1HNZQ

Structure of the thermus thermophilus 30s ribosomal subunit in complex with hygromycin b
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
104
structure length
104
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYQSLSKRGGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structural basis for the action of the antibiotics tetracycline, pactamycin, and hygromycin B on the 30S ribosomal subunit.
pubmed doi rcsb
molecule keywords 16S RIBOSOMAL RNA
molecule tags Ribosome
total genus 16
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2000-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1hnzQ00
2KHJA 4X62L 1XMOL 1UEBA 4UP7A 4DR2Q 1IZ6A 4AQYL 3RN2A 1IBML 1KD1C 2ES2A 5C44H 2F4VQ 2PNHA 5EAYA 1VQLA 3AEVA 3ICEA 4KHPL 1X3GA 3M9BA 1QVCA 3I4NH 1VQIA 4GN3B 4L5RC 1E3PA 1FJGQ 4KHZA 2VQFQ 4A3FH 4DR4Q 4OO1I 4JI3L 5M3FG 2Q2UA 1GVPA 3NELA 5GADC 1EIYB 1QVFA 3BJUA 1D7QA 4B3MQ 3G48A 3I55A 4DR7Q 1C9OA 5C3EG 3GTLH 1JE5A 4JV5L 4IPCA 2D0PA 2UXDL 3W5OA 2R7ZH 1VQHA 3PUWA 4JYAQ 4JI6Q 1EWIA 2JEBI 3K8AA 4NXNQ 4RMFA 3ZJYC 5GAGC 2K5VA 2NVYH 1Y14B 1XNQL 4B3TQ 1VQGA 4A93H 2WB1G 1AE2A 2K5NA 4GLAC 1VQBA 4YHHQ 3RLNA 4IFDI 4R1JA 1K83H 4NXML 4IJLA 2UXBL 5BR8Q 2WB1E 1XMQL 1M90C 1WCMH 1KAWA 5LMNL 1NJIC 4LFCQ 4DV0Q 4IO9A 1KXLA 1VQOA 3K81C 3K7AH 4BXXH 1N9WA 4R4TA 1IBKL 1X3EA 1N34Q 1K0RA 5M3MG 1PA6A 2VS1A 4DV4L 2HHHQ 1SFOH 2PMZE 3A5ZB 3M4PA 1VQNA 4QIWE 1E22A 4DV2Q 4LFAL 1IBLL 1HJPA 1W2BA 1IL2A 4IPDA 1WFQA 4IJHA 4AIMA 2D0OA 1Y1VG 2KCMA 3SGIA 1EIFA 1N8RC 2HT1A 1OXTA 4DK3C 1PH3A 1HNWQ 1AH9A 3CPFA 4A3CG 3STBD 3GTGH 2R92H 3TRZA 3RN5A 3W1GA 4IFDJ 3FKIH 2UXCL 2IX0A 4DV5L 3VDYA 1PH4A 4YWLA 2QEXA 4DV3L 3KDFB 1A0IA 1VQDA 1VQKA 2YTYA 2CWPA 1D8LA 1FGUA 4P73A 1EYGA 3T1YQ 4BBRH 2IHFA 1VQPA 2PI2A 2LSSA 3J7A5 4UP9A 4DR2L 3HOWG 1B8AA 1Q8KA 2HIVA 1SRUA 4LW1A 4LWCA 2RCNA 3CP0A 2VUMH 3UDXA 1HNZQ 4HJAA 2VQFL 4GS3A 2ZJPA 4DR4L 4GOPA 1K8AC 4IOAA 3TS0A 1O7IA 1HH2P 3AFQA 4JG2A 1W3SA 3Q8DA 5H1SE 1VQ7A 1BBUA 4B3ML 4DR7L 3K80C 1X56A 3CCMA 2K75A 3CC7A 2Z0SA 3TREA 3M85A 1YBYA 4GN5A 5M3FH 4JYAL 5GAHC 4JI6L 1YJNA 3ULPA 1L1OB 5IT9c 4B3RL 3ULJA 3G71A 4DV7Q 3RLFA 2B3GA 5C3EH 2NVQH 3S15H 2A19A 4B3TL 4IOCA 2Z6KC 1QUQA 4YHHL 1K73C 2MQHA 1NBWA 3M3YH 3B6YA 2JE6I 2ZTCA 2ZTDA 4JCVE 2MO0A 1HZAA 4LFCL 3JC66 5C4JH 3J81j 4DV0L 2R7DA 2E2HH 4X64Q 1XPUA 4DV1Q 2KCTA 3BU2A 2ZJRA 4JI5Q 1N34L 2YU9H 4GKKL 4HIKA 4OX9Q 2HHHL 4JI7Q 3UDFA 2AHOB 4JOIA 4DV2L 3CCEA 1L2FA 3CPWA 2R93G 4DPGA 1VQAA 3KYHC 3L7ZC 5M3MH 3S24A 3G6EA 2ASBA 1CKOA 1VQJA 1X54A 2WAQG 1KIXA 4BY7G 1Q12A 4GNXA 2WP8J 2E5LQ 5JJKA 4X6AH 4B3SQ 4C2MH 4JI1Q 2PQAB 2VQEL 1Y1VH 2L15A 3PUVA 1PV4A 3S17H 2WAQE 3RZOH 5K36G 1N32L 1L0WA 1I50H 2Q2IA 5HY6A 2N8NA 3PCOB 3H15A 4GOPB 4A3EG 2E2JH 4A3CH 2H5XA 4DAYB 3T1YL 2JA9A 4JBMA 4DAMA 3RNUA 3S1QH 3HOYG 3CW2C 1SR3A 5JEAG 4JI2Q 4LFBQ 4A3BG 1B7YB 5JJLA 1EFWA 5ELOA 1JB7A 1JMCA 2N49A 1JJ2A 2K4KA 1X3FA 1Q1BA 1N36L 1AE3A 3HOWH 3J80i 4DR5Q 4PZ8A 4PMWA 3CD6A 3NENA 1I6HH 1UWVA 5M5XH 3CCRA 2EXDA 5IWAL 1HNXQ 4BBSG 4R4OA 4DR6Q 4HJ8A 1N33Q 3KLWA 4X66L 1TWHH 4NPSA 3PF4A 1SROA 2F52A 2ATWA 4DV7L 4YWKA 2A1AA 3F1ZA 3JAMi 3RZDH 1OXSC 2E8GA 4QJFA 1XJVA 1ASYA 5C4XG 4DUZQ 1JJGA 1PVOA 1YNXA 3J7ZC 1VQMA 3DLLA 1PH9A 1MJCA 1A62A 2OQ0A 1TWAH 3S1RH 3HOZG 2N3SA 1T9HA 2IT1A 1NTGA 3L0OA 1GD7A 1XPRA 2DUDA 1BBWA 4X64L 4DV1L 1BKBA 1YITA 1S40A 1YI2A 3FP9A 5IP7G 1E7ZA 2BA0A 4YCWA 3W1BA 4RG1A 4XTCS 4OX9L 2V1CC 4JI7L 2LXJA 2VW9A 2RF4A 3JAMc 2AKWB 2XGTA 5IYCG 1YHBA 1SMXA 4DR3Q 2E2IH 2IX1A 1G6PA 3HOVG 4GKJQ 5HGQA 3OW2A 3S1NH 1VQFA 3PGZA 5C0XG 2PI2E 5IP9G 1CSPA 4A3DG 1VQ5A 4EX5A 1U0LA 2ZM6Q 2E5LL 2K5HA 4B3SL 4JI1L 4DUYQ 3HOXG 2R93H 4JI8Q 2HQLA 4P72A 3PO3G 1CKMA 1S72A 4HJ5A 4BY7H 2GN5A 2JJQA 5IYBG 4LF9Q 3J81i 3I4MG 5LMUQ 5M5WH 3MXNB 3U4ZA 1EUJA 1OXXK 1X65A 3GTKH 2YTXA 2BH8A 4LFBL 1IXRA 4PZ7A 4A3EH 1KHIA 2MFIA 1QZHA 3L2PA 2YTVA 1PH1A 3CCLA 3HOYH 5IE8A 4R4CA 1L1OC 3A74A 4QL5A 2JEAI 2C35B 4A4IA 3NBHB 1VQ6A 4A3BH 1Q1EA 2F4VL 4DKAC 1WI5A 2MNAA 3TS2A 2A8VA 3PUZA 1HNXL 4DR1Q 1FJGL 1IYJB 4DR6L 1N33L 3J81c 4BY1G 2I5MX 1Q81C 2B63G 2ZJQA 4LF8Q 1EOVA 1WOCA 1J5EQ 1UE5A 3A0JA 4MNOA 1UE1A 1V9PA 1NMGA 4BBSH 2QGQA 4YCUA 2NZOA 3ULLA 4C3JH 4C3HH 4DUZL 1I94Q 3OTOQ 1SLJA 3CAMA 3WWVA 1UE6A 2N78A 4NXNL 2Z6KA 1QVGA 5C4XH 1X6OA 2OTLA 3KF6A 4HIMA 1X55A 2FXQA 2RHQB 4POFA 1SE8A 3S1MH 4BA2I 4YY3Q 4A3LG 2VNUD 2GVAA 3HOZH 1KRTA 2MO1A 2DGYA 3T1HQ 1CKNA 4LF4Q 1BVSA 2K50A 5BR8L 2JQOA 3U50C 4LUVA 4JBWA 1TWGH 4AQYQ 4AYBG 4POGA 4GKJL 4JC0A 5IP7H 1S3OA 4UY8C 3KOJA 3PIOA 3LGJA 1M1KC 1VS0A 1DGSA 3BZKA 1PH7A 1YJ9A 2ID0A 2UUBQ 5IYCH 3AFPA 3E9HA 4NB3A 2AWNA 4A3JG 2UUAQ 2JA8G 4DUYL 1H95A 1J6QA 4LNQA 3CCUA 4JI8L 1VCIA 5IP9H 1FL0A 3EBEA 1HNWL 4A3DH 4P75A 4LF9L 5LMUL 2HIXA 1MIUA 3HOXH 5AJ3Q 1Q86C 5E7NA 1FVIA 1Z47A 2AWOA 1JJCB 2B29A 1GM5A 1E1OA 1LUZA 2BA1A 3PO3H 3PSIA 5JJIA 5IYBH 2LXKA 4EQ5A 1OTCA 3I4MH 1Q82C 5JEAJ 1HZCA 1X9NA 4O2DA 1OXVA 4PG3A 1XMQQ 3I56A 1RL2A 3KFUA 2ZTEA 4DNIA 1HZBA 3E9IA 1YHQA 4DR1L 3E0EA 1RIPA 3PUXA 4O0AA 3H0GG 1HNZL 1HR0W 3CC4A 4DV4Q 1QUQB 1NE3A 3HFZB 4QY7A 5IYDG 1J5EL 3F2CA 3PV0A 3UDIA 1ASZA 1K9MC 1PH6A 3UE1A 1P8LA 4JI4Q 1IBLQ 1HR0Q 1I94L 4BY1H 3IRBA 4A3MG 3OTOL 4R4QA 2B63H 4DK6C 2JA7G 4HIDA 5C0XI 4JI0Q 2VL6A 1WJJA 3GTPH 3PIPA 2UXCQ 3PF5A 3CXCA 3CCJA 2AMCB 3RLOA 1TXYA 1YJWA 4YY3L 4HJ9A 1CSQA 4R4IA 3F8TA 3T1HL 1PH8A 1PHJA 1VQ9A 2JA5G 4OWTB 3J80c 2QA4A 4LF4L 4PZ6A 3I2ZA 1MJEA 4C3IH 3GO5A 2K14A 2JK8A 5GROA 4QGUA 3G4SA 1Q7YC 4A3LH 4YWMA 1YZ6A 1B70B 4GNXB 1C7YA 2EQSA 4A75A 4JI5L 4GLXA 1HZ9A 3S16H 1PYSB 3S14H 4A3GG 2EIFA 1A63A 4HIOA 5FJ8G 3HKSA 2UUBL 2OTJA 2Q2TA 2UUAL 3KDFA 4LUZA 4ME3A 5C0XJ 2UU9Q 1PH5A 2NZHA 3CCSA 2KHIA 1P16A 3FHWA 3AYHB 2NN6G 4TQUS 1EQQA 2JA8H 4A3JH 4LF5Q 4L5SA 2WFWA 2YV5A 3S2DH 5AJ3L 3D0FA 3M4QA 1XNRQ 4K0KQ 2GVBA 4B3RQ 3OYYA 1Z9FA 4FDBA 3STBC 4KLKA 3TQYA 3S2HH 3EIVA 3TEHB 4JBJA 3CC2A 2I5LX 3GTJH 4MTNA 3H3VH 4TVAB 4P74A 3CCVA 3AQQA 4YCVA 4A3IG 4JI2L 3CQZH 1Q46A 2CQOA 3ERSX 4LF6Q 1YHAA 1L1OA 2OQKA 4HJ7A 2KENA 4OXPA 1V1QA 4A3KG 4OO1G 4GKKQ 4WJ3M 3UDGA 4DR5L 1LYLA 2KBNA 2VY3A 1Y1WG 3PO2G 3CCQA 2YYZA 3GDEA 1CUKA 1NMFA 4LUOA 1EQRA 3H0GH 1HR0L 2OWOA 4JI4L 3I4OA 4X65Q 1I5FA 5ELNA 3HOUG 4Y7NH 2IY5B 1V43A 3I7FA 1G291 2BH2A 5IYDH 2I5HA 4J15A 3HKZG 1E24A 5FLMG 2F3IA 4APVA 4JI0L 3GTOH 3KF8B 2R6GA 3UE0A 1A8VA 2VQEQ 4GLVB 4A3MH 2JA6G 3BZCA 3HKZE 3NEMA 2JA7H 2XTIA 1N32Q 4IFDG 3M4OH 1PH2A 1UE7A 3A5UA 4OONA 1YVCA 3CF5A 1GKHA 1VQEA 2Q2HA 4H02A 4UP8A 3RR5A 3CMAA 2R7FA 4BA1I 4DV6Q 1KL9A 3GTMH 3H3VI 3GTQH 3U58A 5C44G 2UUCQ 2JA5H 3K7UC 3MEFA 4JBKA 4LF7Q 2PQAA 1JT8A 1MKHA 3I4NG 4X62Q 3U4VA 1N36Q 4WJ4A 5FLXc 4A3FG 1XMOQ 4DR3L 2UU9L 2NVXH 4GOPC 1IBMQ 2ALYB 4A3GH 4XIGS 1VQ8A 4KHPQ 4KI0A 5FJ8H 3ER0A 5IWAQ 2CCZA 1K8GA 2CFMA 3EN2A 1PFSA 4AYBE 4LF5L 3PUYA 2ZM6L 1LTLA 4X66Q 2K52A 2Y0SG 4JI3Q 5M5YH 1R9TH 1XNRL 3HOVH 2R7ZG 4K0KL 4MZ9A 2CKZB 2Y0SE 4GN4B 3CMEA 2I0QA 1TWFH 4JV5Q 4A93G 1LM0A 1GO3E 2UXDQ 5IY0A 1I3QH 1PYBA 1SN8A 3F2BA 2VZAA 1XTDA 3GD7A 1XNQQ 1WCMG 2IHEA 1NY4A 3KJPA 1KC8C 5LMNW 4LF6L 4QQBX 2RHSB 4UPAA 1E1TA 4BXXG 4NXMQ 4A3IH 2UXBQ 1YEZA 5J3BA 4Y52H 5LMNQ 3F2DA 4OWWB 4JOIC 1OXUA 1TWCH 4X65L 1VQ4A 4A3KH 2D62A 1QZGA 1IBKQ 1YIJA 3M7NA 3KF6B 4ALPA 4LF8L 4IPHA 2CWAA 3PO2H 1Y1WH 4AH6A 2R92G 1VQCA 4LFAQ 4GNXC 3FKIG 2NVTH 1CKNB 4L5TA 3HOUH 1K3RA 4A76A 3D31A 1XPOA 5FLMH 1WYDA 2NN6I 4P71A 5GAEC 4OWXB 4BBRG 2JA6H 3KJOA 1G51A 4DV6L 4DV5Q 2OCEA 4DV3Q 4IPGA 5DLQE 3K0XA 3DM3A 1KQSA 2UUCL 4LF7L 1KRSA 1C0AA 5GQOA 4L5QA 2VUMG 1U5KA
chains in the Genus database with same CATH superfamily
1SXTA 2KHJA 1UEBA 1IZ6A 4AQYL 4KD4A 1PRTB 3OMCA 2F4VQ 1HFGA 4DFAA 3M9BA 4RGOS 1QVCA 1T5XD 2L1BA 4GN3B 1E3PA 1IKMA 2VQFQ 3OWFA 1F9QA 4OO1I 3S14B 5M3FG 2F0NA 1LTTD 5KNBA 1QVFA 3KLSA 4DR7Q 5C3EG 3GTLH 1JE5A 4IPCA 4CGYB 3KBGA 3W5OA 1BOSA 3PUWA 1D5ZC 5J1ZA 4QB4A 4A3JB 1GUNA 1Y14B 4C1NI 4B3TQ 3IAYA 1AE2A 1VF7A 4HSPA 1VQBA 5LL6X 1K83H 1ILPA 1TY2A 3C1FA 3DUZA 3WOEA 2RDFA 1HUNA 1HRJA 1DJRD 1XYIA 1KAWA 5LMNL 3GTJB 3TMEA 1TS5A 1VQOA 4BXXH 2M2LA 2NUCA 1PA6A 5FKAC 1SFOH 2PMZE 2I07B 1E22A 4NKLA 2WKCA 2G9HD 2KCMA 3AU7A 1OXTA 1HNWQ 3STBD 2R92H 3W1GA 3NTIA 3FKIH 2UXCL 2IX0A 4DV5L 1Z7TA 1PH4A 1CQVA 4R8NA 3NE5B 1FGUA 4P73A 2IHFA 3NQTA 5E1FA 2LSSA 3M4OB 2JSOA 3NSWA 4DR2L 4RWSC 2HIVA 4LW1A 1EZ6A 3CP0A 2B2YC 4ZQ3A 4DR4L 3NQIA 2B2UA 1K8AC 3TS0A 3GQBA 4JG2A 1VQ7A 1H9RA 1JWSD 1O78A 4OIJA 5IT9L 1TY0A 2PZWA 3TREA 5C6AA 3NWTA 4GN5A 5M3FH 5GAHC 4JI6L 1IL8A 4IALA 3ULPA 5D65A 5IT9c 4B3RL 3G71A 1IKLA 5C3EH 2A19A 1RODA 2EDGA 2Z6KC 2VB2X 1QUQA 5M5YB 1B9MA 2MQHA 3M3YH 4UDUC 4JCVE 5KYLA 1TWFB 1O7YA 2RCFA 5ELDA 5C4JH 2R7DA 4X64Q 4DV1Q 3BU2A 4FXDA 2D9UA 2B2WA 3BYYB 3CRKC 3E6ZX 4JI7Q 1D2BA 3KLRA 3V05A 1GHJA 1EY4A 3FRPB 1VQJA 2WAQG 1Q12A 4GNXA 4A3KB 4RHSA 4C2MH 4JI1Q 2PQAB 4V0BA 2HDMA 5K36G 2WAQE 1N32L 2AUKA 5HY6A 3PCOB 1SE4A 2NYZD 1A3VA 3T1YL 2JA9A 3RNUA 3S1QH 3MFGA 1BCPB 2A6HC 1SR3A 1TQOA 2CQAA 4JI2Q 3Q22A 5JJLA 1EFWA 2N49A 2L0CA 1CZWA 2H1EA 4DAVA 1JJ2A 2K4KA 1X3FA 3DEPA 1AE3A 1N36L 1EZ8A 4HR7B 4PMBA 3CD6A 1I6HH 1HTPA 2G5DA 4N9TA 4BBSG 5C44B 1F9RA 3I4LA 3I4NB 3PF4A 2K01A 4DV7L 2A1AA 3F1ZA 2QEJC 4A3FB 3H3VC 2LY7A 3KBXA 1TWHB 5C4XG 1DYQA 1F2MA 4BWGB 2EYFA 1PVOA 3DLLA 1MJCA 3S1RH 1BF4A 2IT1A 1GD7A 3VR6A 3T53B 3EA6A 2NVYB 2F3WA 4ABNA 1Z6HA 3W1BA 4RG1A 4XTCS 4A93B 2V1CC 2VW9A 2F0VA 4DR3Q 2R3ZA 2A6EC 3S1NH 1WCMB 5C0XG 2A69C 2SOBA 5IP9G 3K7AB 1DXMA 4EX5A 1U0LA 3VA7A 2E5LL 5EJWA 5T1GA 3HOXG 3S9WA 2Q8TA 1IHZA 5IT9E 1LT5D 4WRDA 1T5EA 5M5WH 5LMUQ 1X65A 5K36H 2YTXA 1IXRA 4CBVA 1QWYA 2K05A 4TSSA 1QZHA 2YTVA 3CCLA 1H9KA 5IE8A 1LT6D 3J81L 4KKUA 4G7OC 3HOYB 4OEMB 1G8ZD 2A8VA 1HNXL 4DR1Q 3J81c 3MHBA 2ZJQA 2V4DA 1EOVA 1WOCA 4EGVA 1UE5A 2K33A 3A0JA 3EROA 2F0MA 4BBSH 2QGQA 5D3DA 3ULLA 2ICEC 1EFID 4KKSA 3ND9A 1CK1A 4C3JB 1ESFA 3TDQA 5C4XH 5CR3A 4C3IG 1SMYC 4HIMA 1X55A 4A3LG 3H94A 2NVQB 4BA2I 4YY3Q 2VNUD 3S15B 2EYMA 2GVAA 3PIP3 2MO1A 4LF4Q 1BVSA 1VMCA 4TRDA 4LUVA 4JBWA 1TWGH 4K8IA 4AQYQ 2Z8LA 4GKJL 4S3SA 1S3OA 3PIOA 2E2HB 2H4OA 3I70A 1YJ9A 1WTPA 1H95A 1JR0D 4FF1A 5EKIA 2JA8G 4DUYL 4CKEA 3VA5A 3CCUA 1II3A 4ID6A 5C0XH 4G7ZC 5IP9H 3EBEA 3D6CA 4P75A 4J8QA 5M3MB 2HIXA 3HOXH 1LTAD 2F0DA 1Z47A 4KK7A 1K8OA 2VB3X 4FF2A 1OTCA 3EJIA 3S17B 1HZCA 2E2JB 3A54A 2WINB 4DNTB 2M00A 4X3UA 3KFUA 2Z4IA 3T51B 4DNIA 1HZBA 1K28A 1UAPA 5ELCA 3PUXA 4O0AA 2N88A 4QY7A 3F2CA 3PV0A 4KTAA 3UE1A 1FR3A 3HOWB 4K8JA 3IRBA 5JVG3 1PRTD 2XWJB 4R4QA 2NZ1D 4KN7C 1WJJA 1PFNA 5ELBA 1Y8OB 2UXCQ 3PF5A 1A3UA 2AMCB 3RLOA 1YJWA 1CSQA 3C46A 4R4IA 3T1HL 3HS0C 1PTOF 4OWTB 1TT2A 3J80c 4C3IH 4A3LH 1TWAB 3S2HH 1YZ6A 1B70B 1SNOA 4A75A 1SAPA 4A3GG 3R3OA 4UAIA 5FJ8G 2EVBA 1PMRA 2UUAL 3KDFA 1DOKA 1KDCA 1HQRD 4DXGA 4ME3A 2UU9Q 1AW7A 1V1OA 3J81E 1NR4A 5KEEA 2NZHA 3CCSA 2KHIA 4C1NK 2E2IB 1P16A 2MHVA 3AYHB 3FHWA 2JA8H 2I46A 1RF2D 2IPKD 4L5SA 1B50A 4RGNA 3D0FA 2GVBA 3OPOA 2D2CC 4B3RQ 4EQOA 2Z1CA 4IQZA 1EY9A 4FF4A 1KTKA 1WD1A 3TQYA 3EIVA 3TEHB 4JBJA 2OT2A 4MTNA 4TVAB 4P74A 1EIGA 1EY0A 3C2PA 1QNUA 2CQOA 3ERSX 4LF6Q 4UHVA 1Y8NB 1EYCA 1LYLA 2XRQD 3PO2G 1Y1WG 3CCQA 2YYZA 3GDEA 4JI4L 1FNVA 1NMFA 1EQRA 2K1BA 3HOUG 3SE0A 2IY5B 3H0GB 4JI0L 5FLMG 3UE0A 5C4HA 1JORA 1A8VA 2B2VA 2BE5D 3BZCA 1PDQA 1N32Q 2L5TA 1SDFA 5BN3A 1BDOA 2ZXPA 1UE7A 4C3HB 3A5UA 1YVCA 1VQEA 2F0KA 2KHSA 1D5XC 4UP8A 2R7FA 4BA1I 1KL9A 3GTMH 3H3VI 1TS3A 3MEFA 1XXGA 1BO0A 3OIQA 2JP1A 4X62Q 1N36Q 4WJ4A 5A2QL 4IUPA 5FLXc 2F3VA 2B2UC 4A3GH 3IFDA 3K0YA 5FJ8H 4G4KA 3HGBA 1VDZA 4AYBE 3SEBA 2ZM6L 1EU3A 2Y0SG 4NW2A 1R9TH 4HN7A 4K0KL 2CKZB 2MGSA 2Y0SE 3HOVB 4GN4B 4JV5Q 1HA6A 4B08A 1AN8A 1I3QH 1PYBA 1TS2A 1ZEQX 3MAQA 2FMMA 4QQBX 2E74C 3PO3B 5D3IB 1SYGA 4NXMQ 3N52A 1C8CA 3I4MB 2UXBQ 1YEZA 3WOFA 2B2WC 1BCPD 1TWCH 2D62A 1IBKQ 1JC7A 3KF6B 1MGSA 3PO2H 1Y1WH 4AH6A 1VQCA 3F2UA 3MFYA 4KY7A 4LFAQ 4GNXC 4H7BA 2NVTH 3HOUH 4A76A 1XPOA 5FLMH 4RCOA 1TIID 4RGTA 3C1EA 5GAEC 4P71A 2B63B 2Q8IB 3KJOA 2EY6A 2Q8RE 1IYVA 2OCEA 3K0XA 3ITPA 1PXUA 2F0UA 5FO7B 1STGA 2KEEA 1XMOL 4UP7A 1IBML 1DOLA 2KEDA 1KD1C 5EAYA 4KHPL 1XX8A 1VQIA 4M1UB 4L5RC 4KHZA 3NPPA 2AQ1B 2EYHA 4M8AA 2EY1A 2DNEA 4ZAIA 1U4PA 3A55A 5CBAE 1EY5A 2UXDL 3P20A 1VQHA 2CH4W 5IGFA 4RMFA 2K5VA 1XNQL 1S4ZA 4I65A 4GLAC 3RLNA 1LT3D 1E2ZA 2XN9C 1SNPA 1K83B 1K8MA 4DF7A 1NJIC 3NTHA 4DV0Q 4IO9A 3SK6A 1KXLA 4R4TA 2B2TA 1HCZA 3CQZB 5F2DA 4DV4L 2MUYA 2HHHQ 1W6KA 1VQNA 4QIWE 1W2BA 5A2QE 1IL2A 4IPDA 4IJHA 3SGIA 3CPFA 3GTGH 3IKJA 3TRZA 3RN5A 4WORA 5C3XA 4Y7NB 4IFDJ 2PW5A 3A7AB 3VDYA 3GTOB 4DV3L 1KDBA 1VQKA 3R2TA 2RSNA 1D8LA 1V8QA 1VQPA 1BBXC 4X3TA 3J7A5 1NSNS 3LWEA 1GUWA 2K5QA 2PO4A 1H9SA 1O7ZA 3ND8A 4GS3A 2ZJPA 4HJAA 4GOPA 4IOAA 5C5LA 3AFQA 1W3SA 4LK1C 1EEFD 5H1SE 4B3ML 3K80C 2QILA 2K75A 3CC7A 1KLGD 2Z0SA 4CKCA 4K2KA 3H09A 4JYAL 1YJNA 1DD2A 3ULJA 3RLFA 2B3GA 5M3FB 4E6IA 1STNA 2ZT9C 4YHHL 1NBWA 2R61A 5CYUA 2MO0A 4LFCL 1ENCA 3JC66 4ZYSA 1JWMD 5EKKA 2ZJRA 1J8IA 5C4JB 1N34L 2NB0A 2YU9H 1MHWC 1D5MC 1SJED 3IL8A 2EJMA 2KCCA 4JOIA 2J4XA 2EYJA 5I4DA 4DV2L 3P1HA 4K5VA 4A3IB 2R93G 4DPGA 1VQAA 3L7ZC 2MP1A 2ASBA 2PMZB 4YIJA 3MXUA 1RHPA 2WP8J 5JJKA 4B3SQ 2VQEL 4GOPB 4A3EG 2JYOA 4PV1C 2RBMA 4DAYB 5C3WA 1TR5A 5JEAG 1A15A 1PZJD 1QCBD 4K6DA 2JA6B 1PZID 3K58A 3MZ5A 1YNJD 1IW7D 3MXGA 4PZ8A 4PMWA 4JK1C 5M5XH 3MXNA 1QOHA 1QJOA 4OIKA 4R4OA 5E4WC 3CRLC 4HJ8A 1I6HB 3KLWA 4NPSA 2BDNA 2XSCA 4RAUC 3ONAB 3K57A 2ATWA 4KJOA 4FO2A 3NHHA 5CORA 1JJGA 1EQVA 1YNXA 4O42A 1L0XB 1LTRD 2OQ0A 5ELEA 2N3SA 3L0OA 5IODA 1BBWA 1F2LA 1YITA 1B4OA 3URYA 1S40A 2WIIB 3FP9A 1X3PA 1E7ZA 4YCWA 5IP7G 1HPCA 4OX9L 2LXJA 2RF4A 4F7XA 2XGTA 5IIFA 1NR2A 5IYCG 1PYWD 4J6HA 1G6PA 5HGQA 3OW2A 1VQFA 3PGZA 1HUMA 2NTTA 3BVGA 1CSPA 2IWHA 4CDDC 1VQ5A 1DONA 2ZM6Q 1WTOA 1LT4D 2R93H 4FVMA 2HQLA 4P72A 1S72A 4LF9Q 4XXEA 3MXNB 2WAQB 1WTQA 3GTKH 3QJYA 1B44D 2BH8A 5M5WB 4LFBL 4A3EH 1KHIA 4FXGC 1A6XA 3L2PA 1PTOC 3T56B 4QL5A 5JEAH 2JEAI 2HD3A 2LFNA 1ENFA 2JXMB 2QF7A 4BBRB 1WI5A 1O80A 2F0JA 3IFTA 1FJGL 4DR6L 1IYJB 5KNDA 1N33L 4BY1G 3VR5A 2I5MX 1J5EQ 1UE1A 2TMPA 1GUTA 1V9PA 1NMGA 2X69A 4DUZL 1I94Q 3GV6A 2B2VC 3OTOQ 4BBSB 5I2XA 2N78A 2A68C 4CJ1B 1D6EC 5TSSA 2NTSA 2OTLA 1F2YA 4POFA 1SE8A 2KCNA 2DGYA 1CKNA 2K50A 2JQOA 3OWEB 1S5CD 5IP7H 4NMZA 1M1KC 3NTKA 1VS0A 1DGSA 1WTWA 2ID0A 2JN4A 5IYCH 1MI2A 3E9HA 4NB3A 4A3JG 5I6YA 3J7AF 2OEOA 4JI8L 4RA8A 4DNRB 1FL0A 2FMCA 1ML0D 5CV4A 1Q86C 2AWOA 1LUZA 2BA1A 1CA6A 3HOXB 1Y1VB 4FNFA 3RZOB 5CBEE 4O2DA 1OXVA 1EWCA 3I72A 1MSGA 2A74C 1TVXA 3SK5A 2QDLA 5CV5A 3I56A 1RL2A 2ZTEA 2BOSA 3E9IA 1RIPA 2WV6D 3CC4A 1GXDC 4XQQA 4PMCA 4ZKCB 4DV4Q 2EYOA 1QUQB 5IYDG 1F2ZA 1B1ZA 1RTNA 1E0BA 1PH6A 1P8LA 1HR0Q 4BY1H 1Q3LA 3VYTA 5FO9B 3PIPA 1FD7D 3CXCA 3SHLA 1TXYA 1LABA 3RZDB 4RCNA 2JA5G 1E2VA 1SE3A 4IUNA 2QA4A 3I2ZA 4KV6A 2K14A 4QGUA 1Q7YC 4GNXB 3SVMA 4GLXA 4JI5L 1HZ9A 3S14H 2EIFA 2O5JC 2UUBL 4PQXA 1I4QA 5C0XJ 2EJFC 4L63B 4A3JH 4LF5Q 5AJ3L 1SNQA 1XNRQ 1I4GA 2JA8B 2HCIA 1Z9FA 4FDBA 5CV7A 3U9SA 4RH6A 3MTSA 3GTJH 2L9HA 4BY7B 5C4ZA 5K5PA 1YHAA 1L1OA 2OQKA 4HJ7A 2A6ED 1V1QA 4A3KG 4OO1G 2B2TC 3TZDA 2P5ZX 2A69D 2CW0C 2KBNA 2VY3A 3M4YA 4ZK9B 4TKOB 1JB3A 1M4VA 3I4OA 5ELNA 4QUCA 1V43A 3I7FA 4ME5A 2BH2A 5IYDH 4OGQC 3VYSA 2DN8A 2VQEQ 1CA5A 1Y69U 2KUMA 1A3TA 3M4OH 4R9WA 4H02A 2Q2HA 3RR5A 4KJNA 3CMAA 5C44G 2UUCQ 2JA5H 4LF7Q 4JBKA 3T4AC 1MKHA 3I4NG 3S1MB 4A3FG 3HOZB 4GOPC 1H9JA 3OIPA 4XIGS 1CTMA 2OXPA 2CCZA 5JJZA 2RDHA 3TP5A 1K8GA 4A3GB 3PUYA 5ELFA 2K52A 3K6OA 2R7ZG 5M5YH 3A7LA 2CVRA 3M7GA 4MZ9A 2I0QA 3CMEA 1TWFH 4A93G 1SMYD 5DAUA 4A3DB 3F2BA 2VZAA 4IZ8A 1WCMG 1KC8C 2RHSB 1E1TA 2XRSD 3DXJC 5LMNQ 1D1IA 4OWWB 4CKBA 4JOIC 3SR1A 4X65L 1VQ4A 4A3KH 4OO1H 2KVMA 1O7LA 1BNZA 2N55A 1LLRD 4IPHA 3ZYYX 1XTCD 3PMFA 4L5TA 4U673 1H9MA 2IW3A 3D31A 1DOMA 4XT1B 5T1IA 2NN6I 1EEID 4DK1A 4DV6L 4DV5Q 2SEBD 4IPGA 1PFMA 3DM3A 1KQSA 4V190 5GQOA 3KUPA 2VUMG 2K5WA 4DR2Q 2RSOA 2ES2A 2E76C 5C44H 1VQLA 3AEVA 3I4NH 1CM9A 1FJGQ 1AEXA 4A3FH 4DR4Q 2K03A 4JI3L 2Q2UA 1GVPA 3NELA 1STYA 5GADC 1EIYB 1D7QA 4AYBB 1C9OA 4DU9A 3NBHA 2R7ZH 4H44C 4JI6Q 3K8AA 3U9OA 2NVYH 3S2DB 1EY6A 3TN2A 1LV9A 4A93H 2WB1G 5LL6S 2K5NA 1CHQD 2FFKB 4IFDI 4HMIA 4R1JA 1DZ1A 1JICA 2WB1E 1WCMH 2F0QA 2PYKA 3BZDB 3T16A 1WTHA 3K81C 3K7AH 1N9WA 1RD9D 3HZXA 5M3MG 2VS1A 4OL7A 5KRUA 3M4PA 2IL8A 4JPBW 1ILQA 4KN4C 1IBLL 1SJHD 2D0OA 1EIFA 1N8RC 4DK3C 1PH3A 4N9PA 2F0IA 4RKBA 5EKLA 5A35A 5I6WA 5HURA 1WD0A 3FPPA 3KDFB 4RGMA 3PQIA 2YTYA 4A3MB 1EYGA 3T1YQ 3HP3A 4LJZC 2JA7B 1D1KA 1NUCA 4UP9A 2RKSA 2EY5A 3HOWG 1B8AA 5EBCA 1SRUA 1CHPD 1U9RA 2ZXOA 4LWCA 2RCNA 2VUMH 3GTQB 2VQFL 1PZKD 4MIUA 1JQYD 2F0GA 2F0WA 1O7IA 1HH2P 5BN5A 2Z4HA 3Q8DA 1U4RA 4DR7L 1X56A 5E4XA 5KNCA 2NVXB 3M85A 1YBYA 1YNNC 2F0HA 4Q5VA 1PTOB 2A73B 4ILWA 1LO5D 1KABA 4DV7Q 2NVQH 1BQQT 3BDOA 3S15H 4B3TL 3EFXD 5J22A 1K73C 1CFMA 1BXTA 2JE6I 2ZTCA 2C9OA 2SNMA 3J81j 2F0SA 5BN4A 2E2HH 2KCTA 5DM63 4JI5Q 3QO2A 1KAAA 3UDFA 2AHOB 3CCEA 1WTXA 1L2FA 2QCPX 4OHJA 4IUQA 5M3MH 1S5ED 4DN4M 4F87A 1X54A 1CI3M 4RFBA 4KKTA 4Z9CB 4B9WA 2E5LQ 1CT1D 2L15A 3PUVA 1PV4A 3S17H 1L0WA 1I50H 2Q2IA 3NBIA 2N8NA 2E2JH 2PW7A 2H5XA 4IURA 5D14A 2DJFC 5EPJA 3CW2C 1SYBA 2QKIC 4A3BG 1B7YB 3A8JE 3K5OA 1QB5D 4CJ2C 1Q1BA 3HOWH 1LTID 3J80i 3W2DA 4KHVA 3I90A 1UWVA 5I9PA 3CCRA 2K04A 2EXDA 5IWAL 1HNXQ 3SDZA 4C3HG 2HCCA 4X66L 1EIHA 1QNKA 2F52A 1CQFA 3I3CA 4HSVA 4YWKA 3JAMi 4R8IA 2Z6BA 1SE2A 2XIWA 4QJFA 3Q0AA 1ASYA 4HEDA 4HCEA 1SBBB 2LKVA 3GTLB 1TWAH 1RCVD 1T9HA 1A2TA 4I7ZC 2EOTA 4X64L 4DV1L 3I73A 4K6LA 1BKBA 2DJGC 3KF8A 2BA0A 1B3AA 4IUTA 1ONLA 4JI7L 2E2IH 3BDLA 1YHBA 1EY7A 3HOVG 4GKJQ 1JOQA 1A2UA 1STEA 3R8BA 3A8IE 1JE4A 2K5HA 4JI1L 4DUYQ 1SFOB 3PO3G 3DWAA 1KDAA 4HJ5A 2R93B 2GN5A 2JJQA 5EPLA 5IYBG 3I4MG 2PZUA 1EUJA 1OXXK 4H0LC 3TZUA 4QMGA 2R92B 1RTOA 3FKIB 1BR9A 1PH1A 4A3EB 4R4CA 1L1OC 3A74A 4ZLTF 4A4IA 3N6RA 1VQ6A 3UI2A 2D5DA 1AZQA 4A3BH 2XNAC 1Q1EA 1V1PA 2F0EA 5C5MA 1Q81C 2B63G 4X3KA 1ICFB 1AP0A 4EVOA 4RHRA 3TP7A 1PRTF 3TP6A 4YCUA 2NZOA 2XWBB 3CHBD 4C3HH 2M9VA 4DXFA 3CAMA 2K5DA 3P7JA 1M8AA 1ZYRC 4NXNL 2X6LA 1QVGA 2FXQA 2RHQB 5C3EB 1SNDA 1KRTA 3T1HQ 3KK7A 5BR8L 3M3YB 1PLFA 1I4HA 3MA2B 4PNYA 4JC0A 5IGEA 3KOJA 3LGJA 3BZKA 2C5CA 3AFPA 2UUAQ 1JOOA 1K3BC 2F0LA 4DAPA 1J6QA 1G2SA 5KYIA 5LMUL 3OHXC 4XDXA 2B29A 3DWPA 4MTKA 1H9SB 3PO3H 5JJIA 3TP8A 3FEWX 5DEHA 4C2MB 4EQ5A 5IYBH 3I4MH 1WTRA 3D3RA 5JEAJ 1X9NA 4PG3A 3KLSX 3MEHA 4F88A 4O1NA 3S1QB 3DEOA 2VXWA 2PNRC 4DR1L 1HNZL 1HR0W 3QB3A 3CKIB 4CDEC 1K9MC 2B8GA 4JI4Q 1IBLQ 3RUZA 4FYDA 3G6JB 2QDBA 2B63H 2PPBC 2SNSA 5C0XI 4BY1B 1C4QA 4JI0Q 2VL6A 5ISRA 3GTPH 2LMCB 4YY3L 4HJ9A 2B39A 1PHJA 4LF4L 5CC4A 2JK8A 2L55A 3S1RB 4FF3A 2EYPA 1A63A 3S16H 3K59A 3SK8A 2XVSA 4HIOA 3HKSA 2OTJA 1Q90A 5JAVA 1FNWA 3VYUA 2AUJD 2NBFA 2Q2TA 3D4WA 4N8X1 1PH5A 4XYQA 1VF5C 1GHKA 4ZKBB 4TQUS 3OW7A 3S1NB 3BG3A 3G7LA 4K0KQ 2GA4B 3OYYA 3STBC 1EY8A 1EYDA 4KMUC 3T13A 5EBDA 3CC2A 2I5LX 3O13A 3H3VH 3CCVA 4YCVA 4A3IG 3CQZH 3SXHA 3R93A 1SYCA 4KY6A 1SEBD 1E2WA 4WJ3M 1BCPF 4DR5L 5COYA 3P75A 4DK0A 1CUKA 1I6VC 1HA5A 4HCSA 3X3MA 1I5FA 1GUOA 4Y7NH 1G291 4J15A 3HKZG 1E24A 3GTOH 4APVA 4GLVB 2JA6G 2IJ0A 3HKZE 5CV9A 1EOTA 4OONA 2Z9HA 2EJGC 1PTOD 2O4XA 3MC0B 2EPBA 3U58A 2EXZA 5C4XB 5CV6A 2PQAA 3WDNA 3NXWA 2RVLA 3U4VA 2JA5B 1G91A 2BCOA 1XMOQ 1MD2D 2UU9L 5EGTA 1IBMQ 4ODGA 4KHPQ 4KI0A 1TWGB 5IWAQ 1J9OA 3D6WA 3EN2A 2K32A 1LTLA 2L4NA 4X66Q 1ICWA 2A68D 3SK4A 4HTHA 1GO3E 2UXDQ 1NNXA 2DY7A 3Q24A 5CGKA 3GD7A 1XNQQ 3E3XA 3KJPA 1NY4A 5LMNW 4LF6L 1STBA 3H6MA 3NP8A 1QILA 4A3IH 2WACA 4I7AA 1QG7A 3L3OC 3F2DA 1OXUA 4DA2A 1QZGA 2F0FA 1YIJA 4MN3A 5EPKA 3M7NA 1JOKA 4ALPA 3BVZA 4LF8L 2CWAA 2EYLA 1HFNA 2ICIA 4ZCKA 1DM0B 1CKNB 4F8MA 4IUVA 2K28A 1B3QA 2SDFA 1K0SA 4OWXB 3A56A 4BBRG 2JA6H 4N8FA 4CJ0B 2EY2A 3FVQA 2A6HD 4DV3Q 1C0AA 2B8FA 4GZYC 4MHEA 1EL0A 4L5QA 1U5KA 5JPNC 4X62L 4K14A 5FOBB 3RN2A 5FO8B 3QWNA 2PNHA 3I8ZA 3ICEA 4C3IB 1X3GA 4J1MA 3S2HB 1LACA 1AFPA 3HG9A 1ENAA 3NK9A 2EE1A 3BJUA 4B3MQ 3G48A 3I55A 4JV5L 2F0PA 5IGDA 2FINB 2O2LD 2D0PA 1FYCA 4JYAQ 3NWSA 1EWIA 2JEBI 4NXNQ 4JW0A 3ZJYC 5GAGC 2R7ZB 1VQGA 1JCKB 4YHHQ 4LAAA 3QG1A 4XYOA 4NXML 3LX0A 4IJLA 2UXBL 3DWQA 5BR8Q 1XMQL 1M90C 2FJ2A 4LFCQ 2PZTA 1IBKL 1X3EA 4LMQD 1N34Q 5L37A 1K0RA 4L6TB 1TS4A 3A5ZB 4DV2Q 4LFAL 1HJPA 4AIMA 1WFQA 4G57A 2IX1A 1Y1VG 2PCFB 2HT1A 1AH9A 4A3CG 3EQLC 4YWLA 2QEXA 5LHY1 1A0IA 1VQDA 2CWPA 3CU7A 2DY8A 4BBRH 1UEAB 2PI2A 3DMUA 3OSOA 5JOBA 1Q8KA 2L12A 4XQJA 4WJWA 1RJTA 2CW0D 3GTMB 3UDXA 1HNZQ 2VUMB 4IN3A 4ZUJA 3AMUA 1BBUA 3BS1A 3CCMA 3BDCA 5JVH3 1LTGD 2MPMA 1L1OB 3V2TA 4OELB 4IOCA 1GUGA 1R9TB 1S5DD 3B6YA 2ZTDA 1FNUA 2BDOA 1HZAA 3DM1A 4KD3A 1XPUA 4DV0L 1I3QB 4EQPA 1IYUA 3X3NA 3BYTB 2WB1B 2IX3A 4GKKL 4HIKA 4OX9Q 2HHHL 3CPWA 2HDLA 3KYHC 3G6EA 3RD4A 3S24A 1CZGA 2K7VA 2RA4A 3A8KE 1CKOA 5DM73 1KIXA 4BY7G 1TWCB 3TSSA 3R2IA 2QW7A 3ERQA 1PRTC 4X6AH 1Q8IA 1Y1VH 3PO2B 5IGCA 1Y1WB 3RZOH 1SYEA 3H15A 4A3CH 1I4XA 2NVTB 3HOUB 4JBMA 4EQNA 4DAMA 5JPMC 1I50B 3HOYG 5KGUA 2AQ3B 4LFBQ 5G3LD 2HUGA 3NUCA 5FK9C 4NDXA 2L11A 4G7HC 5ELOA 1JB7A 1JMCA 3W3AA 1S5BD 3HRZC 4DR5Q 2F03A 3NENA 5HGTA 1Y8PB 4DR6Q 4C3JG 1N33Q 3LNNA 3Q6SA 1TWHH 1SROA 3VYRA 2ZXRA 3RZDH 1OXSC 2E8GA 3J80L 1XJVA 4DUZQ 4H13C 3J7ZC 5I9OA 1VQMA 1PH9A 1A62A 3HOZG 1F77A 1NTGA 2Y0SB 1XPRA 2DUDA 3JAML 1ET6A 2PQEA 1RKNA 1YI2A 5E3FA 3JAMc 2AKWB 1SMXA 3MXPA 4ULLA 3QOLA 2ENBA 5M9OA 2J7ZA 3QR8A 1HQMC 2PI2E 1NCVA 4A3DG 4B3SL 3LWUA 3BVMA 3PIO3 4IUUA 4JI8Q 1JWUD 1AZPA 1CKMA 4BY7H 3J81i 1ZKOA 3FDTA 2BE5C 3Q23A 3U4ZA 5AFWA 4CHTB 2NWGA 4QF4A 1B9NA 3GTGB 1KNAA 4PZ7A 1TKWB 2G9DA 3J7AV 2MFIA 1GUSA 3HOYH 3VR2A 2E2DC 2C35B 3NBHB 3AB9A 1S5FD 1C48A 2F4VL 4DGZA 4DKAC 2MNAA 3TS2A 2B2YA 3PUZA 4A3BB 1STHA 1HXYD 3K5NA 1ZXTA 4KY5A 4LF8Q 4MNOA 4XQNA 4C3JH 3GV3A 1WTVA 3V96A 1I4PA 1SLJA 3WWVA 1UE6A 4HMJA 1LTBD 2CH4A 2LS01 2Z6KA 2F4IA 1KLUD 1X6OA 3KF6A 2MJ8A 2K6AA 5FLXL 4B9XA 3S1MH 4FXKC 3HOZH 3OOCA 3U50C 4BS9A 4CDCC 1X3QA 4AYBG 2F1MA 4POGA 2TSSA 3RMHA 4UY8C 5IGBA 1PH7A 1BCPC 1L0YB 2UUBQ 1EU4A 2AWNA 2YU9B 3K5LA 1F9PA 3GP7A 4LNQA 1YNND 3FMCA 3K5MA 2A5HA 1VCIA 1W6JA 3D4DA 4A3DH 1HNWL 1B53A 4LF9L 4QIWB 1MIUA 2RQXA 3C3LA 5AJ3Q 1R4PB 1FVIA 5E7NA 1JJCB 1GM5A 1E1OA 3PSIA 1SYDA 2LXKA 3J80E 1Q82C 2F0TA 1RDPD 1LTSD 1PFBA 1XMQQ 4XT3B 2KOLA 2OF1A 1YHQA 3E0EA 3H0GG 3JAME 3QIAA 5CMDA 1NE3A 3HFZB 1J5EL 1ASZA 1F9SA 3UDIA 4ZRZA 3VR3A 1I94L 2WKDA 4K5XA 4A3MG 3OTOL 2JA7G 4DK6C 5I2YA 5M5XB 4NP5A 4HIDA 4JVZA 3MWYW 3QOJA 3CCJA 3GTPB 1BUVT 3F8TA 1PH8A 1VQ9A 4PZ6A 1MJEA 3GO5A 3G4SA 5GROA 4YWMA 1C7YA 2EQSA 1OO9B 1GOZA 1G6ZA 1PYSB 1XWEA 1EWHA 3S16B 4U68A 4LUZA 1UUPA 3EVQA 2NN6G 1SSOA 3L9AX 1EQQA 2WFWA 2YV5A 3S2DH 4HAEA 3M4QA 4KLKA 1MSHA 1EYAA 3FPUB 1SNCA 3AQQA 4FP5D 4JI2L 1U4LA 2F0OA 4ZUIA 1Q46A 5DNFA 3GTKB 2KENA 4OXPA 5FLXE 1QE6A 4GKKQ 4L8JA 3UDGA 3MVVA 1NAPA 3E5SA 3H91A 1DCZA 4LUOA 3I91A 1HR0L 2OWOA 3H0GH 4X65Q 2I5HA 2F3IA 3KF8B 1HTLD 2R6GA 5IOCA 4A3MH 2HQEA 2JA7H 3NEMA 2XTIA 4IFDG 1PH2A 5J39A 2RDGA 2KECA 3CF5A 1GKHA 5G3LF 1ESRA 4DV6Q 1ET9A 3GTQH 2KQ3A 3K7UC 4X3SA 4QCLA 1JT8A 2KA7A 5CV8A 1R4QB 4DR3L 4K5WA 2NVXH 1UNSA 4DAYA 2ALYB 4P2CB 1VQ8A 1PTOH 3HEJA 3ER0A 2CFMA 1PFSA 1I4RA 1SYFA 2CHBD 4LF5L 1XNRL 4JI3Q 3DHQA 3HOVH 4RKLA 2NN6H 1VMPA 1EQTA 1ZYRD 2E75C 1HHVA 4C56C 3D8GA 3OMGA 1LM0A 2O5IC 1V1PB 5IY0A 5IGGA 1SN8A 1XTDA 2J0TD 2IHEA 4UPAA 1FGBD 4BXXG 4K2LA 2EZVA 2KJXA 4CDFC 5J3BA 3J7YW 1STAA 4Y52H 2X6GA 5EQ0A 1YNJC 1B2TA 5KIXA 1IW7C 1TU2B 4WFN3 1X32A 4Q0FA 1U4MA 3E0JA 3D4RA 2R92G 3FKIG 4QUFA 1K3RA 1GJXA 1WVLA 2AQ2B 3TBIB 2FHTA 1WYDA 1G2TA 1KNEA 3HKZB 1G51A 5NUCA 4IFDH 3VR4A 1MBYA 5DLQE 2DNCA 2UUCL 4LF7L 1SNMA 1KRSA
chains in the Genus database with same CATH topology
2KHJA 4X62L 1XMOL 1UEBA 4UP7A 4DR2Q 1IZ6A 4AQYL 3RN2A 1IBML 1KD1C 2ES2A 5C44H 2F4VQ 2PNHA 5EAYA 1VQLA 3AEVA 3ICEA 4KHPL 1X3GA 3M9BA 1QVCA 3I4NH 1VQIA 4GN3B 4L5RC 1E3PA 1FJGQ 4KHZA 2VQFQ 4A3FH 4DR4Q 4OO1I 4JI3L 5M3FG 2Q2UA 1GVPA 3NELA 5GADC 1EIYB 1QVFA 3BJUA 1D7QA 4B3MQ 3G48A 3I55A 4DR7Q 1C9OA 5C3EG 3GTLH 1JE5A 4JV5L 4IPCA 2D0PA 2UXDL 3W5OA 2R7ZH 1VQHA 3PUWA 4JYAQ 4JI6Q 1EWIA 2JEBI 3K8AA 4NXNQ 4RMFA 3ZJYC 5GAGC 2K5VA 2NVYH 1Y14B 1XNQL 4B3TQ 1VQGA 4A93H 2WB1G 1AE2A 2K5NA 4GLAC 1VQBA 4YHHQ 3RLNA 4IFDI 4R1JA 1K83H 4NXML 4IJLA 2UXBL 5BR8Q 2WB1E 1XMQL 1M90C 1WCMH 1KAWA 5LMNL 1NJIC 4LFCQ 4DV0Q 4IO9A 1KXLA 1VQOA 3K81C 3K7AH 4BXXH 1N9WA 4R4TA 1IBKL 1X3EA 1N34Q 1K0RA 5M3MG 1PA6A 2VS1A 4DV4L 2HHHQ 1SFOH 2PMZE 3A5ZB 3M4PA 1VQNA 4QIWE 1E22A 4DV2Q 4LFAL 1IBLL 1HJPA 1W2BA 1IL2A 4IPDA 1WFQA 4IJHA 4AIMA 2D0OA 1Y1VG 2KCMA 3SGIA 1EIFA 1N8RC 2HT1A 1OXTA 4DK3C 1PH3A 1HNWQ 1AH9A 3CPFA 4A3CG 3STBD 3GTGH 2R92H 3TRZA 3RN5A 3W1GA 4IFDJ 3FKIH 2UXCL 2IX0A 4DV5L 3VDYA 1PH4A 4YWLA 2QEXA 4DV3L 3KDFB 1A0IA 1VQDA 1VQKA 2YTYA 2CWPA 1D8LA 1FGUA 4P73A 1EYGA 3T1YQ 4BBRH 2IHFA 1VQPA 2PI2A 2LSSA 3J7A5 4UP9A 4DR2L 3HOWG 1B8AA 1Q8KA 2HIVA 1SRUA 4LW1A 4LWCA 2RCNA 3CP0A 2VUMH 3UDXA 1HNZQ 4HJAA 2VQFL 4GS3A 2ZJPA 4DR4L 4GOPA 1K8AC 4IOAA 3TS0A 1O7IA 1HH2P 3AFQA 4JG2A 1W3SA 3Q8DA 5H1SE 1VQ7A 1BBUA 4B3ML 4DR7L 3K80C 1X56A 3CCMA 2K75A 3CC7A 2Z0SA 3TREA 3M85A 1YBYA 4GN5A 5M3FH 4JYAL 5GAHC 4JI6L 1YJNA 3ULPA 1L1OB 5IT9c 4B3RL 3ULJA 3G71A 4DV7Q 3RLFA 2B3GA 5C3EH 2NVQH 3S15H 2A19A 4B3TL 4IOCA 2Z6KC 1QUQA 4YHHL 1K73C 2MQHA 1NBWA 3M3YH 3B6YA 2JE6I 2ZTCA 2ZTDA 4JCVE 2MO0A 1HZAA 4LFCL 3JC66 5C4JH 3J81j 4DV0L 2R7DA 2E2HH 4X64Q 1XPUA 4DV1Q 2KCTA 3BU2A 2ZJRA 4JI5Q 1N34L 2YU9H 4GKKL 4HIKA 4OX9Q 2HHHL 4JI7Q 3UDFA 2AHOB 4JOIA 4DV2L 3CCEA 1L2FA 3CPWA 2R93G 4DPGA 1VQAA 3KYHC 3L7ZC 5M3MH 3S24A 3G6EA 2ASBA 1CKOA 1VQJA 1X54A 2WAQG 1KIXA 4BY7G 1Q12A 4GNXA 2WP8J 2E5LQ 5JJKA 4X6AH 4B3SQ 4C2MH 4JI1Q 2PQAB 2VQEL 1Y1VH 2L15A 3PUVA 1PV4A 3S17H 2WAQE 3RZOH 5K36G 1N32L 1L0WA 1I50H 2Q2IA 5HY6A 2N8NA 3PCOB 3H15A 4GOPB 4A3EG 2E2JH 4A3CH 2H5XA 4DAYB 3T1YL 2JA9A 4JBMA 4DAMA 3RNUA 3S1QH 3HOYG 3CW2C 1SR3A 5JEAG 4JI2Q 4LFBQ 4A3BG 1B7YB 5JJLA 1EFWA 5ELOA 1JB7A 1JMCA 2N49A 1JJ2A 2K4KA 1X3FA 1Q1BA 1N36L 1AE3A 3HOWH 3J80i 4DR5Q 4PZ8A 4PMWA 3CD6A 3NENA 1I6HH 1UWVA 5M5XH 3CCRA 2EXDA 5IWAL 1HNXQ 4BBSG 4R4OA 4DR6Q 4HJ8A 1N33Q 3KLWA 4X66L 1TWHH 4NPSA 3PF4A 1SROA 2F52A 2ATWA 4DV7L 4YWKA 2A1AA 3F1ZA 3JAMi 3RZDH 1OXSC 2E8GA 4QJFA 1XJVA 1ASYA 5C4XG 4DUZQ 1JJGA 1PVOA 1YNXA 3J7ZC 1VQMA 3DLLA 1PH9A 1MJCA 1A62A 2OQ0A 1TWAH 3S1RH 3HOZG 2N3SA 1T9HA 2IT1A 1NTGA 3L0OA 1GD7A 1XPRA 2DUDA 1BBWA 4X64L 4DV1L 1BKBA 1YITA 1S40A 1YI2A 3FP9A 5IP7G 1E7ZA 2BA0A 4YCWA 3W1BA 4RG1A 4XTCS 4OX9L 2V1CC 4JI7L 2LXJA 2VW9A 2RF4A 3JAMc 2AKWB 2XGTA 5IYCG 1YHBA 1SMXA 4DR3Q 2E2IH 2IX1A 1G6PA 3HOVG 4GKJQ 5HGQA 3OW2A 3S1NH 1VQFA 3PGZA 5C0XG 2PI2E 5IP9G 1CSPA 4A3DG 1VQ5A 4EX5A 1U0LA 2ZM6Q 2E5LL 2K5HA 4B3SL 4JI1L 4DUYQ 3HOXG 2R93H 4JI8Q 2HQLA 4P72A 3PO3G 1CKMA 1S72A 4HJ5A 4BY7H 2GN5A 2JJQA 5IYBG 4LF9Q 3J81i 3I4MG 5LMUQ 5M5WH 3MXNB 3U4ZA 1EUJA 1OXXK 1X65A 3GTKH 2YTXA 2BH8A 4LFBL 1IXRA 4PZ7A 4A3EH 1KHIA 2MFIA 1QZHA 3L2PA 2YTVA 1PH1A 3CCLA 3HOYH 5IE8A 4R4CA 1L1OC 3A74A 4QL5A 2JEAI 2C35B 4A4IA 3NBHB 1VQ6A 4A3BH 1Q1EA 2F4VL 4DKAC 1WI5A 2MNAA 3TS2A 2A8VA 3PUZA 1HNXL 4DR1Q 1FJGL 1IYJB 4DR6L 1N33L 3J81c 4BY1G 2I5MX 1Q81C 2B63G 2ZJQA 4LF8Q 1EOVA 1WOCA 1J5EQ 1UE5A 3A0JA 4MNOA 1UE1A 1V9PA 1NMGA 4BBSH 2QGQA 4YCUA 2NZOA 3ULLA 4C3JH 4C3HH 4DUZL 1I94Q 3OTOQ 1SLJA 3CAMA 3WWVA 1UE6A 2N78A 4NXNL 2Z6KA 1QVGA 5C4XH 1X6OA 2OTLA 3KF6A 4HIMA 1X55A 2FXQA 2RHQB 4POFA 1SE8A 3S1MH 4BA2I 4YY3Q 4A3LG 2VNUD 2GVAA 3HOZH 1KRTA 2MO1A 2DGYA 3T1HQ 1CKNA 4LF4Q 1BVSA 2K50A 5BR8L 2JQOA 3U50C 4LUVA 4JBWA 1TWGH 4AQYQ 4AYBG 4POGA 4GKJL 4JC0A 5IP7H 1S3OA 4UY8C 3KOJA 3PIOA 3LGJA 1M1KC 1VS0A 1DGSA 3BZKA 1PH7A 1YJ9A 2ID0A 2UUBQ 5IYCH 3AFPA 3E9HA 4NB3A 2AWNA 4A3JG 2UUAQ 2JA8G 4DUYL 1H95A 1J6QA 4LNQA 3CCUA 4JI8L 1VCIA 5IP9H 1FL0A 3EBEA 1HNWL 4A3DH 4P75A 4LF9L 5LMUL 2HIXA 1MIUA 3HOXH 5AJ3Q 1Q86C 5E7NA 1FVIA 1Z47A 2AWOA 1JJCB 2B29A 1GM5A 1E1OA 1LUZA 2BA1A 3PO3H 3PSIA 5JJIA 5IYBH 2LXKA 4EQ5A 1OTCA 3I4MH 1Q82C 5JEAJ 1HZCA 1X9NA 4O2DA 1OXVA 4PG3A 1XMQQ 3I56A 1RL2A 3KFUA 2ZTEA 4DNIA 1HZBA 3E9IA 1YHQA 4DR1L 3E0EA 1RIPA 3PUXA 4O0AA 3H0GG 1HNZL 1HR0W 3CC4A 4DV4Q 1QUQB 1NE3A 3HFZB 4QY7A 5IYDG 1J5EL 3F2CA 3PV0A 3UDIA 1ASZA 1K9MC 1PH6A 3UE1A 1P8LA 4JI4Q 1IBLQ 1HR0Q 1I94L 4BY1H 3IRBA 4A3MG 3OTOL 4R4QA 2B63H 4DK6C 2JA7G 4HIDA 5C0XI 4JI0Q 2VL6A 1WJJA 3GTPH 3PIPA 2UXCQ 3PF5A 3CXCA 3CCJA 2AMCB 3RLOA 1TXYA 1YJWA 4YY3L 4HJ9A 1CSQA 4R4IA 3F8TA 3T1HL 1PH8A 1PHJA 1VQ9A 2JA5G 4OWTB 3J80c 2QA4A 4LF4L 4PZ6A 3I2ZA 1MJEA 4C3IH 3GO5A 2K14A 2JK8A 5GROA 4QGUA 3G4SA 1Q7YC 4A3LH 4YWMA 1YZ6A 1B70B 4GNXB 1C7YA 2EQSA 4A75A 4JI5L 4GLXA 1HZ9A 3S16H 1PYSB 3S14H 4A3GG 2EIFA 1A63A 4HIOA 5FJ8G 3HKSA 2UUBL 2OTJA 2Q2TA 2UUAL 3KDFA 4LUZA 4ME3A 5C0XJ 2UU9Q 1PH5A 2NZHA 3CCSA 2KHIA 1P16A 3FHWA 3AYHB 2NN6G 4TQUS 1EQQA 2JA8H 4A3JH 4LF5Q 4L5SA 2WFWA 2YV5A 3S2DH 5AJ3L 3D0FA 3M4QA 1XNRQ 4K0KQ 2GVBA 4B3RQ 3OYYA 1Z9FA 4FDBA 3STBC 4KLKA 3TQYA 3S2HH 3EIVA 3TEHB 4JBJA 3CC2A 2I5LX 3GTJH 4MTNA 3H3VH 4TVAB 4P74A 3CCVA 3AQQA 4YCVA 4A3IG 4JI2L 3CQZH 1Q46A 2CQOA 3ERSX 4LF6Q 1YHAA 1L1OA 2OQKA 4HJ7A 2KENA 4OXPA 1V1QA 4A3KG 4OO1G 4GKKQ 4WJ3M 3UDGA 4DR5L 1LYLA 2KBNA 2VY3A 1Y1WG 3PO2G 3CCQA 2YYZA 3GDEA 1CUKA 1NMFA 4LUOA 1EQRA 3H0GH 1HR0L 2OWOA 4JI4L 3I4OA 4X65Q 1I5FA 5ELNA 3HOUG 4Y7NH 2IY5B 1V43A 3I7FA 1G291 2BH2A 5IYDH 2I5HA 4J15A 3HKZG 1E24A 5FLMG 2F3IA 4APVA 4JI0L 3GTOH 3KF8B 2R6GA 3UE0A 1A8VA 2VQEQ 4GLVB 4A3MH 2JA6G 3BZCA 3HKZE 3NEMA 2JA7H 2XTIA 1N32Q 4IFDG 3M4OH 1PH2A 1UE7A 3A5UA 4OONA 1YVCA 3CF5A 1GKHA 1VQEA 2Q2HA 4H02A 4UP8A 3RR5A 3CMAA 2R7FA 4BA1I 4DV6Q 1KL9A 3GTMH 3H3VI 3GTQH 3U58A 5C44G 2UUCQ 2JA5H 3K7UC 3MEFA 4JBKA 4LF7Q 2PQAA 1JT8A 1MKHA 3I4NG 4X62Q 3U4VA 1N36Q 4WJ4A 5FLXc 4A3FG 1XMOQ 4DR3L 2UU9L 2NVXH 4GOPC 1IBMQ 2ALYB 4A3GH 4XIGS 1VQ8A 4KHPQ 4KI0A 5FJ8H 3ER0A 5IWAQ 2CCZA 1K8GA 2CFMA 3EN2A 1PFSA 4AYBE 4LF5L 3PUYA 2ZM6L 1LTLA 4X66Q 2K52A 2Y0SG 4JI3Q 5M5YH 1R9TH 1XNRL 3HOVH 2R7ZG 4K0KL 4MZ9A 2CKZB 2Y0SE 4GN4B 3CMEA 2I0QA 1TWFH 4JV5Q 4A93G 1LM0A 1GO3E 2UXDQ 5IY0A 1I3QH 1PYBA 1SN8A 3F2BA 2VZAA 1XTDA 3GD7A 1XNQQ 1WCMG 2IHEA 1NY4A 3KJPA 1KC8C 5LMNW 4LF6L 4QQBX 2RHSB 4UPAA 1E1TA 4BXXG 4NXMQ 4A3IH 2UXBQ 1YEZA 5J3BA 4Y52H 5LMNQ 3F2DA 4OWWB 4JOIC 1OXUA 1TWCH 4X65L 1VQ4A 4A3KH 2D62A 1QZGA 1IBKQ 1YIJA 3M7NA 3KF6B 4ALPA 4LF8L 4IPHA 2CWAA 3PO2H 1Y1WH 4AH6A 2R92G 1VQCA 4LFAQ 4GNXC 3FKIG 2NVTH 1CKNB 4L5TA 3HOUH 1K3RA 4A76A 3D31A 1XPOA 5FLMH 1WYDA 2NN6I 4P71A 5GAEC 4OWXB 4BBRG 2JA6H 3KJOA 1G51A 4DV6L 4DV5Q 2OCEA 4DV3Q 4IPGA 5DLQE 3K0XA 3DM3A 1KQSA 2UUCL 4LF7L 1KRSA 1C0AA 5GQOA 4L5QA 2VUMG 1U5KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KHJ A;  4X62 L;  1XMO L;  1UEB A;  4UP7 A;  4DR2 Q;  1IZ6 A;  4AQY L;  3RN2 A;  1IBM L;  1KD1 C;  2ES2 A;  5C44 H;  2F4V Q;  2PNH A;  5EAY A;  1VQL A;  3AEV A;  3ICE A;  4KHP L;  1X3G A;  3M9B A;  1QVC A;  3I4N H;  1VQI A;  4GN3 B;  4L5R C;  1E3P A;  1FJG Q;  4KHZ A;  2VQF Q;  4A3F H;  4DR4 Q;  4OO1 I;  4JI3 L;  5M3F G;  2Q2U A;  1GVP A;  3NEL A;  5GAD C;  1EIY B;  1QVF A;  3BJU A;  1D7Q A;  4B3M Q;  3G48 A;  3I55 A;  4DR7 Q;  1C9O A;  5C3E G;  3GTL H;  1JE5 A;  4JV5 L;  4IPC A;  2D0P A;  2UXD L;  3W5O A;  2R7Z H;  1VQH A;  3PUW A;  4JYA Q;  4JI6 Q;  1EWI A;  2JEB I;  3K8A A;  4NXN Q;  4RMF A;  3ZJY C;  5GAG C;  2K5V A;  2NVY H;  1Y14 B;  1XNQ L;  4B3T Q;  1VQG A;  4A93 H;  2WB1 G;  1AE2 A;  2K5N A;  4GLA C;  1VQB A;  4YHH Q;  3RLN A;  4IFD I;  4R1J A;  1K83 H;  4NXM L;  4IJL A;  2UXB L;  5BR8 Q;  2WB1 E;  1XMQ L;  1M90 C;  1WCM H;  1KAW A;  5LMN L;  1NJI C;  4LFC Q;  4DV0 Q;  4IO9 A;  1KXL A;  1VQO A;  3K81 C;  3K7A H;  4BXX H;  1N9W A;  4R4T A;  1IBK L;  1X3E A;  1N34 Q;  1K0R A;  5M3M G;  1PA6 A;  2VS1 A;  4DV4 L;  2HHH Q;  1SFO H;  2PMZ E;  3A5Z B;  3M4P A;  1VQN A;  4QIW E;  1E22 A;  4DV2 Q;  4LFA L;  1IBL L;  1HJP A;  1W2B A;  1IL2 A;  4IPD A;  1WFQ A;  4IJH A;  4AIM A;  2D0O A;  1Y1V G;  2KCM A;  3SGI A;  1EIF A;  1N8R C;  2HT1 A;  1OXT A;  4DK3 C;  1PH3 A;  1HNW Q;  1AH9 A;  3CPF A;  4A3C G;  3STB D;  3GTG H;  2R92 H;  3TRZ A;  3RN5 A;  3W1G A;  4IFD J;  3FKI H;  2UXC L;  2IX0 A;  4DV5 L;  3VDY A;  1PH4 A;  4YWL A;  2QEX A;  4DV3 L;  3KDF B;  1A0I A;  1VQD A;  1VQK A;  2YTY A;  2CWP A;  1D8L A;  1FGU A;  4P73 A;  1EYG A;  3T1Y Q;  4BBR H;  2IHF A;  1VQP A;  2PI2 A;  2LSS A;  3J7A 5;  4UP9 A;  4DR2 L;  3HOW G;  1B8A A;  1Q8K A;  2HIV A;  1SRU A;  4LW1 A;  4LWC A;  2RCN A;  3CP0 A;  2VUM H;  3UDX A;  1HNZ Q;  4HJA A;  2VQF L;  4GS3 A;  2ZJP A;  4DR4 L;  4GOP A;  1K8A C;  4IOA A;  3TS0 A;  1O7I A;  1HH2 P;  3AFQ A;  4JG2 A;  1W3S A;  3Q8D A;  5H1S E;  1VQ7 A;  1BBU A;  4B3M L;  4DR7 L;  3K80 C;  1X56 A;  3CCM A;  2K75 A;  3CC7 A;  2Z0S A;  3TRE A;  3M85 A;  1YBY A;  4GN5 A;  5M3F H;  4JYA L;  5GAH C;  4JI6 L;  1YJN A;  3ULP A;  1L1O B;  5IT9 c;  4B3R L;  3ULJ A;  3G71 A;  4DV7 Q;  3RLF A;  2B3G A;  5C3E H;  2NVQ H;  3S15 H;  2A19 A;  4B3T L;  4IOC A;  2Z6K C;  1QUQ A;  4YHH L;  1K73 C;  2MQH A;  1NBW A;  3M3Y H;  3B6Y A;  2JE6 I;  2ZTC A;  2ZTD A;  4JCV E;  2MO0 A;  1HZA A;  4LFC L;  3JC6 6;  5C4J H;  3J81 j;  4DV0 L;  2R7D A;  2E2H H;  4X64 Q;  1XPU A;  4DV1 Q;  2KCT A;  3BU2 A;  2ZJR A;  4JI5 Q;  1N34 L;  2YU9 H;  4GKK L;  4HIK A;  4OX9 Q;  2HHH L;  4JI7 Q;  3UDF A;  2AHO B;  4JOI A;  4DV2 L;  3CCE A;  1L2F A;  3CPW A;  2R93 G;  4DPG A;  1VQA A;  3KYH C;  3L7Z C;  5M3M H;  3S24 A;  3G6E A;  2ASB A;  1CKO A;  1VQJ A;  1X54 A;  2WAQ G;  1KIX A;  4BY7 G;  1Q12 A;  4GNX A;  2WP8 J;  2E5L Q;  5JJK A;  4X6A H;  4B3S Q;  4C2M H;  4JI1 Q;  2PQA B;  2VQE L;  1Y1V H;  2L15 A;  3PUV A;  1PV4 A;  3S17 H;  2WAQ E;  3RZO H;  5K36 G;  1N32 L;  1L0W A;  1I50 H;  2Q2I A;  5HY6 A;  2N8N A;  3PCO B;  3H15 A;  4GOP B;  4A3E G;  2E2J H;  4A3C H;  2H5X A;  4DAY B;  3T1Y L;  2JA9 A;  4JBM A;  4DAM A;  3RNU A;  3S1Q H;  3HOY G;  3CW2 C;  1SR3 A;  5JEA G;  4JI2 Q;  4LFB Q;  4A3B G;  1B7Y B;  5JJL A;  1EFW A;  5ELO A;  1JB7 A;  1JMC A;  2N49 A;  1JJ2 A;  2K4K A;  1X3F A;  1Q1B A;  1N36 L;  1AE3 A;  3HOW H;  3J80 i;  4DR5 Q;  4PZ8 A;  4PMW A;  3CD6 A;  3NEN A;  1I6H H;  1UWV A;  5M5X H;  3CCR A;  2EXD A;  5IWA L;  1HNX Q;  4BBS G;  4R4O A;  4DR6 Q;  4HJ8 A;  1N33 Q;  3KLW A;  4X66 L;  1TWH H;  4NPS A;  3PF4 A;  1SRO A;  2F52 A;  2ATW A;  4DV7 L;  4YWK A;  2A1A A;  3F1Z A;  3JAM i;  3RZD H;  1OXS C;  2E8G A;  4QJF A;  1XJV A;  1ASY A;  5C4X G;  4DUZ Q;  1JJG A;  1PVO A;  1YNX A;  3J7Z C;  1VQM A;  3DLL A;  1PH9 A;  1MJC A;  1A62 A;  2OQ0 A;  1TWA H;  3S1R H;  3HOZ G;  2N3S A;  1T9H A;  2IT1 A;  1NTG A;  3L0O A;  1GD7 A;  1XPR A;  2DUD A;  1BBW A;  4X64 L;  4DV1 L;  1BKB A;  1YIT A;  1S40 A;  1YI2 A;  3FP9 A;  5IP7 G;  1E7Z A;  2BA0 A;  4YCW A;  3W1B A;  4RG1 A;  4XTC S;  4OX9 L;  2V1C C;  4JI7 L;  2LXJ A;  2VW9 A;  2RF4 A;  3JAM c;  2AKW B;  2XGT A;  5IYC G;  1YHB A;  1SMX A;  4DR3 Q;  2E2I H;  2IX1 A;  1G6P A;  3HOV G;  4GKJ Q;  5HGQ A;  3OW2 A;  3S1N H;  1VQF A;  3PGZ A;  5C0X G;  2PI2 E;  5IP9 G;  1CSP A;  4A3D G;  1VQ5 A;  4EX5 A;  1U0L A;  2ZM6 Q;  2E5L L;  2K5H A;  4B3S L;  4JI1 L;  4DUY Q;  3HOX G;  2R93 H;  4JI8 Q;  2HQL A;  4P72 A;  3PO3 G;  1CKM A;  1S72 A;  4HJ5 A;  4BY7 H;  2GN5 A;  2JJQ A;  5IYB G;  4LF9 Q;  3J81 i;  3I4M G;  5LMU Q;  5M5W H;  3MXN B;  3U4Z A;  1EUJ A;  1OXX K;  1X65 A;  3GTK H;  2YTX A;  2BH8 A;  4LFB L;  1IXR A;  4PZ7 A;  4A3E H;  1KHI A;  2MFI A;  1QZH A;  3L2P A;  2YTV A;  1PH1 A;  3CCL A;  3HOY H;  5IE8 A;  4R4C A;  1L1O C;  3A74 A;  4QL5 A;  2JEA I;  2C35 B;  4A4I A;  3NBH B;  1VQ6 A;  4A3B H;  1Q1E A;  2F4V L;  4DKA C;  1WI5 A;  2MNA A;  3TS2 A;  2A8V A;  3PUZ A;  1HNX L;  4DR1 Q;  1FJG L;  1IYJ B;  4DR6 L;  1N33 L;  3J81 c;  4BY1 G;  2I5M X;  1Q81 C;  2B63 G;  2ZJQ A;  4LF8 Q;  1EOV A;  1WOC A;  1J5E Q;  1UE5 A;  3A0J A;  4MNO A;  1UE1 A;  1V9P A;  1NMG A;  4BBS H;  2QGQ A;  4YCU A;  2NZO A;  3ULL A;  4C3J H;  4C3H H;  4DUZ L;  1I94 Q;  3OTO Q;  1SLJ A;  3CAM A;  3WWV A;  1UE6 A;  2N78 A;  4NXN L;  2Z6K A;  1QVG A;  5C4X H;  1X6O A;  2OTL A;  3KF6 A;  4HIM A;  1X55 A;  2FXQ A;  2RHQ B;  4POF A;  1SE8 A;  3S1M H;  4BA2 I;  4YY3 Q;  4A3L G;  2VNU D;  2GVA A;  3HOZ H;  1KRT A;  2MO1 A;  2DGY A;  3T1H Q;  1CKN A;  4LF4 Q;  1BVS A;  2K50 A;  5BR8 L;  2JQO A;  3U50 C;  4LUV A;  4JBW A;  1TWG H;  4AQY Q;  4AYB G;  4POG A;  4GKJ L;  4JC0 A;  5IP7 H;  1S3O A;  4UY8 C;  3KOJ A;  3PIO A;  3LGJ A;  1M1K C;  1VS0 A;  1DGS A;  3BZK A;  1PH7 A;  1YJ9 A;  2ID0 A;  2UUB Q;  5IYC H;  3AFP A;  3E9H A;  4NB3 A;  2AWN A;  4A3J G;  2UUA Q;  2JA8 G;  4DUY L;  1H95 A;  1J6Q A;  4LNQ A;  3CCU A;  4JI8 L;  1VCI A;  5IP9 H;  1FL0 A;  3EBE A;  1HNW L;  4A3D H;  4P75 A;  4LF9 L;  5LMU L;  2HIX A;  1MIU A;  3HOX H;  5AJ3 Q;  1Q86 C;  5E7N A;  1FVI A;  1Z47 A;  2AWO A;  1JJC B;  2B29 A;  1GM5 A;  1E1O A;  1LUZ A;  2BA1 A;  3PO3 H;  3PSI A;  5JJI A;  5IYB H;  2LXK A;  4EQ5 A;  1OTC A;  3I4M H;  1Q82 C;  5JEA J;  1HZC A;  1X9N A;  4O2D A;  1OXV A;  4PG3 A;  1XMQ Q;  3I56 A;  1RL2 A;  3KFU A;  2ZTE A;  4DNI A;  1HZB A;  3E9I A;  1YHQ A;  4DR1 L;  3E0E A;  1RIP A;  3PUX A;  4O0A A;  3H0G G;  1HNZ L;  1HR0 W;  3CC4 A;  4DV4 Q;  1QUQ B;  1NE3 A;  3HFZ B;  4QY7 A;  5IYD G;  1J5E L;  3F2C A;  3PV0 A;  3UDI A;  1ASZ A;  1K9M C;  1PH6 A;  3UE1 A;  1P8L A;  4JI4 Q;  1IBL Q;  1HR0 Q;  1I94 L;  4BY1 H;  3IRB A;  4A3M G;  3OTO L;  4R4Q A;  2B63 H;  4DK6 C;  2JA7 G;  4HID A;  5C0X I;  4JI0 Q;  2VL6 A;  1WJJ A;  3GTP H;  3PIP A;  2UXC Q;  3PF5 A;  3CXC A;  3CCJ A;  2AMC B;  3RLO A;  1TXY A;  1YJW A;  4YY3 L;  4HJ9 A;  1CSQ A;  4R4I A;  3F8T A;  3T1H L;  1PH8 A;  1PHJ A;  1VQ9 A;  2JA5 G;  4OWT B;  3J80 c;  2QA4 A;  4LF4 L;  4PZ6 A;  3I2Z A;  1MJE A;  4C3I H;  3GO5 A;  2K14 A;  2JK8 A;  5GRO A;  4QGU A;  3G4S A;  1Q7Y C;  4A3L H;  4YWM A;  1YZ6 A;  1B70 B;  4GNX B;  1C7Y A;  2EQS A;  4A75 A;  4JI5 L;  4GLX A;  1HZ9 A;  3S16 H;  1PYS B;  3S14 H;  4A3G G;  2EIF A;  1A63 A;  4HIO A;  5FJ8 G;  3HKS A;  2UUB L;  2OTJ A;  2Q2T A;  2UUA L;  3KDF A;  4LUZ A;  4ME3 A;  5C0X J;  2UU9 Q;  1PH5 A;  2NZH A;  3CCS A;  2KHI A;  1P16 A;  3FHW A;  3AYH B;  2NN6 G;  4TQU S;  1EQQ A;  2JA8 H;  4A3J H;  4LF5 Q;  4L5S A;  2WFW A;  2YV5 A;  3S2D H;  5AJ3 L;  3D0F A;  3M4Q A;  1XNR Q;  4K0K Q;  2GVB A;  4B3R Q;  3OYY A;  1Z9F A;  4FDB A;  3STB C;  4KLK A;  3TQY A;  3S2H H;  3EIV A;  3TEH B;  4JBJ A;  3CC2 A;  2I5L X;  3GTJ H;  4MTN A;  3H3V H;  4TVA B;  4P74 A;  3CCV A;  3AQQ A;  4YCV A;  4A3I G;  4JI2 L;  3CQZ H;  1Q46 A;  2CQO A;  3ERS X;  4LF6 Q;  1YHA A;  1L1O A;  2OQK A;  4HJ7 A;  2KEN A;  4OXP A;  1V1Q A;  4A3K G;  4OO1 G;  4GKK Q;  4WJ3 M;  3UDG A;  4DR5 L;  1LYL A;  2KBN A;  2VY3 A;  1Y1W G;  3PO2 G;  3CCQ A;  2YYZ A;  3GDE A;  1CUK A;  1NMF A;  4LUO A;  1EQR A;  3H0G H;  1HR0 L;  2OWO A;  4JI4 L;  3I4O A;  4X65 Q;  1I5F A;  5ELN A;  3HOU G;  4Y7N H;  2IY5 B;  1V43 A;  3I7F A;  1G29 1;  2BH2 A;  5IYD H;  2I5H A;  4J15 A;  3HKZ G;  1E24 A;  5FLM G;  2F3I A;  4APV A;  4JI0 L;  3GTO H;  3KF8 B;  2R6G A;  3UE0 A;  1A8V A;  2VQE Q;  4GLV B;  4A3M H;  2JA6 G;  3BZC A;  3HKZ E;  3NEM A;  2JA7 H;  2XTI A;  1N32 Q;  4IFD G;  3M4O H;  1PH2 A;  1UE7 A;  3A5U A;  4OON A;  1YVC A;  3CF5 A;  1GKH A;  1VQE A;  2Q2H A;  4H02 A;  4UP8 A;  3RR5 A;  3CMA A;  2R7F A;  4BA1 I;  4DV6 Q;  1KL9 A;  3GTM H;  3H3V I;  3GTQ H;  3U58 A;  5C44 G;  2UUC Q;  2JA5 H;  3K7U C;  3MEF A;  4JBK A;  4LF7 Q;  2PQA A;  1JT8 A;  1MKH A;  3I4N G;  4X62 Q;  3U4V A;  1N36 Q;  4WJ4 A;  5FLX c;  4A3F G;  1XMO Q;  4DR3 L;  2UU9 L;  2NVX H;  4GOP C;  1IBM Q;  2ALY B;  4A3G H;  4XIG S;  1VQ8 A;  4KHP Q;  4KI0 A;  5FJ8 H;  3ER0 A;  5IWA Q;  2CCZ A;  1K8G A;  2CFM A;  3EN2 A;  1PFS A;  4AYB E;  4LF5 L;  3PUY A;  2ZM6 L;  1LTL A;  4X66 Q;  2K52 A;  2Y0S G;  4JI3 Q;  5M5Y H;  1R9T H;  1XNR L;  3HOV H;  2R7Z G;  4K0K L;  4MZ9 A;  2CKZ B;  2Y0S E;  4GN4 B;  3CME A;  2I0Q A;  1TWF H;  4JV5 Q;  4A93 G;  1LM0 A;  1GO3 E;  2UXD Q;  5IY0 A;  1I3Q H;  1PYB A;  1SN8 A;  3F2B A;  2VZA A;  1XTD A;  3GD7 A;  1XNQ Q;  1WCM G;  2IHE A;  1NY4 A;  3KJP A;  1KC8 C;  5LMN W;  4LF6 L;  4QQB X;  2RHS B;  4UPA A;  1E1T A;  4BXX G;  4NXM Q;  4A3I H;  2UXB Q;  1YEZ A;  5J3B A;  4Y52 H;  5LMN Q;  3F2D A;  4OWW B;  4JOI C;  1OXU A;  1TWC H;  4X65 L;  1VQ4 A;  4A3K H;  2D62 A;  1QZG A;  1IBK Q;  1YIJ A;  3M7N A;  3KF6 B;  4ALP A;  4LF8 L;  4IPH A;  2CWA A;  3PO2 H;  1Y1W H;  4AH6 A;  2R92 G;  1VQC A;  4LFA Q;  4GNX C;  3FKI G;  2NVT H;  1CKN B;  4L5T A;  3HOU H;  1K3R A;  4A76 A;  3D31 A;  1XPO A;  5FLM H;  1WYD A;  2NN6 I;  4P71 A;  5GAE C;  4OWX B;  4BBR G;  2JA6 H;  3KJO A;  1G51 A;  4DV6 L;  4DV5 Q;  2OCE A;  4DV3 Q;  4IPG A;  5DLQ E;  3K0X A;  3DM3 A;  1KQS A;  2UUC L;  4LF7 L;  1KRS A;  1C0A A;  5GQO A;  4L5Q A;  2VUM G;  1U5K A; 
#chains in the Genus database with same CATH topology
 1SXT A;  2KHJ A;  1UEB A;  1IZ6 A;  4AQY L;  4KD4 A;  1PRT B;  3OMC A;  2F4V Q;  1HFG A;  4DFA A;  3M9B A;  4RGO S;  1QVC A;  1T5X D;  2L1B A;  4GN3 B;  1E3P A;  1IKM A;  2VQF Q;  3OWF A;  1F9Q A;  4OO1 I;  3S14 B;  5M3F G;  2F0N A;  1LTT D;  5KNB A;  1QVF A;  3KLS A;  4DR7 Q;  5C3E G;  3GTL H;  1JE5 A;  4IPC A;  4CGY B;  3KBG A;  3W5O A;  1BOS A;  3PUW A;  1D5Z C;  5J1Z A;  4QB4 A;  4A3J B;  1GUN A;  1Y14 B;  4C1N I;  4B3T Q;  3IAY A;  1AE2 A;  1VF7 A;  4HSP A;  1VQB A;  5LL6 X;  1K83 H;  1ILP A;  1TY2 A;  3C1F A;  3DUZ A;  3WOE A;  2RDF A;  1HUN A;  1HRJ A;  1DJR D;  1XYI A;  1KAW A;  5LMN L;  3GTJ B;  3TME A;  1TS5 A;  1VQO A;  4BXX H;  2M2L A;  2NUC A;  1PA6 A;  5FKA C;  1SFO H;  2PMZ E;  2I07 B;  1E22 A;  4NKL A;  2WKC A;  2G9H D;  2KCM A;  3AU7 A;  1OXT A;  1HNW Q;  3STB D;  2R92 H;  3W1G A;  3NTI A;  3FKI H;  2UXC L;  2IX0 A;  4DV5 L;  1Z7T A;  1PH4 A;  1CQV A;  4R8N A;  3NE5 B;  1FGU A;  4P73 A;  2IHF A;  3NQT A;  5E1F A;  2LSS A;  3M4O B;  2JSO A;  3NSW A;  4DR2 L;  4RWS C;  2HIV A;  4LW1 A;  1EZ6 A;  3CP0 A;  2B2Y C;  4ZQ3 A;  4DR4 L;  3NQI A;  2B2U A;  1K8A C;  3TS0 A;  3GQB A;  4JG2 A;  1VQ7 A;  1H9R A;  1JWS D;  1O78 A;  4OIJ A;  5IT9 L;  1TY0 A;  2PZW A;  3TRE A;  5C6A A;  3NWT A;  4GN5 A;  5M3F H;  5GAH C;  4JI6 L;  1IL8 A;  4IAL A;  3ULP A;  5D65 A;  5IT9 c;  4B3R L;  3G71 A;  1IKL A;  5C3E H;  2A19 A;  1ROD A;  2EDG A;  2Z6K C;  2VB2 X;  1QUQ A;  5M5Y B;  1B9M A;  2MQH A;  3M3Y H;  4UDU C;  4JCV E;  5KYL A;  1TWF B;  1O7Y A;  2RCF A;  5ELD A;  5C4J H;  2R7D A;  4X64 Q;  4DV1 Q;  3BU2 A;  4FXD A;  2D9U A;  2B2W A;  3BYY B;  3CRK C;  3E6Z X;  4JI7 Q;  1D2B A;  3KLR A;  3V05 A;  1GHJ A;  1EY4 A;  3FRP B;  1VQJ A;  2WAQ G;  1Q12 A;  4GNX A;  4A3K B;  4RHS A;  4C2M H;  4JI1 Q;  2PQA B;  4V0B A;  2HDM A;  5K36 G;  2WAQ E;  1N32 L;  2AUK A;  5HY6 A;  3PCO B;  1SE4 A;  2NYZ D;  1A3V A;  3T1Y L;  2JA9 A;  3RNU A;  3S1Q H;  3MFG A;  1BCP B;  2A6H C;  1SR3 A;  1TQO A;  2CQA A;  4JI2 Q;  3Q22 A;  5JJL A;  1EFW A;  2N49 A;  2L0C A;  1CZW A;  2H1E A;  4DAV A;  1JJ2 A;  2K4K A;  1X3F A;  3DEP A;  1AE3 A;  1N36 L;  1EZ8 A;  4HR7 B;  4PMB A;  3CD6 A;  1I6H H;  1HTP A;  2G5D A;  4N9T A;  4BBS G;  5C44 B;  1F9R A;  3I4L A;  3I4N B;  3PF4 A;  2K01 A;  4DV7 L;  2A1A A;  3F1Z A;  2QEJ C;  4A3F B;  3H3V C;  2LY7 A;  3KBX A;  1TWH B;  5C4X G;  1DYQ A;  1F2M A;  4BWG B;  2EYF A;  1PVO A;  3DLL A;  1MJC A;  3S1R H;  1BF4 A;  2IT1 A;  1GD7 A;  3VR6 A;  3T53 B;  3EA6 A;  2NVY B;  2F3W A;  4ABN A;  1Z6H A;  3W1B A;  4RG1 A;  4XTC S;  4A93 B;  2V1C C;  2VW9 A;  2F0V A;  4DR3 Q;  2R3Z A;  2A6E C;  3S1N H;  1WCM B;  5C0X G;  2A69 C;  2SOB A;  5IP9 G;  3K7A B;  1DXM A;  4EX5 A;  1U0L A;  3VA7 A;  2E5L L;  5EJW A;  5T1G A;  3HOX G;  3S9W A;  2Q8T A;  1IHZ A;  5IT9 E;  1LT5 D;  4WRD A;  1T5E A;  5M5W H;  5LMU Q;  1X65 A;  5K36 H;  2YTX A;  1IXR A;  4CBV A;  1QWY A;  2K05 A;  4TSS A;  1QZH A;  2YTV A;  3CCL A;  1H9K A;  5IE8 A;  1LT6 D;  3J81 L;  4KKU A;  4G7O C;  3HOY B;  4OEM B;  1G8Z D;  2A8V A;  1HNX L;  4DR1 Q;  3J81 c;  3MHB A;  2ZJQ A;  2V4D A;  1EOV A;  1WOC A;  4EGV A;  1UE5 A;  2K33 A;  3A0J A;  3ERO A;  2F0M A;  4BBS H;  2QGQ A;  5D3D A;  3ULL A;  2ICE C;  1EFI D;  4KKS A;  3ND9 A;  1CK1 A;  4C3J B;  1ESF A;  3TDQ A;  5C4X H;  5CR3 A;  4C3I G;  1SMY C;  4HIM A;  1X55 A;  4A3L G;  3H94 A;  2NVQ B;  4BA2 I;  4YY3 Q;  2VNU D;  3S15 B;  2EYM A;  2GVA A;  3PIP 3;  2MO1 A;  4LF4 Q;  1BVS A;  1VMC A;  4TRD A;  4LUV A;  4JBW A;  1TWG H;  4K8I A;  4AQY Q;  2Z8L A;  4GKJ L;  4S3S A;  1S3O A;  3PIO A;  2E2H B;  2H4O A;  3I70 A;  1YJ9 A;  1WTP A;  1H95 A;  1JR0 D;  4FF1 A;  5EKI A;  2JA8 G;  4DUY L;  4CKE A;  3VA5 A;  3CCU A;  1II3 A;  4ID6 A;  5C0X H;  4G7Z C;  5IP9 H;  3EBE A;  3D6C A;  4P75 A;  4J8Q A;  5M3M B;  2HIX A;  3HOX H;  1LTA D;  2F0D A;  1Z47 A;  4KK7 A;  1K8O A;  2VB3 X;  4FF2 A;  1OTC A;  3EJI A;  3S17 B;  1HZC A;  2E2J B;  3A54 A;  2WIN B;  4DNT B;  2M00 A;  4X3U A;  3KFU A;  2Z4I A;  3T51 B;  4DNI A;  1HZB A;  1K28 A;  1UAP A;  5ELC A;  3PUX A;  4O0A A;  2N88 A;  4QY7 A;  3F2C A;  3PV0 A;  4KTA A;  3UE1 A;  1FR3 A;  3HOW B;  4K8J A;  3IRB A;  5JVG 3;  1PRT D;  2XWJ B;  4R4Q A;  2NZ1 D;  4KN7 C;  1WJJ A;  1PFN A;  5ELB A;  1Y8O B;  2UXC Q;  3PF5 A;  1A3U A;  2AMC B;  3RLO A;  1YJW A;  1CSQ A;  3C46 A;  4R4I A;  3T1H L;  3HS0 C;  1PTO F;  4OWT B;  1TT2 A;  3J80 c;  4C3I H;  4A3L H;  1TWA B;  3S2H H;  1YZ6 A;  1B70 B;  1SNO A;  4A75 A;  1SAP A;  4A3G G;  3R3O A;  4UAI A;  5FJ8 G;  2EVB A;  1PMR A;  2UUA L;  3KDF A;  1DOK A;  1KDC A;  1HQR D;  4DXG A;  4ME3 A;  2UU9 Q;  1AW7 A;  1V1O A;  3J81 E;  1NR4 A;  5KEE A;  2NZH A;  3CCS A;  2KHI A;  4C1N K;  2E2I B;  1P16 A;  2MHV A;  3AYH B;  3FHW A;  2JA8 H;  2I46 A;  1RF2 D;  2IPK D;  4L5S A;  1B50 A;  4RGN A;  3D0F A;  2GVB A;  3OPO A;  2D2C C;  4B3R Q;  4EQO A;  2Z1C A;  4IQZ A;  1EY9 A;  4FF4 A;  1KTK A;  1WD1 A;  3TQY A;  3EIV A;  3TEH B;  4JBJ A;  2OT2 A;  4MTN A;  4TVA B;  4P74 A;  1EIG A;  1EY0 A;  3C2P A;  1QNU A;  2CQO A;  3ERS X;  4LF6 Q;  4UHV A;  1Y8N B;  1EYC A;  1LYL A;  2XRQ D;  3PO2 G;  1Y1W G;  3CCQ A;  2YYZ A;  3GDE A;  4JI4 L;  1FNV A;  1NMF A;  1EQR A;  2K1B A;  3HOU G;  3SE0 A;  2IY5 B;  3H0G B;  4JI0 L;  5FLM G;  3UE0 A;  5C4H A;  1JOR A;  1A8V A;  2B2V A;  2BE5 D;  3BZC A;  1PDQ A;  1N32 Q;  2L5T A;  1SDF A;  5BN3 A;  1BDO A;  2ZXP A;  1UE7 A;  4C3H B;  3A5U A;  1YVC A;  1VQE A;  2F0K A;  2KHS A;  1D5X C;  4UP8 A;  2R7F A;  4BA1 I;  1KL9 A;  3GTM H;  3H3V I;  1TS3 A;  3MEF A;  1XXG A;  1BO0 A;  3OIQ A;  2JP1 A;  4X62 Q;  1N36 Q;  4WJ4 A;  5A2Q L;  4IUP A;  5FLX c;  2F3V A;  2B2U C;  4A3G H;  3IFD A;  3K0Y A;  5FJ8 H;  4G4K A;  3HGB A;  1VDZ A;  4AYB E;  3SEB A;  2ZM6 L;  1EU3 A;  2Y0S G;  4NW2 A;  1R9T H;  4HN7 A;  4K0K L;  2CKZ B;  2MGS A;  2Y0S E;  3HOV B;  4GN4 B;  4JV5 Q;  1HA6 A;  4B08 A;  1AN8 A;  1I3Q H;  1PYB A;  1TS2 A;  1ZEQ X;  3MAQ A;  2FMM A;  4QQB X;  2E74 C;  3PO3 B;  5D3I B;  1SYG A;  4NXM Q;  3N52 A;  1C8C A;  3I4M B;  2UXB Q;  1YEZ A;  3WOF A;  2B2W C;  1BCP D;  1TWC H;  2D62 A;  1IBK Q;  1JC7 A;  3KF6 B;  1MGS A;  3PO2 H;  1Y1W H;  4AH6 A;  1VQC A;  3F2U A;  3MFY A;  4KY7 A;  4LFA Q;  4GNX C;  4H7B A;  2NVT H;  3HOU H;  4A76 A;  1XPO A;  5FLM H;  4RCO A;  1TII D;  4RGT A;  3C1E A;  5GAE C;  4P71 A;  2B63 B;  2Q8I B;  3KJO A;  2EY6 A;  2Q8R E;  1IYV A;  2OCE A;  3K0X A;  3ITP A;  1PXU A;  2F0U A;  5FO7 B;  1STG A;  2KEE A;  1XMO L;  4UP7 A;  1IBM L;  1DOL A;  2KED A;  1KD1 C;  5EAY A;  4KHP L;  1XX8 A;  1VQI A;  4M1U B;  4L5R C;  4KHZ A;  3NPP A;  2AQ1 B;  2EYH A;  4M8A A;  2EY1 A;  2DNE A;  4ZAI A;  1U4P A;  3A55 A;  5CBA E;  1EY5 A;  2UXD L;  3P20 A;  1VQH A;  2CH4 W;  5IGF A;  4RMF A;  2K5V A;  1XNQ L;  1S4Z A;  4I65 A;  4GLA C;  3RLN A;  1LT3 D;  1E2Z A;  2XN9 C;  1SNP A;  1K83 B;  1K8M A;  4DF7 A;  1NJI C;  3NTH A;  4DV0 Q;  4IO9 A;  3SK6 A;  1KXL A;  4R4T A;  2B2T A;  1HCZ A;  3CQZ B;  5F2D A;  4DV4 L;  2MUY A;  2HHH Q;  1W6K A;  1VQN A;  4QIW E;  1W2B A;  5A2Q E;  1IL2 A;  4IPD A;  4IJH A;  3SGI A;  3CPF A;  3GTG H;  3IKJ A;  3TRZ A;  3RN5 A;  4WOR A;  5C3X A;  4Y7N B;  4IFD J;  2PW5 A;  3A7A B;  3VDY A;  3GTO B;  4DV3 L;  1KDB A;  1VQK A;  3R2T A;  2RSN A;  1D8L A;  1V8Q A;  1VQP A;  1BBX C;  4X3T A;  3J7A 5;  1NSN S;  3LWE A;  1GUW A;  2K5Q A;  2PO4 A;  1H9S A;  1O7Z A;  3ND8 A;  4GS3 A;  2ZJP A;  4HJA A;  4GOP A;  4IOA A;  5C5L A;  3AFQ A;  1W3S A;  4LK1 C;  1EEF D;  5H1S E;  4B3M L;  3K80 C;  2QIL A;  2K75 A;  3CC7 A;  1KLG D;  2Z0S A;  4CKC A;  4K2K A;  3H09 A;  4JYA L;  1YJN A;  1DD2 A;  3ULJ A;  3RLF A;  2B3G A;  5M3F B;  4E6I A;  1STN A;  2ZT9 C;  4YHH L;  1NBW A;  2R61 A;  5CYU A;  2MO0 A;  4LFC L;  1ENC A;  3JC6 6;  4ZYS A;  1JWM D;  5EKK A;  2ZJR A;  1J8I A;  5C4J B;  1N34 L;  2NB0 A;  2YU9 H;  1MHW C;  1D5M C;  1SJE D;  3IL8 A;  2EJM A;  2KCC A;  4JOI A;  2J4X A;  2EYJ A;  5I4D A;  4DV2 L;  3P1H A;  4K5V A;  4A3I B;  2R93 G;  4DPG A;  1VQA A;  3L7Z C;  2MP1 A;  2ASB A;  2PMZ B;  4YIJ A;  3MXU A;  1RHP A;  2WP8 J;  5JJK A;  4B3S Q;  2VQE L;  4GOP B;  4A3E G;  2JYO A;  4PV1 C;  2RBM A;  4DAY B;  5C3W A;  1TR5 A;  5JEA G;  1A15 A;  1PZJ D;  1QCB D;  4K6D A;  2JA6 B;  1PZI D;  3K58 A;  3MZ5 A;  1YNJ D;  1IW7 D;  3MXG A;  4PZ8 A;  4PMW A;  4JK1 C;  5M5X H;  3MXN A;  1QOH A;  1QJO A;  4OIK A;  4R4O A;  5E4W C;  3CRL C;  4HJ8 A;  1I6H B;  3KLW A;  4NPS A;  2BDN A;  2XSC A;  4RAU C;  3ONA B;  3K57 A;  2ATW A;  4KJO A;  4FO2 A;  3NHH A;  5COR A;  1JJG A;  1EQV A;  1YNX A;  4O42 A;  1L0X B;  1LTR D;  2OQ0 A;  5ELE A;  2N3S A;  3L0O A;  5IOD A;  1BBW A;  1F2L A;  1YIT A;  1B4O A;  3URY A;  1S40 A;  2WII B;  3FP9 A;  1X3P A;  1E7Z A;  4YCW A;  5IP7 G;  1HPC A;  4OX9 L;  2LXJ A;  2RF4 A;  4F7X A;  2XGT A;  5IIF A;  1NR2 A;  5IYC G;  1PYW D;  4J6H A;  1G6P A;  5HGQ A;  3OW2 A;  1VQF A;  3PGZ A;  1HUM A;  2NTT A;  3BVG A;  1CSP A;  2IWH A;  4CDD C;  1VQ5 A;  1DON A;  2ZM6 Q;  1WTO A;  1LT4 D;  2R93 H;  4FVM A;  2HQL A;  4P72 A;  1S72 A;  4LF9 Q;  4XXE A;  3MXN B;  2WAQ B;  1WTQ A;  3GTK H;  3QJY A;  1B44 D;  2BH8 A;  5M5W B;  4LFB L;  4A3E H;  1KHI A;  4FXG C;  1A6X A;  3L2P A;  1PTO C;  3T56 B;  4QL5 A;  5JEA H;  2JEA I;  2HD3 A;  2LFN A;  1ENF A;  2JXM B;  2QF7 A;  4BBR B;  1WI5 A;  1O80 A;  2F0J A;  3IFT A;  1FJG L;  4DR6 L;  1IYJ B;  5KND A;  1N33 L;  4BY1 G;  3VR5 A;  2I5M X;  1J5E Q;  1UE1 A;  2TMP A;  1GUT A;  1V9P A;  1NMG A;  2X69 A;  4DUZ L;  1I94 Q;  3GV6 A;  2B2V C;  3OTO Q;  4BBS B;  5I2X A;  2N78 A;  2A68 C;  4CJ1 B;  1D6E C;  5TSS A;  2NTS A;  2OTL A;  1F2Y A;  4POF A;  1SE8 A;  2KCN A;  2DGY A;  1CKN A;  2K50 A;  2JQO A;  3OWE B;  1S5C D;  5IP7 H;  4NMZ A;  1M1K C;  3NTK A;  1VS0 A;  1DGS A;  1WTW A;  2ID0 A;  2JN4 A;  5IYC H;  1MI2 A;  3E9H A;  4NB3 A;  4A3J G;  5I6Y A;  3J7A F;  2OEO A;  4JI8 L;  4RA8 A;  4DNR B;  1FL0 A;  2FMC A;  1ML0 D;  5CV4 A;  1Q86 C;  2AWO A;  1LUZ A;  2BA1 A;  1CA6 A;  3HOX B;  1Y1V B;  4FNF A;  3RZO B;  5CBE E;  4O2D A;  1OXV A;  1EWC A;  3I72 A;  1MSG A;  2A74 C;  1TVX A;  3SK5 A;  2QDL A;  5CV5 A;  3I56 A;  1RL2 A;  2ZTE A;  2BOS A;  3E9I A;  1RIP A;  2WV6 D;  3CC4 A;  1GXD C;  4XQQ A;  4PMC A;  4ZKC B;  4DV4 Q;  2EYO A;  1QUQ B;  5IYD G;  1F2Z A;  1B1Z A;  1RTN A;  1E0B A;  1PH6 A;  1P8L A;  1HR0 Q;  4BY1 H;  1Q3L A;  3VYT A;  5FO9 B;  3PIP A;  1FD7 D;  3CXC A;  3SHL A;  1TXY A;  1LAB A;  3RZD B;  4RCN A;  2JA5 G;  1E2V A;  1SE3 A;  4IUN A;  2QA4 A;  3I2Z A;  4KV6 A;  2K14 A;  4QGU A;  1Q7Y C;  4GNX B;  3SVM A;  4GLX A;  4JI5 L;  1HZ9 A;  3S14 H;  2EIF A;  2O5J C;  2UUB L;  4PQX A;  1I4Q A;  5C0X J;  2EJF C;  4L63 B;  4A3J H;  4LF5 Q;  5AJ3 L;  1SNQ A;  1XNR Q;  1I4G A;  2JA8 B;  2HCI A;  1Z9F A;  4FDB A;  5CV7 A;  3U9S A;  4RH6 A;  3MTS A;  3GTJ H;  2L9H A;  4BY7 B;  5C4Z A;  5K5P A;  1YHA A;  1L1O A;  2OQK A;  4HJ7 A;  2A6E D;  1V1Q A;  4A3K G;  4OO1 G;  2B2T C;  3TZD A;  2P5Z X;  2A69 D;  2CW0 C;  2KBN A;  2VY3 A;  3M4Y A;  4ZK9 B;  4TKO B;  1JB3 A;  1M4V A;  3I4O A;  5ELN A;  4QUC A;  1V43 A;  3I7F A;  4ME5 A;  2BH2 A;  5IYD H;  4OGQ C;  3VYS A;  2DN8 A;  2VQE Q;  1CA5 A;  1Y69 U;  2KUM A;  1A3T A;  3M4O H;  4R9W A;  4H02 A;  2Q2H A;  3RR5 A;  4KJN A;  3CMA A;  5C44 G;  2UUC Q;  2JA5 H;  4LF7 Q;  4JBK A;  3T4A C;  1MKH A;  3I4N G;  3S1M B;  4A3F G;  3HOZ B;  4GOP C;  1H9J A;  3OIP A;  4XIG S;  1CTM A;  2OXP A;  2CCZ A;  5JJZ A;  2RDH A;  3TP5 A;  1K8G A;  4A3G B;  3PUY A;  5ELF A;  2K52 A;  3K6O A;  2R7Z G;  5M5Y H;  3A7L A;  2CVR A;  3M7G A;  4MZ9 A;  2I0Q A;  3CME A;  1TWF H;  4A93 G;  1SMY D;  5DAU A;  4A3D B;  3F2B A;  2VZA A;  4IZ8 A;  1WCM G;  1KC8 C;  2RHS B;  1E1T A;  2XRS D;  3DXJ C;  5LMN Q;  1D1I A;  4OWW B;  4CKB A;  4JOI C;  3SR1 A;  4X65 L;  1VQ4 A;  4A3K H;  4OO1 H;  2KVM A;  1O7L A;  1BNZ A;  2N55 A;  1LLR D;  4IPH A;  3ZYY X;  1XTC D;  3PMF A;  4L5T A;  4U67 3;  1H9M A;  2IW3 A;  3D31 A;  1DOM A;  4XT1 B;  5T1I A;  2NN6 I;  1EEI D;  4DK1 A;  4DV6 L;  4DV5 Q;  2SEB D;  4IPG A;  1PFM A;  3DM3 A;  1KQS A;  4V19 0;  5GQO A;  3KUP A;  2VUM G;  2K5W A;  4DR2 Q;  2RSO A;  2ES2 A;  2E76 C;  5C44 H;  1VQL A;  3AEV A;  3I4N H;  1CM9 A;  1FJG Q;  1AEX A;  4A3F H;  4DR4 Q;  2K03 A;  4JI3 L;  2Q2U A;  1GVP A;  3NEL A;  1STY A;  5GAD C;  1EIY B;  1D7Q A;  4AYB B;  1C9O A;  4DU9 A;  3NBH A;  2R7Z H;  4H44 C;  4JI6 Q;  3K8A A;  3U9O A;  2NVY H;  3S2D B;  1EY6 A;  3TN2 A;  1LV9 A;  4A93 H;  2WB1 G;  5LL6 S;  2K5N A;  1CHQ D;  2FFK B;  4IFD I;  4HMI A;  4R1J A;  1DZ1 A;  1JIC A;  2WB1 E;  1WCM H;  2F0Q A;  2PYK A;  3BZD B;  3T16 A;  1WTH A;  3K81 C;  3K7A H;  1N9W A;  1RD9 D;  3HZX A;  5M3M G;  2VS1 A;  4OL7 A;  5KRU A;  3M4P A;  2IL8 A;  4JPB W;  1ILQ A;  4KN4 C;  1IBL L;  1SJH D;  2D0O A;  1EIF A;  1N8R C;  4DK3 C;  1PH3 A;  4N9P A;  2F0I A;  4RKB A;  5EKL A;  5A35 A;  5I6W A;  5HUR A;  1WD0 A;  3FPP A;  3KDF B;  4RGM A;  3PQI A;  2YTY A;  4A3M B;  1EYG A;  3T1Y Q;  3HP3 A;  4LJZ C;  2JA7 B;  1D1K A;  1NUC A;  4UP9 A;  2RKS A;  2EY5 A;  3HOW G;  1B8A A;  5EBC A;  1SRU A;  1CHP D;  1U9R A;  2ZXO A;  4LWC A;  2RCN A;  2VUM H;  3GTQ B;  2VQF L;  1PZK D;  4MIU A;  1JQY D;  2F0G A;  2F0W A;  1O7I A;  1HH2 P;  5BN5 A;  2Z4H A;  3Q8D A;  1U4R A;  4DR7 L;  1X56 A;  5E4X A;  5KNC A;  2NVX B;  3M85 A;  1YBY A;  1YNN C;  2F0H A;  4Q5V A;  1PTO B;  2A73 B;  4ILW A;  1LO5 D;  1KAB A;  4DV7 Q;  2NVQ H;  1BQQ T;  3BDO A;  3S15 H;  4B3T L;  3EFX D;  5J22 A;  1K73 C;  1CFM A;  1BXT A;  2JE6 I;  2ZTC A;  2C9O A;  2SNM A;  3J81 j;  2F0S A;  5BN4 A;  2E2H H;  2KCT A;  5DM6 3;  4JI5 Q;  3QO2 A;  1KAA A;  3UDF A;  2AHO B;  3CCE A;  1WTX A;  1L2F A;  2QCP X;  4OHJ A;  4IUQ A;  5M3M H;  1S5E D;  4DN4 M;  4F87 A;  1X54 A;  1CI3 M;  4RFB A;  4KKT A;  4Z9C B;  4B9W A;  2E5L Q;  1CT1 D;  2L15 A;  3PUV A;  1PV4 A;  3S17 H;  1L0W A;  1I50 H;  2Q2I A;  3NBI A;  2N8N A;  2E2J H;  2PW7 A;  2H5X A;  4IUR A;  5D14 A;  2DJF C;  5EPJ A;  3CW2 C;  1SYB A;  2QKI C;  4A3B G;  1B7Y B;  3A8J E;  3K5O A;  1QB5 D;  4CJ2 C;  1Q1B A;  3HOW H;  1LTI D;  3J80 i;  3W2D A;  4KHV A;  3I90 A;  1UWV A;  5I9P A;  3CCR A;  2K04 A;  2EXD A;  5IWA L;  1HNX Q;  3SDZ A;  4C3H G;  2HCC A;  4X66 L;  1EIH A;  1QNK A;  2F52 A;  1CQF A;  3I3C A;  4HSV A;  4YWK A;  3JAM i;  4R8I A;  2Z6B A;  1SE2 A;  2XIW A;  4QJF A;  3Q0A A;  1ASY A;  4HED A;  4HCE A;  1SBB B;  2LKV A;  3GTL B;  1TWA H;  1RCV D;  1T9H A;  1A2T A;  4I7Z C;  2EOT A;  4X64 L;  4DV1 L;  3I73 A;  4K6L A;  1BKB A;  2DJG C;  3KF8 A;  2BA0 A;  1B3A A;  4IUT A;  1ONL A;  4JI7 L;  2E2I H;  3BDL A;  1YHB A;  1EY7 A;  3HOV G;  4GKJ Q;  1JOQ A;  1A2U A;  1STE A;  3R8B A;  3A8I E;  1JE4 A;  2K5H A;  4JI1 L;  4DUY Q;  1SFO B;  3PO3 G;  3DWA A;  1KDA A;  4HJ5 A;  2R93 B;  2GN5 A;  2JJQ A;  5EPL A;  5IYB G;  3I4M G;  2PZU A;  1EUJ A;  1OXX K;  4H0L C;  3TZU A;  4QMG A;  2R92 B;  1RTO A;  3FKI B;  1BR9 A;  1PH1 A;  4A3E B;  4R4C A;  1L1O C;  3A74 A;  4ZLT F;  4A4I A;  3N6R A;  1VQ6 A;  3UI2 A;  2D5D A;  1AZQ A;  4A3B H;  2XNA C;  1Q1E A;  1V1P A;  2F0E A;  5C5M A;  1Q81 C;  2B63 G;  4X3K A;  1ICF B;  1AP0 A;  4EVO A;  4RHR A;  3TP7 A;  1PRT F;  3TP6 A;  4YCU A;  2NZO A;  2XWB B;  3CHB D;  4C3H H;  2M9V A;  4DXF A;  3CAM A;  2K5D A;  3P7J A;  1M8A A;  1ZYR C;  4NXN L;  2X6L A;  1QVG A;  2FXQ A;  2RHQ B;  5C3E B;  1SND A;  1KRT A;  3T1H Q;  3KK7 A;  5BR8 L;  3M3Y B;  1PLF A;  1I4H A;  3MA2 B;  4PNY A;  4JC0 A;  5IGE A;  3KOJ A;  3LGJ A;  3BZK A;  2C5C A;  3AFP A;  2UUA Q;  1JOO A;  1K3B C;  2F0L A;  4DAP A;  1J6Q A;  1G2S A;  5KYI A;  5LMU L;  3OHX C;  4XDX A;  2B29 A;  3DWP A;  4MTK A;  1H9S B;  3PO3 H;  5JJI A;  3TP8 A;  3FEW X;  5DEH A;  4C2M B;  4EQ5 A;  5IYB H;  3I4M H;  1WTR A;  3D3R A;  5JEA J;  1X9N A;  4PG3 A;  3KLS X;  3MEH A;  4F88 A;  4O1N A;  3S1Q B;  3DEO A;  2VXW A;  2PNR C;  4DR1 L;  1HNZ L;  1HR0 W;  3QB3 A;  3CKI B;  4CDE C;  1K9M C;  2B8G A;  4JI4 Q;  1IBL Q;  3RUZ A;  4FYD A;  3G6J B;  2QDB A;  2B63 H;  2PPB C;  2SNS A;  5C0X I;  4BY1 B;  1C4Q A;  4JI0 Q;  2VL6 A;  5ISR A;  3GTP H;  2LMC B;  4YY3 L;  4HJ9 A;  2B39 A;  1PHJ A;  4LF4 L;  5CC4 A;  2JK8 A;  2L55 A;  3S1R B;  4FF3 A;  2EYP A;  1A63 A;  3S16 H;  3K59 A;  3SK8 A;  2XVS A;  4HIO A;  3HKS A;  2OTJ A;  1Q90 A;  5JAV A;  1FNW A;  3VYU A;  2AUJ D;  2NBF A;  2Q2T A;  3D4W A;  4N8X 1;  1PH5 A;  4XYQ A;  1VF5 C;  1GHK A;  4ZKB B;  4TQU S;  3OW7 A;  3S1N B;  3BG3 A;  3G7L A;  4K0K Q;  2GA4 B;  3OYY A;  3STB C;  1EY8 A;  1EYD A;  4KMU C;  3T13 A;  5EBD A;  3CC2 A;  2I5L X;  3O13 A;  3H3V H;  3CCV A;  4YCV A;  4A3I G;  3CQZ H;  3SXH A;  3R93 A;  1SYC A;  4KY6 A;  1SEB D;  1E2W A;  4WJ3 M;  1BCP F;  4DR5 L;  5COY A;  3P75 A;  4DK0 A;  1CUK A;  1I6V C;  1HA5 A;  4HCS A;  3X3M A;  1I5F A;  1GUO A;  4Y7N H;  1G29 1;  4J15 A;  3HKZ G;  1E24 A;  3GTO H;  4APV A;  4GLV B;  2JA6 G;  2IJ0 A;  3HKZ E;  5CV9 A;  1EOT A;  4OON A;  2Z9H A;  2EJG C;  1PTO D;  2O4X A;  3MC0 B;  2EPB A;  3U58 A;  2EXZ A;  5C4X B;  5CV6 A;  2PQA A;  3WDN A;  3NXW A;  2RVL A;  3U4V A;  2JA5 B;  1G91 A;  2BCO A;  1XMO Q;  1MD2 D;  2UU9 L;  5EGT A;  1IBM Q;  4ODG A;  4KHP Q;  4KI0 A;  1TWG B;  5IWA Q;  1J9O A;  3D6W A;  3EN2 A;  2K32 A;  1LTL A;  2L4N A;  4X66 Q;  1ICW A;  2A68 D;  3SK4 A;  4HTH A;  1GO3 E;  2UXD Q;  1NNX A;  2DY7 A;  3Q24 A;  5CGK A;  3GD7 A;  1XNQ Q;  3E3X A;  3KJP A;  1NY4 A;  5LMN W;  4LF6 L;  1STB A;  3H6M A;  3NP8 A;  1QIL A;  4A3I H;  2WAC A;  4I7A A;  1QG7 A;  3L3O C;  3F2D A;  1OXU A;  4DA2 A;  1QZG A;  2F0F A;  1YIJ A;  4MN3 A;  5EPK A;  3M7N A;  1JOK A;  4ALP A;  3BVZ A;  4LF8 L;  2CWA A;  2EYL A;  1HFN A;  2ICI A;  4ZCK A;  1DM0 B;  1CKN B;  4F8M A;  4IUV A;  2K28 A;  1B3Q A;  2SDF A;  1K0S A;  4OWX B;  3A56 A;  4BBR G;  2JA6 H;  4N8F A;  4CJ0 B;  2EY2 A;  3FVQ A;  2A6H D;  4DV3 Q;  1C0A A;  2B8F A;  4GZY C;  4MHE A;  1EL0 A;  4L5Q A;  1U5K A;  5JPN C;  4X62 L;  4K14 A;  5FOB B;  3RN2 A;  5FO8 B;  3QWN A;  2PNH A;  3I8Z A;  3ICE A;  4C3I B;  1X3G A;  4J1M A;  3S2H B;  1LAC A;  1AFP A;  3HG9 A;  1ENA A;  3NK9 A;  2EE1 A;  3BJU A;  4B3M Q;  3G48 A;  3I55 A;  4JV5 L;  2F0P A;  5IGD A;  2FIN B;  2O2L D;  2D0P A;  1FYC A;  4JYA Q;  3NWS A;  1EWI A;  2JEB I;  4NXN Q;  4JW0 A;  3ZJY C;  5GAG C;  2R7Z B;  1VQG A;  1JCK B;  4YHH Q;  4LAA A;  3QG1 A;  4XYO A;  4NXM L;  3LX0 A;  4IJL A;  2UXB L;  3DWQ A;  5BR8 Q;  1XMQ L;  1M90 C;  2FJ2 A;  4LFC Q;  2PZT A;  1IBK L;  1X3E A;  4LMQ D;  1N34 Q;  5L37 A;  1K0R A;  4L6T B;  1TS4 A;  3A5Z B;  4DV2 Q;  4LFA L;  1HJP A;  4AIM A;  1WFQ A;  4G57 A;  2IX1 A;  1Y1V G;  2PCF B;  2HT1 A;  1AH9 A;  4A3C G;  3EQL C;  4YWL A;  2QEX A;  5LHY 1;  1A0I A;  1VQD A;  2CWP A;  3CU7 A;  2DY8 A;  4BBR H;  1UEA B;  2PI2 A;  3DMU A;  3OSO A;  5JOB A;  1Q8K A;  2L12 A;  4XQJ A;  4WJW A;  1RJT A;  2CW0 D;  3GTM B;  3UDX A;  1HNZ Q;  2VUM B;  4IN3 A;  4ZUJ A;  3AMU A;  1BBU A;  3BS1 A;  3CCM A;  3BDC A;  5JVH 3;  1LTG D;  2MPM A;  1L1O B;  3V2T A;  4OEL B;  4IOC A;  1GUG A;  1R9T B;  1S5D D;  3B6Y A;  2ZTD A;  1FNU A;  2BDO A;  1HZA A;  3DM1 A;  4KD3 A;  1XPU A;  4DV0 L;  1I3Q B;  4EQP A;  1IYU A;  3X3N A;  3BYT B;  2WB1 B;  2IX3 A;  4GKK L;  4HIK A;  4OX9 Q;  2HHH L;  3CPW A;  2HDL A;  3KYH C;  3G6E A;  3RD4 A;  3S24 A;  1CZG A;  2K7V A;  2RA4 A;  3A8K E;  1CKO A;  5DM7 3;  1KIX A;  4BY7 G;  1TWC B;  3TSS A;  3R2I A;  2QW7 A;  3ERQ A;  1PRT C;  4X6A H;  1Q8I A;  1Y1V H;  3PO2 B;  5IGC A;  1Y1W B;  3RZO H;  1SYE A;  3H15 A;  4A3C H;  1I4X A;  2NVT B;  3HOU B;  4JBM A;  4EQN A;  4DAM A;  5JPM C;  1I50 B;  3HOY G;  5KGU A;  2AQ3 B;  4LFB Q;  5G3L D;  2HUG A;  3NUC A;  5FK9 C;  4NDX A;  2L11 A;  4G7H C;  5ELO A;  1JB7 A;  1JMC A;  3W3A A;  1S5B D;  3HRZ C;  4DR5 Q;  2F03 A;  3NEN A;  5HGT A;  1Y8P B;  4DR6 Q;  4C3J G;  1N33 Q;  3LNN A;  3Q6S A;  1TWH H;  1SRO A;  3VYR A;  2ZXR A;  3RZD H;  1OXS C;  2E8G A;  3J80 L;  1XJV A;  4DUZ Q;  4H13 C;  3J7Z C;  5I9O A;  1VQM A;  1PH9 A;  1A62 A;  3HOZ G;  1F77 A;  1NTG A;  2Y0S B;  1XPR A;  2DUD A;  3JAM L;  1ET6 A;  2PQE A;  1RKN A;  1YI2 A;  5E3F A;  3JAM c;  2AKW B;  1SMX A;  3MXP A;  4ULL A;  3QOL A;  2ENB A;  5M9O A;  2J7Z A;  3QR8 A;  1HQM C;  2PI2 E;  1NCV A;  4A3D G;  4B3S L;  3LWU A;  3BVM A;  3PIO 3;  4IUU A;  4JI8 Q;  1JWU D;  1AZP A;  1CKM A;  4BY7 H;  3J81 i;  1ZKO A;  3FDT A;  2BE5 C;  3Q23 A;  3U4Z A;  5AFW A;  4CHT B;  2NWG A;  4QF4 A;  1B9N A;  3GTG B;  1KNA A;  4PZ7 A;  1TKW B;  2G9D A;  3J7A V;  2MFI A;  1GUS A;  3HOY H;  3VR2 A;  2E2D C;  2C35 B;  3NBH B;  3AB9 A;  1S5F D;  1C48 A;  2F4V L;  4DGZ A;  4DKA C;  2MNA A;  3TS2 A;  2B2Y A;  3PUZ A;  4A3B B;  1STH A;  1HXY D;  3K5N A;  1ZXT A;  4KY5 A;  4LF8 Q;  4MNO A;  4XQN A;  4C3J H;  3GV3 A;  1WTV A;  3V96 A;  1I4P A;  1SLJ A;  3WWV A;  1UE6 A;  4HMJ A;  1LTB D;  2CH4 A;  2LS0 1;  2Z6K A;  2F4I A;  1KLU D;  1X6O A;  3KF6 A;  2MJ8 A;  2K6A A;  5FLX L;  4B9X A;  3S1M H;  4FXK C;  3HOZ H;  3OOC A;  3U50 C;  4BS9 A;  4CDC C;  1X3Q A;  4AYB G;  2F1M A;  4POG A;  2TSS A;  3RMH A;  4UY8 C;  5IGB A;  1PH7 A;  1BCP C;  1L0Y B;  2UUB Q;  1EU4 A;  2AWN A;  2YU9 B;  3K5L A;  1F9P A;  3GP7 A;  4LNQ A;  1YNN D;  3FMC A;  3K5M A;  2A5H A;  1VCI A;  1W6J A;  3D4D A;  4A3D H;  1HNW L;  1B53 A;  4LF9 L;  4QIW B;  1MIU A;  2RQX A;  3C3L A;  5AJ3 Q;  1R4P B;  1FVI A;  5E7N A;  1JJC B;  1GM5 A;  1E1O A;  3PSI A;  1SYD A;  2LXK A;  3J80 E;  1Q82 C;  2F0T A;  1RDP D;  1LTS D;  1PFB A;  1XMQ Q;  4XT3 B;  2KOL A;  2OF1 A;  1YHQ A;  3E0E A;  3H0G G;  3JAM E;  3QIA A;  5CMD A;  1NE3 A;  3HFZ B;  1J5E L;  1ASZ A;  1F9S A;  3UDI A;  4ZRZ A;  3VR3 A;  1I94 L;  2WKD A;  4K5X A;  4A3M G;  3OTO L;  2JA7 G;  4DK6 C;  5I2Y A;  5M5X B;  4NP5 A;  4HID A;  4JVZ A;  3MWY W;  3QOJ A;  3CCJ A;  3GTP B;  1BUV T;  3F8T A;  1PH8 A;  1VQ9 A;  4PZ6 A;  1MJE A;  3GO5 A;  3G4S A;  5GRO A;  4YWM A;  1C7Y A;  2EQS A;  1OO9 B;  1GOZ A;  1G6Z A;  1PYS B;  1XWE A;  1EWH A;  3S16 B;  4U68 A;  4LUZ A;  1UUP A;  3EVQ A;  2NN6 G;  1SSO A;  3L9A X;  1EQQ A;  2WFW A;  2YV5 A;  3S2D H;  4HAE A;  3M4Q A;  4KLK A;  1MSH A;  1EYA A;  3FPU B;  1SNC A;  3AQQ A;  4FP5 D;  4JI2 L;  1U4L A;  2F0O A;  4ZUI A;  1Q46 A;  5DNF A;  3GTK B;  2KEN A;  4OXP A;  5FLX E;  1QE6 A;  4GKK Q;  4L8J A;  3UDG A;  3MVV A;  1NAP A;  3E5S A;  3H91 A;  1DCZ A;  4LUO A;  3I91 A;  1HR0 L;  2OWO A;  3H0G H;  4X65 Q;  2I5H A;  2F3I A;  3KF8 B;  1HTL D;  2R6G A;  5IOC A;  4A3M H;  2HQE A;  2JA7 H;  3NEM A;  2XTI A;  4IFD G;  1PH2 A;  5J39 A;  2RDG A;  2KEC A;  3CF5 A;  1GKH A;  5G3L F;  1ESR A;  4DV6 Q;  1ET9 A;  3GTQ H;  2KQ3 A;  3K7U C;  4X3S A;  4QCL A;  1JT8 A;  2KA7 A;  5CV8 A;  1R4Q B;  4DR3 L;  4K5W A;  2NVX H;  1UNS A;  4DAY A;  2ALY B;  4P2C B;  1VQ8 A;  1PTO H;  3HEJ A;  3ER0 A;  2CFM A;  1PFS A;  1I4R A;  1SYF A;  2CHB D;  4LF5 L;  1XNR L;  4JI3 Q;  3DHQ A;  3HOV H;  4RKL A;  2NN6 H;  1VMP A;  1EQT A;  1ZYR D;  2E75 C;  1HHV A;  4C56 C;  3D8G A;  3OMG A;  1LM0 A;  2O5I C;  1V1P B;  5IY0 A;  5IGG A;  1SN8 A;  1XTD A;  2J0T D;  2IHE A;  4UPA A;  1FGB D;  4BXX G;  4K2L A;  2EZV A;  2KJX A;  4CDF C;  5J3B A;  3J7Y W;  1STA A;  4Y52 H;  2X6G A;  5EQ0 A;  1YNJ C;  1B2T A;  5KIX A;  1IW7 C;  1TU2 B;  4WFN 3;  1X32 A;  4Q0F A;  1U4M A;  3E0J A;  3D4R A;  2R92 G;  3FKI G;  4QUF A;  1K3R A;  1GJX A;  1WVL A;  2AQ2 B;  3TBI B;  2FHT A;  1WYD A;  1G2T A;  1KNE A;  3HKZ B;  1G51 A;  5NUC A;  4IFD H;  3VR4 A;  1MBY A;  5DLQ E;  2DNC A;  2UUC L;  4LF7 L;  1SNM A;  1KRS A; 
#chains in the Genus database with same CATH homology
 2KHJ A;  4X62 L;  1XMO L;  1UEB A;  4UP7 A;  4DR2 Q;  1IZ6 A;  4AQY L;  3RN2 A;  1IBM L;  1KD1 C;  2ES2 A;  5C44 H;  2F4V Q;  2PNH A;  5EAY A;  1VQL A;  3AEV A;  3ICE A;  4KHP L;  1X3G A;  3M9B A;  1QVC A;  3I4N H;  1VQI A;  4GN3 B;  4L5R C;  1E3P A;  1FJG Q;  4KHZ A;  2VQF Q;  4A3F H;  4DR4 Q;  4OO1 I;  4JI3 L;  5M3F G;  2Q2U A;  1GVP A;  3NEL A;  5GAD C;  1EIY B;  1QVF A;  3BJU A;  1D7Q A;  4B3M Q;  3G48 A;  3I55 A;  4DR7 Q;  1C9O A;  5C3E G;  3GTL H;  1JE5 A;  4JV5 L;  4IPC A;  2D0P A;  2UXD L;  3W5O A;  2R7Z H;  1VQH A;  3PUW A;  4JYA Q;  4JI6 Q;  1EWI A;  2JEB I;  3K8A A;  4NXN Q;  4RMF A;  3ZJY C;  5GAG C;  2K5V A;  2NVY H;  1Y14 B;  1XNQ L;  4B3T Q;  1VQG A;  4A93 H;  2WB1 G;  1AE2 A;  2K5N A;  4GLA C;  1VQB A;  4YHH Q;  3RLN A;  4IFD I;  4R1J A;  1K83 H;  4NXM L;  4IJL A;  2UXB L;  5BR8 Q;  2WB1 E;  1XMQ L;  1M90 C;  1WCM H;  1KAW A;  5LMN L;  1NJI C;  4LFC Q;  4DV0 Q;  4IO9 A;  1KXL A;  1VQO A;  3K81 C;  3K7A H;  4BXX H;  1N9W A;  4R4T A;  1IBK L;  1X3E A;  1N34 Q;  1K0R A;  5M3M G;  1PA6 A;  2VS1 A;  4DV4 L;  2HHH Q;  1SFO H;  2PMZ E;  3A5Z B;  3M4P A;  1VQN A;  4QIW E;  1E22 A;  4DV2 Q;  4LFA L;  1IBL L;  1HJP A;  1W2B A;  1IL2 A;  4IPD A;  1WFQ A;  4IJH A;  4AIM A;  2D0O A;  1Y1V G;  2KCM A;  3SGI A;  1EIF A;  1N8R C;  2HT1 A;  1OXT A;  4DK3 C;  1PH3 A;  1HNW Q;  1AH9 A;  3CPF A;  4A3C G;  3STB D;  3GTG H;  2R92 H;  3TRZ A;  3RN5 A;  3W1G A;  4IFD J;  3FKI H;  2UXC L;  2IX0 A;  4DV5 L;  3VDY A;  1PH4 A;  4YWL A;  2QEX A;  4DV3 L;  3KDF B;  1A0I A;  1VQD A;  1VQK A;  2YTY A;  2CWP A;  1D8L A;  1FGU A;  4P73 A;  1EYG A;  3T1Y Q;  4BBR H;  2IHF A;  1VQP A;  2PI2 A;  2LSS A;  3J7A 5;  4UP9 A;  4DR2 L;  3HOW G;  1B8A A;  1Q8K A;  2HIV A;  1SRU A;  4LW1 A;  4LWC A;  2RCN A;  3CP0 A;  2VUM H;  3UDX A;  1HNZ Q;  4HJA A;  2VQF L;  4GS3 A;  2ZJP A;  4DR4 L;  4GOP A;  1K8A C;  4IOA A;  3TS0 A;  1O7I A;  1HH2 P;  3AFQ A;  4JG2 A;  1W3S A;  3Q8D A;  5H1S E;  1VQ7 A;  1BBU A;  4B3M L;  4DR7 L;  3K80 C;  1X56 A;  3CCM A;  2K75 A;  3CC7 A;  2Z0S A;  3TRE A;  3M85 A;  1YBY A;  4GN5 A;  5M3F H;  4JYA L;  5GAH C;  4JI6 L;  1YJN A;  3ULP A;  1L1O B;  5IT9 c;  4B3R L;  3ULJ A;  3G71 A;  4DV7 Q;  3RLF A;  2B3G A;  5C3E H;  2NVQ H;  3S15 H;  2A19 A;  4B3T L;  4IOC A;  2Z6K C;  1QUQ A;  4YHH L;  1K73 C;  2MQH A;  1NBW A;  3M3Y H;  3B6Y A;  2JE6 I;  2ZTC A;  2ZTD A;  4JCV E;  2MO0 A;  1HZA A;  4LFC L;  3JC6 6;  5C4J H;  3J81 j;  4DV0 L;  2R7D A;  2E2H H;  4X64 Q;  1XPU A;  4DV1 Q;  2KCT A;  3BU2 A;  2ZJR A;  4JI5 Q;  1N34 L;  2YU9 H;  4GKK L;  4HIK A;  4OX9 Q;  2HHH L;  4JI7 Q;  3UDF A;  2AHO B;  4JOI A;  4DV2 L;  3CCE A;  1L2F A;  3CPW A;  2R93 G;  4DPG A;  1VQA A;  3KYH C;  3L7Z C;  5M3M H;  3S24 A;  3G6E A;  2ASB A;  1CKO A;  1VQJ A;  1X54 A;  2WAQ G;  1KIX A;  4BY7 G;  1Q12 A;  4GNX A;  2WP8 J;  2E5L Q;  5JJK A;  4X6A H;  4B3S Q;  4C2M H;  4JI1 Q;  2PQA B;  2VQE L;  1Y1V H;  2L15 A;  3PUV A;  1PV4 A;  3S17 H;  2WAQ E;  3RZO H;  5K36 G;  1N32 L;  1L0W A;  1I50 H;  2Q2I A;  5HY6 A;  2N8N A;  3PCO B;  3H15 A;  4GOP B;  4A3E G;  2E2J H;  4A3C H;  2H5X A;  4DAY B;  3T1Y L;  2JA9 A;  4JBM A;  4DAM A;  3RNU A;  3S1Q H;  3HOY G;  3CW2 C;  1SR3 A;  5JEA G;  4JI2 Q;  4LFB Q;  4A3B G;  1B7Y B;  5JJL A;  1EFW A;  5ELO A;  1JB7 A;  1JMC A;  2N49 A;  1JJ2 A;  2K4K A;  1X3F A;  1Q1B A;  1N36 L;  1AE3 A;  3HOW H;  3J80 i;  4DR5 Q;  4PZ8 A;  4PMW A;  3CD6 A;  3NEN A;  1I6H H;  1UWV A;  5M5X H;  3CCR A;  2EXD A;  5IWA L;  1HNX Q;  4BBS G;  4R4O A;  4DR6 Q;  4HJ8 A;  1N33 Q;  3KLW A;  4X66 L;  1TWH H;  4NPS A;  3PF4 A;  1SRO A;  2F52 A;  2ATW A;  4DV7 L;  4YWK A;  2A1A A;  3F1Z A;  3JAM i;  3RZD H;  1OXS C;  2E8G A;  4QJF A;  1XJV A;  1ASY A;  5C4X G;  4DUZ Q;  1JJG A;  1PVO A;  1YNX A;  3J7Z C;  1VQM A;  3DLL A;  1PH9 A;  1MJC A;  1A62 A;  2OQ0 A;  1TWA H;  3S1R H;  3HOZ G;  2N3S A;  1T9H A;  2IT1 A;  1NTG A;  3L0O A;  1GD7 A;  1XPR A;  2DUD A;  1BBW A;  4X64 L;  4DV1 L;  1BKB A;  1YIT A;  1S40 A;  1YI2 A;  3FP9 A;  5IP7 G;  1E7Z A;  2BA0 A;  4YCW A;  3W1B A;  4RG1 A;  4XTC S;  4OX9 L;  2V1C C;  4JI7 L;  2LXJ A;  2VW9 A;  2RF4 A;  3JAM c;  2AKW B;  2XGT A;  5IYC G;  1YHB A;  1SMX A;  4DR3 Q;  2E2I H;  2IX1 A;  1G6P A;  3HOV G;  4GKJ Q;  5HGQ A;  3OW2 A;  3S1N H;  1VQF A;  3PGZ A;  5C0X G;  2PI2 E;  5IP9 G;  1CSP A;  4A3D G;  1VQ5 A;  4EX5 A;  1U0L A;  2ZM6 Q;  2E5L L;  2K5H A;  4B3S L;  4JI1 L;  4DUY Q;  3HOX G;  2R93 H;  4JI8 Q;  2HQL A;  4P72 A;  3PO3 G;  1CKM A;  1S72 A;  4HJ5 A;  4BY7 H;  2GN5 A;  2JJQ A;  5IYB G;  4LF9 Q;  3J81 i;  3I4M G;  5LMU Q;  5M5W H;  3MXN B;  3U4Z A;  1EUJ A;  1OXX K;  1X65 A;  3GTK H;  2YTX A;  2BH8 A;  4LFB L;  1IXR A;  4PZ7 A;  4A3E H;  1KHI A;  2MFI A;  1QZH A;  3L2P A;  2YTV A;  1PH1 A;  3CCL A;  3HOY H;  5IE8 A;  4R4C A;  1L1O C;  3A74 A;  4QL5 A;  2JEA I;  2C35 B;  4A4I A;  3NBH B;  1VQ6 A;  4A3B H;  1Q1E A;  2F4V L;  4DKA C;  1WI5 A;  2MNA A;  3TS2 A;  2A8V A;  3PUZ A;  1HNX L;  4DR1 Q;  1FJG L;  1IYJ B;  4DR6 L;  1N33 L;  3J81 c;  4BY1 G;  2I5M X;  1Q81 C;  2B63 G;  2ZJQ A;  4LF8 Q;  1EOV A;  1WOC A;  1J5E Q;  1UE5 A;  3A0J A;  4MNO A;  1UE1 A;  1V9P A;  1NMG A;  4BBS H;  2QGQ A;  4YCU A;  2NZO A;  3ULL A;  4C3J H;  4C3H H;  4DUZ L;  1I94 Q;  3OTO Q;  1SLJ A;  3CAM A;  3WWV A;  1UE6 A;  2N78 A;  4NXN L;  2Z6K A;  1QVG A;  5C4X H;  1X6O A;  2OTL A;  3KF6 A;  4HIM A;  1X55 A;  2FXQ A;  2RHQ B;  4POF A;  1SE8 A;  3S1M H;  4BA2 I;  4YY3 Q;  4A3L G;  2VNU D;  2GVA A;  3HOZ H;  1KRT A;  2MO1 A;  2DGY A;  3T1H Q;  1CKN A;  4LF4 Q;  1BVS A;  2K50 A;  5BR8 L;  2JQO A;  3U50 C;  4LUV A;  4JBW A;  1TWG H;  4AQY Q;  4AYB G;  4POG A;  4GKJ L;  4JC0 A;  5IP7 H;  1S3O A;  4UY8 C;  3KOJ A;  3PIO A;  3LGJ A;  1M1K C;  1VS0 A;  1DGS A;  3BZK A;  1PH7 A;  1YJ9 A;  2ID0 A;  2UUB Q;  5IYC H;  3AFP A;  3E9H A;  4NB3 A;  2AWN A;  4A3J G;  2UUA Q;  2JA8 G;  4DUY L;  1H95 A;  1J6Q A;  4LNQ A;  3CCU A;  4JI8 L;  1VCI A;  5IP9 H;  1FL0 A;  3EBE A;  1HNW L;  4A3D H;  4P75 A;  4LF9 L;  5LMU L;  2HIX A;  1MIU A;  3HOX H;  5AJ3 Q;  1Q86 C;  5E7N A;  1FVI A;  1Z47 A;  2AWO A;  1JJC B;  2B29 A;  1GM5 A;  1E1O A;  1LUZ A;  2BA1 A;  3PO3 H;  3PSI A;  5JJI A;  5IYB H;  2LXK A;  4EQ5 A;  1OTC A;  3I4M H;  1Q82 C;  5JEA J;  1HZC A;  1X9N A;  4O2D A;  1OXV A;  4PG3 A;  1XMQ Q;  3I56 A;  1RL2 A;  3KFU A;  2ZTE A;  4DNI A;  1HZB A;  3E9I A;  1YHQ A;  4DR1 L;  3E0E A;  1RIP A;  3PUX A;  4O0A A;  3H0G G;  1HNZ L;  1HR0 W;  3CC4 A;  4DV4 Q;  1QUQ B;  1NE3 A;  3HFZ B;  4QY7 A;  5IYD G;  1J5E L;  3F2C A;  3PV0 A;  3UDI A;  1ASZ A;  1K9M C;  1PH6 A;  3UE1 A;  1P8L A;  4JI4 Q;  1IBL Q;  1HR0 Q;  1I94 L;  4BY1 H;  3IRB A;  4A3M G;  3OTO L;  4R4Q A;  2B63 H;  4DK6 C;  2JA7 G;  4HID A;  5C0X I;  4JI0 Q;  2VL6 A;  1WJJ A;  3GTP H;  3PIP A;  2UXC Q;  3PF5 A;  3CXC A;  3CCJ A;  2AMC B;  3RLO A;  1TXY A;  1YJW A;  4YY3 L;  4HJ9 A;  1CSQ A;  4R4I A;  3F8T A;  3T1H L;  1PH8 A;  1PHJ A;  1VQ9 A;  2JA5 G;  4OWT B;  3J80 c;  2QA4 A;  4LF4 L;  4PZ6 A;  3I2Z A;  1MJE A;  4C3I H;  3GO5 A;  2K14 A;  2JK8 A;  5GRO A;  4QGU A;  3G4S A;  1Q7Y C;  4A3L H;  4YWM A;  1YZ6 A;  1B70 B;  4GNX B;  1C7Y A;  2EQS A;  4A75 A;  4JI5 L;  4GLX A;  1HZ9 A;  3S16 H;  1PYS B;  3S14 H;  4A3G G;  2EIF A;  1A63 A;  4HIO A;  5FJ8 G;  3HKS A;  2UUB L;  2OTJ A;  2Q2T A;  2UUA L;  3KDF A;  4LUZ A;  4ME3 A;  5C0X J;  2UU9 Q;  1PH5 A;  2NZH A;  3CCS A;  2KHI A;  1P16 A;  3FHW A;  3AYH B;  2NN6 G;  4TQU S;  1EQQ A;  2JA8 H;  4A3J H;  4LF5 Q;  4L5S A;  2WFW A;  2YV5 A;  3S2D H;  5AJ3 L;  3D0F A;  3M4Q A;  1XNR Q;  4K0K Q;  2GVB A;  4B3R Q;  3OYY A;  1Z9F A;  4FDB A;  3STB C;  4KLK A;  3TQY A;  3S2H H;  3EIV A;  3TEH B;  4JBJ A;  3CC2 A;  2I5L X;  3GTJ H;  4MTN A;  3H3V H;  4TVA B;  4P74 A;  3CCV A;  3AQQ A;  4YCV A;  4A3I G;  4JI2 L;  3CQZ H;  1Q46 A;  2CQO A;  3ERS X;  4LF6 Q;  1YHA A;  1L1O A;  2OQK A;  4HJ7 A;  2KEN A;  4OXP A;  1V1Q A;  4A3K G;  4OO1 G;  4GKK Q;  4WJ3 M;  3UDG A;  4DR5 L;  1LYL A;  2KBN A;  2VY3 A;  1Y1W G;  3PO2 G;  3CCQ A;  2YYZ A;  3GDE A;  1CUK A;  1NMF A;  4LUO A;  1EQR A;  3H0G H;  1HR0 L;  2OWO A;  4JI4 L;  3I4O A;  4X65 Q;  1I5F A;  5ELN A;  3HOU G;  4Y7N H;  2IY5 B;  1V43 A;  3I7F A;  1G29 1;  2BH2 A;  5IYD H;  2I5H A;  4J15 A;  3HKZ G;  1E24 A;  5FLM G;  2F3I A;  4APV A;  4JI0 L;  3GTO H;  3KF8 B;  2R6G A;  3UE0 A;  1A8V A;  2VQE Q;  4GLV B;  4A3M H;  2JA6 G;  3BZC A;  3HKZ E;  3NEM A;  2JA7 H;  2XTI A;  1N32 Q;  4IFD G;  3M4O H;  1PH2 A;  1UE7 A;  3A5U A;  4OON A;  1YVC A;  3CF5 A;  1GKH A;  1VQE A;  2Q2H A;  4H02 A;  4UP8 A;  3RR5 A;  3CMA A;  2R7F A;  4BA1 I;  4DV6 Q;  1KL9 A;  3GTM H;  3H3V I;  3GTQ H;  3U58 A;  5C44 G;  2UUC Q;  2JA5 H;  3K7U C;  3MEF A;  4JBK A;  4LF7 Q;  2PQA A;  1JT8 A;  1MKH A;  3I4N G;  4X62 Q;  3U4V A;  1N36 Q;  4WJ4 A;  5FLX c;  4A3F G;  1XMO Q;  4DR3 L;  2UU9 L;  2NVX H;  4GOP C;  1IBM Q;  2ALY B;  4A3G H;  4XIG S;  1VQ8 A;  4KHP Q;  4KI0 A;  5FJ8 H;  3ER0 A;  5IWA Q;  2CCZ A;  1K8G A;  2CFM A;  3EN2 A;  1PFS A;  4AYB E;  4LF5 L;  3PUY A;  2ZM6 L;  1LTL A;  4X66 Q;  2K52 A;  2Y0S G;  4JI3 Q;  5M5Y H;  1R9T H;  1XNR L;  3HOV H;  2R7Z G;  4K0K L;  4MZ9 A;  2CKZ B;  2Y0S E;  4GN4 B;  3CME A;  2I0Q A;  1TWF H;  4JV5 Q;  4A93 G;  1LM0 A;  1GO3 E;  2UXD Q;  5IY0 A;  1I3Q H;  1PYB A;  1SN8 A;  3F2B A;  2VZA A;  1XTD A;  3GD7 A;  1XNQ Q;  1WCM G;  2IHE A;  1NY4 A;  3KJP A;  1KC8 C;  5LMN W;  4LF6 L;  4QQB X;  2RHS B;  4UPA A;  1E1T A;  4BXX G;  4NXM Q;  4A3I H;  2UXB Q;  1YEZ A;  5J3B A;  4Y52 H;  5LMN Q;  3F2D A;  4OWW B;  4JOI C;  1OXU A;  1TWC H;  4X65 L;  1VQ4 A;  4A3K H;  2D62 A;  1QZG A;  1IBK Q;  1YIJ A;  3M7N A;  3KF6 B;  4ALP A;  4LF8 L;  4IPH A;  2CWA A;  3PO2 H;  1Y1W H;  4AH6 A;  2R92 G;  1VQC A;  4LFA Q;  4GNX C;  3FKI G;  2NVT H;  1CKN B;  4L5T A;  3HOU H;  1K3R A;  4A76 A;  3D31 A;  1XPO A;  5FLM H;  1WYD A;  2NN6 I;  4P71 A;  5GAE C;  4OWX B;  4BBR G;  2JA6 H;  3KJO A;  1G51 A;  4DV6 L;  4DV5 Q;  2OCE A;  4DV3 Q;  4IPG A;  5DLQ E;  3K0X A;  3DM3 A;  1KQS A;  2UUC L;  4LF7 L;  1KRS A;  1C0A A;  5GQO A;  4L5Q A;  2VUM G;  1U5K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...