1HNZQ

Structure of the thermus thermophilus 30s ribosomal subunit in complex with hygromycin b
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
104
structure length
104
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYQSLSKRGGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title The structural basis for the action of the antibiotics tetracycline, pactamycin, and hygromycin B on the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 16
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2000-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1hnzQ00
3CXCA 3PF4A 2K5NA 1HNXQ 1WOCA 1KQSA 1HNZQ 2NVYH 1Z9FA 4UPAA 1X65A 2PNHA 4DR1Q 4BXXH 2E2IH 4OWXB 2JA6H 4P73A 1TWCH 4JOIC 3TEHB 3J81i 3CC7A 2MFIA 4DKAC 4JYAQ 4JI7Q 2EIFA 3GTPH 4JI1Q 1BVSA 2DUDA 4YWMA 5IP9G 5C3EH 2VQEQ 1HZAA 1VQKA 1Q12A 1QUQA 4JBMA 1K0RA 2BA1A 3A5UA 4DR3Q 3I2ZA 2B63H 3GTOH 4A3LG 3S24A 3RN2A 2PI2A 2HT1A 1QVFA 3HKSA 3HKZG 4LFCQ 3HOWH 3H0GG 2GVBA 5AJ3Q 2ZM6Q 1MJEA 4KLKA 4DV6Q 3I4NG 4GS3A 1NY4A 4OX9L 1EOVA 2B3GA 1TWFH 2LXKA 3I55A 1VQ6A 1K83H 3F8TA 1QZHA 4P74A 1D7QA 2NVTH 2R92G 3W1BA 4YCVA 2I5HA 1C7YA 3S2HH 2MO1A 4A3IG 4JC0A 1RIPA 4DUYL 3H15A 1QVCA 2LSSA 3HOZG 2RHQB 3J7A5 3WWVA 1OTCA 3GTQH 3I56A 3L7ZC 4HIMA 4A3DH 1U0LA 4IPHA 3K0XA 1K8GA 3UE0A 1YI2A 3EN2A 5HGQA 5M5WH 2OWOA 4JI8L 2IX1A 1CKNB 4QJFA 1WJJA 2K4KA 3J81c 1XPOA 3H3VH 4BY7G 3GTJH 1Z47A 2UXDQ 3S1NH 1HH2P 3S16H 5IYCG 5GAHC 4DV1L 4LF6L 5FLMG 1SMXA 4PZ7A 3CC2A 3PIOA 5IYDG 1AE2A 1PH1A 2F52A 4DV2Q 2JA5H 1B8AA 1FJGL 2N3SA 1QZGA 1K3RA 1CUKA 2YYZA 3KF6B 2N49A 1XMQQ 2HIXA 2K75A 5C4XH 1XPRA 3CCSA 4LF8L 4DR6L 1KHIA 2WFWA 2YU9H 4LF7L 1PH6A 3T1HL 5IWAL 1Y1WG 3H3VI 3RN5A 1KC8C 1GM5A 2NVXH 3JAMi 4R4IA 3CCVA 2NN6G 4B3TQ 3PUXA 2MNAA 2B63G 1XNQL 4TVAB 3PCOB 2H5XA 5LMNQ 1VQDA 1QVGA 1PH8A 3MXNB 4A3EH 3RR5A 1UE6A 3F2CA 2UXCQ 3CCEA 5IYBH 3F1ZA 1NBWA 4GLAC 3KFUA 4LUZA 3UDGA 4JI2L 4OWWB 3HKZE 5LMUL 1R9TH 4A3BG 1E22A 4P75A 2ZJPA 3CW2C 5M3MH 2A8VA 4KHZA 2ZTDA 4P71A 4X62Q 1N33L 1FL0A 1CKNA 4LUVA 3U4VA 2HHHL 2UUBQ 2XGTA 1S3OA 2JQOA 4UP8A 3RLFA 1JMCA 4A3DG 5C44H 2EXDA 2Y0SE 3UDIA 3TRZA 2K52A 4DAMA 1GD7A 4LFBQ 2UXCL 4DV4L 1N34Q 3JC66 1LM0A 4B3ML 3AEVA 2KCTA 1WCMH 2I5MX 2PMZE 4A3KH 1G51A 1VQHA 4APVA 4AYBG 4DR5Q 1SROA 1HR0Q 2JA8H 4WJ4A 4X66L 4KHPQ 1VQ4A 5BR8L 4LWCA 3S1QH 2D0PA 1GO3E 3CAMA 3KF6A 1YBYA 3ULJA 2IY5B 3PUWA 1KRSA 2IHEA 1CSQA 3CP0A 1YZ6A 4OONA 4RMFA 4HJ9A 4BBSG 2PI2E 3ULLA 3RNUA 3BU2A 1Q1EA 2RHSB 4IFDJ 4LF4L 1IBML 4OWTB 4DUZQ 2UU9Q 2VQFL 2JA5G 1SLJA 1IZ6A 4DV7Q 1J5EL 1V9PA 3CCJA 4JI5Q 1WFQA 3KF8B 5IP7H 4A3JH 4O2DA 3A74A 1YEZA 5C4XG 4GOPB 3OW2A 4X65Q 4OO1I 2V1CC 4JG2A 2UUCQ 4X64Q 4DV5L 2N78A 3PGZA 3EIVA 5GAGC 1HJPA 1EIFA 3RLNA 2MO0A 4KI0A 3J80i 1VQLA 1UEBA 1TWHH 5K36G 1YJWA 1YHBA 4HJAA 4IPDA 1K9MC 2WB1G 2NZOA 2UUAL 3T1YL 4POFA 2BH2A 1IXRA 4DR4Q 4BA1I 4JV5L 4A3EG 1O7IA 2Q2UA 1HZCA 1S72A 3OTOL 2L15A 4YY3Q 4JI3Q 3GO5A 4R4QA 4XIGS 2AWNA 1JJ2A 4GKJQ 1Y14B 4GLXA 4B3SL 1B70B 1A0IA 4YWLA 5FJ8G 2VL6A 1D8LA 2EQSA 1X56A 1HNXL 1EUJA 4JI0Q 3PO2G 1Q81C 4GKKQ 3STBD 3CCQA 1E1TA 3CQZH 4LF9Q 1HNZL 3G48A 3NELA 4BY1H 3HOYH 3PUYA 1I94Q 5M5YH 3CD6A 3J7ZC 1E7ZA 3D0FA 4HJ7A 4J15A 3PV0A 4DR1L 1XMOQ 4A93H 1G6PA 2LXJA 5J3BA 3M7NA 1EFWA 3M85A 4JYAL 4OO1G 2VNUD 4JI7L 1SN8A 4UP9A 3W1GA 2JA7H 1XJVA 4JI1L 2Q2IA 2QEXA 2VQEL 1HZBA 1WCMG 1DGSA 2JA6G 1NTGA 2C35B 4HJ8A 1OXTA 3F2BA 1N32Q 1MJCA 1VCIA 2JA8G 4QY7A 3STBC 1CKMA 1IYJB 2Y0SG 4EX5A 4IFDI 4DR3L 1EYGA 1TWGH 5M5XH 2K14A 3KYHC 4UP7A 4GOPA 1EIYB 1OXXK 1PYBA 2VS1A 4MNOA 4AYBE 4LFCL 3J80c 3GTKH 4IOAA 3A5ZB 3HOXH 1H95A 1BBWA 1YJNA 5AJ3L 2ZM6L 4JBJA 4DV6L 4JI6Q 1KRTA 3AFQA 3GDEA 1VQ5A 4A3GH 4PZ6A 5JJLA 1HR0W 2GN5A 3PSIA 2IT1A 4LUOA 5M3FH 3E9HA 2OCEA 2CWPA 1OXSC 1PV4A 2N8NA 1TWAH 2XTIA 4AQYQ 2VUMH 3CF5A 2Q2TA 3CPFA 3RZDH 1VQ8A 1BBUA 4XTCS 1X6OA 3G71A 4K0KQ 2NVQH 4P72A 4L5TA 4DPGA 2UXBQ 4ME3A 3FKIH 3CMEA 4BXXG 3TQYA 4NB3A 4LFAQ 1HZ9A 4WJ3M 1HNWQ 4A3FH 3ERSX 3UDXA 2R7ZH 1E1OA 5C3EG 2WB1E 4DR2Q 1J6QA 4YCUA 4A75A 1M1KC 2F4VQ 4IFDG 2UXDL 1JE5A 4DV0Q 4A3MH 2R7FA 4DAYB 4MZ9A 4Y7NH 4LNQA 4C3HH 3NBHB 1N36Q 3I4MH 1OXUA 4R1JA 1UWVA 4YHHQ 2ZJRA 4NXNQ 2JEAI 4MTNA 4IJLA 3S15H 3HOYG 1PH7A 3L0OA 1GVPA 3HOWG 5C0XJ 3RLOA 4AIMA 4DV3Q 4DV2L 4A93G 1KAWA 1N8RC 1PVOA 4JCVE 1YJ9A 4LF5Q 3S2DH 4JBWA 4B3RQ 3ULPA 1XMQL 2AMCB 3HOUH 3G6EA 1IBLQ 1IBKQ 2RCNA 1L2FA 2E5LQ 4GOPC 3E9IA 4BBRH 2YTXA 4C2MH 1W3SA 4QIWE 1EQRA 4A3CH 3M3YH 5IE8A 3K7UC 2CQOA 4B3TL 1S40A 3KDFB 3GTLH 1NMGA 2WP8J 5LMNL 3U50C 3I4OA 1AE3A 2QGQA 1LYLA 4A3GG 2VY3A 1RL2A 4JI4Q 1MIUA 1V1QA 1X3GA 3DM3A 3W5OA 2K5HA 1X3EA 4YWKA 5C4JH 2HQLA 2OQ0A 4GN5A 1A63A 1X9NA 3M4PA 5EAYA 4X62L 4A3LH 2JEBI 3E0EA 1GKHA 3Q8DA 2VW9A 4HIDA 2UUBL 2CCZA 4NPSA 3BJUA 4PG3A 2UXBL 4LFBL 2VZAA 3I7FA 1N34L 1VQ7A 1KXLA 1P8LA 2E8GA 1Y1VH 4YCWA 1HR0L 4DR7Q 1G291 4DR5L 1C9OA 4QGUA 4KHPL 4NXMQ 4DK3C 4A3MG 3RZOH 1B7YB 4A3IH 2CWAA 5C0XI 2RF4A 1M90C 1JB7A 1SE8A 3I4MG 1IL2A 3HOZH 3M4OH 1PH5A 3K81C 1EQQA 1WI5A 2K5VA 4LW1A 4DUZL 4IPGA 2UU9L 2JE6I 1VS0A 3NENA 5JEAJ 4GNXB 2GVAA 2KCMA 2ZTEA 3M9BA 4DV7L 4JI5L 1VQIA 3TS2A 3KDFA 2DGYA 3PUZA 5IYBG 2R93H 3HFZB 4R4CA 4TQUS 3KOJA 4AH6A 4X65L 3ICEA 1X55A 5GAEC 2UUCL 4BBRG 2E2HH 4X64L 4BY7H 2KHIA 5M3MG 1NMFA 5IYCH 4JBKA 4L5RC 2NZHA 4A3CG 5GQOA 5FLMH 3S1RH 1OXVA 2OTLA 5LMNW 3CCLA 1Q1BA 1UE5A 3D31A 5IYDH 5IT9c 4DR4L 2ID0A 5C44G 4OX9Q 3IRBA 1XPUA 4YY3L 1PYSB 4JI3L 4A3KG 4GKJL 4QQBX 4IJHA 5C0XG 3CCUA 1Q82C 3CCMA 1SRUA 1Y1WH 4UY8C 3K7AH 3KLWA 4JI0L 2ATWA 1BKBA 4R4OA 4DUYQ 1I5FA 3TS0A 4LF9L 2HIVA 1VQCA 4GKKL 1A8VA 4C3IH 1YVCA 3NEMA 3CMAA 3CPWA 1I94L 1I6HH 1XMOL 1X3FA 1VQ9A 2WAQE 1YNXA 1KL9A 1LTLA 3AYHB 5IP7G 4A3JG 4A76A 1Y1VG 2F3IA 4DNIA 1N9WA 5H1SE 1N32L 4JI8Q 1KIXA 3B6YA 1CKOA 4PZ8A 4GNXA 1EWIA 4A3BH 3FHWA 2MQHA 1L1OB 4IO9A 2IHFA 4Y52H 2K50A 4RG1A 1XTDA 4LF6Q 4DV1Q 1ASZA 4L5QA 3HOVH 3K8AA 2Z0SA 3M4QA 1I3QH 4GLVB 2Q2HA 1LUZA 5HY6A 3TREA 1YHQA 4JI6L 2NN6I 1SR3A 2JA9A 3F2DA 2BH8A 1JJCB 3GTGH 3EBEA 2AHOB 2KHJA 3AFPA 1FJGQ 2R93G 1YHAA 3VDYA 1KD1C 1WYDA 4LF8Q 2R6GA 4DR6Q 4LF7Q 3ZJYC 4AQYL 1NJIC 1VQOA 3T1HQ 5IWAQ 5GROA 1PFSA 4C3JH 4HJ5A 4K0KL 4FDBA 1ASYA 3S1MH 4BY1G 4BBSH 3UE1A 1T9HA 3KJOA 1XNQQ 1NE3A 2OQKA 3KJPA 1W2BA 1A62A 2YTYA 3PUVA 3U4ZA 3PIPA 1PA6A 4R4TA 3GTMH 2I5LX 3OYYA 1AH9A 2QA4A 2A19A 1VQPA 3L2PA 4LFAL 1HNWL 2JA7G 1PH9A 1TXYA 4DR2L 1PHJA 2F4VL 2Z6KA 3PO3H 4JI2Q 4DV0L 2ZJQA 5JEAG 5LMUQ 2FXQA 2D0OA 1N36L 1K8AC 1CSPA 2R7DA 1P16A 3FP9A 4NXNL 4YHHL 4HIKA 1Q7YC 1VQFA 3AQQA 1N33Q 2KBNA 2PQAB 5GADC 1U5KA 1L1OA 3HOXG 4DV3L 1I50H 1PH4A 4OXPA 2HHHQ 1FVIA 3ER0A 4A4IA 4GNXC 4LF5L 1VQBA 1VQEA 3BZCA 2IX0A 3LGJA 4DK6C 3G4SA 2E2JH 4B3RL 4X6AH 2BA0A 1IBLL 3MEFA 4GN4B 4DV4Q 1PH2A 1IBKL 2E5LL 2YTVA 5M3FG 4B3MQ 5IP9H 1UE1A 5IY0A 1V43A 3BZKA 1SFOH 4EQ5A 2AKWB 5ELNA 4X66Q 1K73C 3GD7A 2VUMG 4JOIA 4QL5A 1L0WA 2WAQG 5BR8Q 3K80C 5FJ8H 2ES2A 4PMWA 1XNRQ 2YV5A 3PO2H 3PF5A 4BA2I 1VQJA 3HOVG 1Q8KA 1VQNA 3SGIA 3FKIG 3H0GH 1IBMQ 4LF4Q 3UDFA 3I4NH 1VQMA 4ALPA 2OTJA 2ZTCA 3CCRA 4HIOA 2VQFQ 1QUQB 3U58A 1J5EQ 4JI4L 4A3FG 1X54A 2I0QA 2R7ZG 2R92H 5JJKA 5FLXc 4POGA 5JJIA 1YIJA 3S14H 4DV5Q 1E24A 1E3PA 2JJQA 2JK8A 3J81j 1XNRL 3S17H 3A0JA 4IOCA 1VQAA 5ELOA 3CC4A 1C0AA 1UE7A 1YITA 2ASBA 2B29A 3JAMc 2A1AA 2CFMA 2KENA 3T1YQ 2Z6KC 1Q86C 2UUAQ 4L5SA 1Q46A 5E7NA 4JV5Q 1FGUA 2ALYB 2AWOA 3HOUG 2PQAA 4GN3B 3DLLA 2D62A 4H02A 4IPCA 4DR7L 3OTOQ 1MKHA 1VQGA 2CKZB 1PH3A 4NXML 3PO3G 4O0AA 1L1OC 1JJGA 1JT8A 5DLQE 4B3SQ
chains in the Genus database with same CATH superfamily
1TS3A 4P2CB 4NDXA 3CXCA 1IYUA 3GV6A 3PF4A 4DA2A 5IT9L 1HNXQ 1WOCA 1KQSA 2NVYH 5L37A 2B2UC 4DR1Q 4OWXB 4JOIC 1VMPA 4DKAC 2K1BA 4JI7Q 4JI1Q 5IP9G 5C3EH 2VQEQ 3SHLA 1VQKA 1HZAA 4A3BB 2EJMA 3LWUA 1ET9A 5A2QE 3R3OA 4IQZA 3K5NA 3RN2A 3EFXD 4RGOS 3AU7A 3H94A 4DFAA 3HKSA 4LFCQ 1G2TA 4KKUA 4OHJA 2ZM6Q 4KLKA 4OX9L 1ENAA 2B3GA 3GTGB 3I55A 1TKWB 2K6AA 3W1BA 4YCVA 2M2LA 1H9JA 5COYA 4A3IG 1V1OA 4DUYL 1QVCA 4UAIA 4CGYB 3WWVA 3RMHA 4HIMA 4A3DH 1U0LA 3K0XA 2D9UA 3SR1A 3OMCA 1O7YA 2OWOA 3EN2A 5C3WA 2L12A 1ILQA 2EOTA 1CKNB 4JI8L 3GTJH 1TS4A 1RF2D 4DV1L 2RQXA 1JOOA 1ZKOA 1ENCA 1ET6A 2F52A 1I50B 2JA5H 1QZGA 3PMFA 2E2JB 1STYA 5C4XH 4KY7A 2Q8TA 3CCSA 1XPRA 4LF8L 4LK1C 2YU9H 4RFBA 3T1HL 3H3VI 2K5QA 3JAMi 3OW7A 4OGQC 2MNAA 3D6WA 1GUNA 1VQDA 3HKZB 3H0GB 3MXNB 4A3EH 3RR5A 5E4WC 4ZKBB 3CCEA 2NTTA 1PZKD 3QOJA 4JI2L 2XSCA 5LMUL 1R9TH 1HQRD 4A3BG 1JWUD 1FNWA 2C9OA 4ME5A 4P71A 1N33L 3S17B 4LUVA 2HHHL 2UUBQ 3RLFA 2JQOA 1JMCA 4A3DG 5C44H 2EXDA 2Y0SE 2UXCL 2K52A 4IURA 4DAMA 5FLXL 4G4KA 1N34Q 2KCTA 2I5MX 4RGNA 4WJ4A 4DR5Q 1SROA 3EJIA 2B2YC 2EY5A 4KHPQ 3S1QH 5EQ0A 3ULJA 2DNEA 1PTOC 3BVGA 1KRSA 2IHEA 4FP5D 2PI2E 4H44C 4OWTB 4DUZQ 5KYLA 2JA5G 5EKIA 2E2IB 1J5EL 1B44D 1WFQA 1TWCB 3Q22A 3W3AA 4A3JH 5C4XG 4TKOB 2V1CC 2UUCQ 2QDBA 2RVLA 2N78A 4IZ8A 3PGZA 5GAGC 1EYAA 3TP8A 3GTOB 1Q8IA 2WB1G 4S3SA 5IOCA 3BVMA 4DR4Q 4A3EG 4K8JA 2G5DA 1K83B 4YY3Q 4R4QA 1EY6A 2MHVA 2AWNA 1JJ2A 1BCPD 1HCZA 1IKLA 2B2VA 1B70B 5FJ8G 1EZ8A 2VL6A 1PTOB 1D8LA 3URYA 2EZVA 3J7AF 3S2HB 3CCQA 4LF9Q 1E1TA 3CQZH 5BN3A 4BY1H 3G48A 3A54A 3FMCA 3PUYA 1I94Q 5M5YH 3H09A 3CD6A 3D0FA 4A93H 3M7NA 4JYAL 1BCPC 2VNUD 3W1GA 1JWSD 3V05A 1LT4D 2J0TD 2KQ3A 1VCIA 2DN8A 4QY7A 1TWGH 4C3JB 1WTOA 4WJWA 2K14A 1HA6A 1OXXK 1FNUA 1W6JA 1YJNA 3GTMB 4JBJA 4DV6L 2F0FA 4HCEA 3GDEA 1S5ED 4PZ6A 1HR0W 1EWHA 1QG7A 4CKCA 1B4OA 3E9HA 2OCEA 2CWPA 4KJOA 5FKAC 1RODA 4I7AA 2ZT9C 2O2LD 2EYMA 3RZDH 2Q2TA 5JAVA 5I6WA 3F2UA 4ME3A 4O42A 2L11A 2F0VA 1O7LA 3CMEA 4JK1C 4LFAQ 2F0OA 1M4VA 2I46A 4ILWA 3ERSX 3Q24A 3UDXA 4GZYC 1LTSD 1E1OA 4DR2Q 1J6QA 4A75A 1KLUD 4DV0Q 4DAYB 3K58A 4LNQA 4ZUIA 4C3HH 5M3MB 4R1JA 5ELEA 4MTNA 4IJLA 1PH7A 5HURA 4DV2L 4AIMA 1TU2B 4A93G 1KLGD 2AUKA 4B3RQ 1U4LA 5G3LD 3ULPA 2AMCB 1EU3A 3HOUH 1F2YA 2E5LQ 4GOPC 3E9IA 4BBRH 1WCMB 2JA6B 4A3KB 5EBCA 1HFGA 2F0EA 2CQOA 3GP7A 1S40A 3KDFB 2Q8RE 2JP1A 1M8AA 4RHSA 5LMNL 2WIIB 1JICA 3IFDA 1AE3A 2QGQA 4DAPA 1LYLA 1SYEA 5C3XA 5IGEA 1SDFA 1V1QA 3HGBA 2HCIA 2HQLA 2K5WA 1LV9A 1WTXA 3Q23A 4B9XA 2K01A 2JEBI 2VW9A 1CQVA 5M9OA 3BJUA 1EY4A 4LFBL 1VQ7A 1KXLA 2E8GA 1Y1VH 2FHTA 2PNRC 5KNCA 1T5XD 1HR0L 4DR7Q 1G291 1C9OA 1FD7D 2AQ2B 3I91A 3GTPB 3BVZA 4QGUA 4DK3C 3K5LA 2CWAA 3FPUB 3HOZH 3K81C 1EQQA 1WI5A 3V2TA 3D4DA 3HOYB 2F4IA 2GVAA 4DV7L 3OHXC 3PUZA 2B8GA 4IUQA 2PW5A 4AH6A 5CBEE 1J9OA 4EVOA 1X55A 3VYRA 4ZK9B 3NTKA 4BBRG 2E2HH 5M3MG 2NZHA 1DJRD 5FLMH 2OTLA 3J7AV 1DONA 2NZ1D 3NQIA 4KJNA 3GTKB 2ID0A 3HOXB 2R61A 4DN4M 1XXGA 3IRBA 1XPUA 4ZYSA 4A3KG 4CKEA 1FNVA 4IJHA 5M3FB 1Q82C 1AW7A 1PFNA 1NCVA 4UY8C 1LTBD 2VUMB 5FOBB 3TP7A 2ATWA 2WAQB 1GOZA 4NP5A 1YVCA 3CPWA 1XMOL 1X3FA 1S5BD 3RD4A 1KL9A 3AYHB 1A6XA 1GJXA 5IP7G 4A76A 1Y1VG 5C5LA 1N9WA 1KIXA 3FHWA 3E5SA 3R93A 4K5XA 4F7XA 4Y7NB 3CRKC 4LF6Q 2EYHA 1EZ6A 4DU9A 4X3SA 1NR2A 1R4PB 1RTNA 5CGKA 1KABA 4GLVB 4EQOA 2EYLA 1SR3A 2NN6I 5CV4A 1JJCB 1U4RA 3DUZA 3S2DB 1YHAA 4KN4C 5I2YA 1E2WA 4LF7Q 2F0GA 3FPPA 1QE6A 1D5ZC 2KHSA 3I72A 2RBMA 1ASYA 2F0HA 3S1MH 2PZWA 1TR5A 2RDHA 2ZXRA 1PMRA 3GTLB 3KJPA 3PUVA 3SK4A 3A7LA 2XWBB 1HNWL 2B2TA 2F4VL 2O5JC 1VMCA 2Z6KA 2KCCA 5EKKA 2ZJQA 2FXQA 4PMBA 1LT3D 3SE0A 1K8AC 1Q7YC 2OT2A 2VB2X 5K36H 3HOXG 1PH4A 1WD0A 4DK6C 3TP5A 5E4XA 4DV4Q 2JXMB 1MSGA 5M3FG 2C5CA 2B2UA 1LACA 1I4XA 2VUMG 3GD7A 3FVQA 4JOIA 4QL5A 2WAQG 1IW7D 4PMWA 3PO2H 4DXGA 1VQJA 1HTPA 2M9VA 1IBMQ 1PZID 4ALPA 4HIOA 1JWMD 2VQFQ 1QUQB 1D2BA 2FJ2A 5D3DA 2R93B 1X54A 3H91A 1IW7C 1NR4A 1EY7A 3R2TA 1ZXTA 4DV5Q 2L5TA 1DOMA 3D4RA 3J81j 1Z6HA 4IOCA 1UE7A 3G7LA 3Q0AA 4X3KA 3JAMc 2UUAQ 1Q86C 1ILPA 1ENFA 1Q46A 5CYUA 5E7NA 4JV5Q 2ALYB 1PRTB 2D62A 4ZLTF 5DNFA 2CKZB 5LHY1 2Z1CA 2F0UA 1L1OC 2RDGA 2XIWA 1Y1WB 3K7AB 1I4HA 4RHRA 4C3IB 1CA5A 4UPAA 4EQPA 4BXXH 2L55A 3MEHA 1IKMA 2D2CC 3DM1A 1G6ZA 1B9MA 3BG3A 2EIFA 3MXGA 4YWMA 1KDBA 2BOSA 4I7ZC 5EPJA 4N8FA 4JBMA 4HN7A 3MVVA 1UUPA 1K0RA 4DR3Q 3A55A 3HZXA 2TMPA 3S9WA 1K8OA 3TBIB 2LKVA 3HOWH 4HSPA 5AJ3Q 1MJEA 4GS3A 1TWFH 4MHEA 3F8TA 2L0CA 4DXFA 3J80E 2NVTH 1XX8A 5F2DA 5CORA 1MGSA 3BDOA 2MO1A 1E0BA 1ZYRD 1OTCA 1BXTA 4BBSB 4F8MA 3I56A 4U673 4NMZA 1B1ZA 4DGZA 1ONLA 1K8GA 3SVMA 4KV6A 4NKLA 5HGQA 3J81c 3H3VH 4XQNA 3A8KE 4BY7G 1Z47A 4C2MB 3S1NH 3PO3B 1ZYRC 5J39A 5GAHC 4RKBA 3QB3A 1STEA 3KLRA 4PZ7A 4EQNA 1PZJD 2B2YA 3VA7A 4DK1A 2QILA 2P5ZX 2K04A 4KK7A 1B8AA 3C3LA 4KTAA 4RCNA 1FJGL 2IPKD 2N3SA 1DXMA 2YYZA 2HIXA 2K75A 3CKIB 2WFWA 1PH6A 3I90A 5IWAL 2CVRA 1SFOB 1Y1WG 1SMYD 4K5VA 1GM5A 4R4IA 4B3TQ 4C3IG 1STHA 1XNQL 4TVAB 3PCOB 2QF7A 3ND9A 2QDLA 4KN7C 3F2CA 4FF4A 5IGFA 1PLFA 1NBWA 3F1ZA 4B9WA 2SOBA 4LUZA 1SMYC 3G6JB 3ZYYX 2Z4IA 1HHVA 3NUCA 1EU4A 1RCVD 1SYGA 1GUTA 1S3OA 4ZRZA 1QWYA 3TMEA 4UHVA 2N88A 3N6RA 3UDIA 2MJ8A 2PMZE 2Z8LA 1VQHA 4APVA 2JA8H 1VQ4A 2D0PA 3KF6A 1STGA 1YBYA 1I4RA 3JAML 4OONA 4BBSG 3RNUA 4K8IA 2RHSB 4IFDJ 4LF4L 1B50A 2F0DA 2UU9Q 2EJFC 3SK6A 1GUGA 2OEOA 4HMJA 1XYIA 1V9PA 3CCJA 1CHQD 4JI5Q 3A74A 5E1FA 4JG2A 5C3EB 4X64Q 1AP0A 1SEBD 5IGCA 3RLNA 4KI0A 3J80i 3IL8A 4WORA 1YJWA 1YHBA 5IGGA 4HJAA 5LL6X 2NZOA 3T1YL 2BH2A 1IXRA 4BA1I 2Q2UA 3OTOL 5BN5A 2L15A 4RAUC 4JI3Q 1CM9A 1Y14B 4B3SL 1A0IA 5ISRA 1LLRD 4L6TB 1X56A 1IYVA 2Z6BA 1Q81C 3STBD 1HNZL 1SNMA 2PO4A 4HJ7A 4J15A 3PV0A 2LXJA 1D1KA 5J3BA 4A3DB 3M85A 4B08A 2JA7H 3EA6A 1HZBA 4ABNA 2C35B 1N32Q 1OXTA 2JA8G 3MC0B 2KEEA 3STBC 1IYJB 3GTJB 4IFDI 3KF8A 3NTHA 2A5HA 5M5XH 2SNSA 3KYHC 3UI2A 4GOPA 1EIYB 1PXUA 1Q90A 1JC7A 1PYBA 4RA8A 1TY2A 4JI6Q 1BCPF 2JA5B 3J81L 1GHKA 2GN5A 1DYQA 3I3CA 4LUOA 4CJ2C 5C4XB 1WTQA 4BWGB 2YU9B 1TWAH 4AQYQ 1UAPA 4RH6A 1VQ8A 3KK7A 2MP1A 3G71A 2NVQH 3U9OA 1Y8PB 2EVBA 2WB1B 3FKIH 1GXDC 3I73A 4A3EB 1SYBA 1WTHA 4A3FH 2R7ZH 3OSOA 4KKTA 5C3EG 2UXDL 1JE5A 2R7FA 4MZ9A 1R9TB 1FR3A 4RCOA 2HCCA 4IUNA 5J1ZA 4YHHQ 4NXNQ 2F0TA 4QF4A 3S15H 5C4ZA 2EYFA 4DV3Q 1KAWA 1N8RC 1NNXA 4JCVE 1YJ9A 5C44B 1RHPA 1XMQL 3E0JA 3G6EA 1PFMA 1IBKQ 1HUNA 3OPOA 4CKBA 4FF2A 1W3SA 2AQ3B 4QIWE 3T56B 4A3CH 5IE8A 3S1QB 3TDQA 1NMGA 1JQYD 1PTOD 3QO2A 3I4OA 3U50C 4KKSA 4X3UA 4H7BA 1RL2A 5FO7B 3C1FA 4A3JB 3W5OA 1H9KA 2K32A 2K5HA 1X3EA 2WKDA 2A6ED 3QJYA 4YWKA 5C4JH 4GN5A 4X62L 4A3LH 4ID6A 1GKHA 2X6GA 5G3LF 4HIDA 2DJGC 2UXBL 3NBHA 1EQTA 1EWCA 4E6IA 2A6EC 2MPMA 1SSOA 1OO9B 2F0MA 3RZOH 1B7YB 2RF4A 3M4OH 1PH5A 4LW1A 2XRSD 3CQZB 4BY1B 4HAEA 1VS0A 5JEAJ 5M5YB 4GNXB 4A93B 2RKSA 3M9BA 2SEBD 3TS2A 1LT5D 1HFNA 3KOJA 2K03A 4X65L 2SDFA 1NMFA 5IYCH 4A3CG 5GQOA 2KCNA 3S1RH 1EYDA 5LMNW 1TWGB 1BBXC 1UE5A 3L9AX 2A74C 5IYDH 1BDOA 5C44G 2VXWA 4ZKCB 3SXHA 4OX9Q 5JPMC 4GKJL 4Z9CB 5ELBA 3TSSA 1GUSA 1WVLA 3ONAB 4RKLA 5EGTA 4JI0L 1BKBA 4DUYQ 4GKKL 1I5FA 3RZDB 1RJTA 2NN6H 2PYKA 3CMAA 4ZAIA 1IHZA 3GV3A 1I6HH 4MN3A 1LTLA 3DMUA 4A3JG 4X3TA 4DNIA 4JI8Q 4PZ8A 1NUCA 2IHFA 2F0PA 2J4XA 1KNAA 1BO0A 2DNCA 4DV1Q 1G8ZD 4C3HB 3HOVH 3K8AA 4C56C 1S5FD 3K5MA 5HY6A 2Q2HA 1LUZA 1H9SB 4G7ZC 2AHOB 2EE1A 4CJ1B 5J22A 1EIHA 2Z9HA 3NK9A 3HOUB 1KD1C 1WYDA 4LF8Q 3I8ZA 4BBRB 4FNFA 3T1HQ 4LMQD 5KEEA 4C3JH 4K0KL 3VYUA 4FDBA 4BY1G 3KJOA 1TQOA 1NE3A 1A63A 2YTYA 3GTMH 1TS5A 3VYTA 1AH9A 2A19A 1VQPA 4K2KA 1FYCA 3VR4A 3TP6A 4JI2Q 5D3IB 5LMUQ 3NWTA 1BQQT 2PW7A 2CH4W 2D0OA 1N36L 1STAA 2DY7A 5T1IA 1ESRA 2E75C 1N33Q 1II3A 4IUTA 1H9RA 3K59A 1L1OA 2HHHQ 3P1HA 4OXPA 1FVIA 3A56A 4A4IA 4CDDC 1WTWA 4LF5L 3BZCA 1IBLL 1Y1VB 1UE1A 1V43A 3BZKA 1J8IA 1K0SA 2ES2A 5DEHA 3K80C 2EXZA 1XNRQ 3NWSA 2YV5A 2K7VA 1U9RA 4BA2I 3HOVG 1TWHB 1VQNA 3HOZB 3D4WA 2PMZB 3UDFA 3I4NH 2OTJA 1BUVT 3CCRA 3K6OA 3H6MA 1J5EQ 4JI4L 4OO1H 1RTOA 2R92H 2B39A 5JJKA 4MTKA 4POGA 1TY0A 5JJIA 2E2HB 1YIJA 1D1IA 3S14H 4C3HG 1UEAB 2JJQA 1MI2A 2LY7A 3A0JA 3DEPA 3CC4A 1ICFB 2A1AA 4L5SA 5NUCA 2NB0A 4FF1A 3HOUG 2PQAA 4IPCA 1MKHA 1VQGA 5IIFA 4NXML 5JOBA 4UDUC 3NBIA 1JJGA 5DLQE 1C48A 2K5NA 3WOFA 2TSSA 1I6VC 3I70A 1Z9FA 4QUFA 4RGMA 2EPBA 5EPLA 4DNTB 4JYAQ 4G7HC 3GTPH 4LAAA 4RGTA 2BA1A 1WTVA 2B63H 3NTIA 1QVFA 2GVBA 4TRDA 4DV6Q 3I4NG 3OWFA 3K57A 1EOVA 2FFKB 2LXKA 1VQ6A 4P74A 1V1PA 2R92G 1CTMA 1UNSA 2A68D 4JC0A 3H15A 2LSSA 3HOZG 3KLSX 3FDTA 2K05A 3LX0A 3GTQH 3J7A5 3S1MB 3L7ZC 4FXGC 2H1EA 2ZXPA 4M1UB 1U4PA 1QOHA 3OOCA 5M5WH 2FMCA 2A68C 2IX1A 1WJJA 1HH2P 3S16H 4CDCC 3MTSA 4XYOA 5FLMG 1SMXA 1RKNA 1JB3A 3CC2A 3U9SA 1PH1A 4DV2Q 2EYOA 3QIAA 1K3RA 1CUKA 2CH4A 4DR6L 1KHIA 2F0QA 2L1BA 1PRTD 2B8FA 3PQIA 1WTRA 1KC8C 2NVXH 1AZQA 1KTKA 3NPPA 2B63G 3PO2B 1QILA 2H5XA 5EPKA 3O13A 5LMNQ 3TZUA 2F3VA 2O5IC 5EKLA 5IYBH 4GLAC 1EY0A 1PRTC 2JYOA 4K14A 4EGVA 5KNDA 3UDGA 1STBA 4OWWB 3HKZE 2FINB 3MWYW 1E22A 4P75A 3W2DA 4KHZA 2Y0SB 2ZTDA 5E3FA 1FL0A 1CKNA 3U4VA 4K2LA 5I4DA 2A69C 2K5DA 3SDZA 1Q3LA 4UP8A 5IGBA 4WFN3 1W6KA 3TRZA 4LFBQ 3JC66 4B3ML 4HEDA 1E2VA 3AEVA 1HR0Q 5EJWA 1K3BC 4X66L 4BY7B 5BR8L 1GO3E 3CAMA 1DD2A 2IY5B 4NW2A 3K0YA 1HRJA 3ULLA 3BDCA 3BU2A 5CMDA 4HCSA 1QCBD 4N8X1 1SLJA 4DV7Q 2CW0D 4O2DA 1YEZA 2PCFB 3KUPA 3VR6A 1LTAD 4OO1I 3M7GA 3MXNA 3SEBA 1MSHA 3H3VC 1EIFA 2WACA 1VQLA 1UEBA 2SNMA 5K36G 2CW0C 3AB9A 3HOWB 1B9NA 1O7IA 1S72A 5IGDA 1TWFB 4XQJA 4IFDH 2NVTB 4YWLA 1HNXL 1EUJA 3PO2G 4HMIA 3NELA 3TN2A 3VA5A 1I3QB 3J7ZC 1E7ZA 4DR1L 1XMOQ 3DWPA 1EOTA 2ENBA 1EFWA 5FK9C 3T13A 4JI7L 3T51B 4JI1L 2QEXA 1VF5C 2VQEL 1HTLD 4HJ8A 2KVMA 3F2BA 3BDLA 4KHVA 1CHPD 1D6EC 4ODGA 2Y0SG 4PV1C 4EX5A 3S1NB 2QKIC 4UP7A 2GA4B 1F77A 2VS1A 4MNOA 4AYBE 4LFCL 4IOAA 1BBWA 2ZM6L 1DM0B 4FO2A 5I9OA 1VQ5A 4A3GH 4Q5VA 1CA6A 2IT1A 5DAUA 3A8JE 1A3TA 2F0LA 1OXSC 5DM73 1PV4A 4G7OC 5I2XA 2NYZD 3LNNA 1CFMA 3AMUA 5ELCA 1BBUA 1X6OA 3MZ5A 4P72A 2F1MA 2ICIA 4L5TA 4DPGA 2HD3A 2R3ZA 2F0SA 4BXXG 3TQYA 2DY8A 5CBAE 4NB3A 1S5CD 4K5WA 1HNWQ 2X69A 1LTTD 1M1KC 4IFDG 2F4VQ 5I6YA 4A3MH 1A2UA 2EY2A 3E3XA 5K5PA 3I4MH 4U68A 2HDLA 1AZPA 1UWVA 2ZJRA 4IUVA 3NHHA 4DF7A 2EJGC 2KECA 3L0OA 3HOWG 1LT6D 5C0XJ 2G9HD 1YNND 3IKJA 2JN4A 4JBWA 1L2FA 4C2MH 2JA8B 1EQRA 3M3YH 1SBBB 3P7JA 3CU7A 1R4QB 3K7UC 4N9PA 5CR3A 1YNNC 3P75A 1SE3A 3BYTB 2Q8IB 1CI3M 4A3GG 1F2ZA 1MIUA 2WV6D 2ZXOA 1X3GA 1A3UA 3DM3A 5ELDA 1F9QA 1TIID 3X3MA 1X9NA 3BYYB 3M4PA 4RWSC 5EAYA 1EFID 2UUBL 4C1NI 4CHTB 2NVYB 4DAYA 4PG3A 2KJXA 3C1EA 4KMUC 3I7FA 1N34L 4YCWA 2IW3A 2PPBC 4DR5L 5CV6A 3IFTA 4KHPL 1PTOF 2XWJB 4CBVA 4A3MG 3KLSA 3T53B 5DM63 5D65A 4A3IH 1SE2A 5C0XI 1SE8A 3I4MG 3FEWX 2NBFA 5KIXA 1JOQA 2K5VA 3KBXA 4DUZL 2JE6I 1QJOA 4JVZA 2KCMA 2ZTEA 4DK0A 1SNQA 1VQIA 3R2IA 3KDFA 3K5OA 3ERQA 4TQUS 3DWAA 1SNDA 5FO8B 5IT9E 3ICEA 5GAEC 2UUCL 4ZQ3A 2KHIA 3HRZC 1YNJD 2M00A 4ZUJA 4JBKA 4ULLA 1Q1BA 2I07B 5M5XB 2LMCB 2B2WC 4DR4L 1H9MA 1KNEA 5A2QL 1B3QA 2LFNA 1F9RA 1YNJC 4YY3L 1PYSB 1LTGD 4QQBX 5JEAH 3CCUA 3CRLC 2NWGA 3CCMA 3HS0C 1SRUA 3SK5A 3N52A 1TWAB 4R4OA 4LF9L 4J1MA 1VQCA 1A8VA 2RDFA 3NE5B 1I94L 2NVQB 5EBDA 1KDCA 2WKCA 1SYCA 3FKIB 1PYWD 1VQ9A 2WAQE 2HDMA 2V4DA 4IUUA 2F3IA 4A3FB 5H1SE 2R7ZB 3B6YA 3OIQA 1EWIA 3PIO3 4A3BH 2MQHA 1GUWA 4IO9A 2K50A 1MD2D 5D14A 1GUOA 2PQEA 4L5QA 2XN9C 1JCKB 2IWHA 3BZDB 1EL0A 3J81E 3T4AC 2Z0SA 3S15B 1YHQA 2H4OA 3GTGH 1I4GA 1FJGQ 4CDEC 1LTRD 2E2DC 2JSOA 3MXUA 1NJIC 2PZTA 4QMGA 1NSNS 5IWAQ 1PFSA 4JPBW 3QOLA 1DOKA 1QNUA 3D8GA 1CT1D 1T9HA 1XNQQ 1W2BA 3U4ZA 3VR3A 3HP3A 3HEJA 4R4TA 1C4QA 2QA4A 2MUYA 2Z4HA 5CV5A 4XYQA 3L2PA 4LFAL 3L3OC 1Y69U 2JA7G 1PH9A 1TXYA 3V96A 4DR2L 3OMGA 4DV0L 4KY6A 5JEAG 5C4JB 2R7DA 1P16A 2KA7A 2E76C 2L4NA 4HIKA 5GADC 5KYIA 1U5KA 1EIGA 1EY8A 1I50H 5CC4A 4GNXC 2IX0A 3LGJA 2E2JH 4B3RL 4FYDA 4X6AH 4ZCKA 5LL6S 3NP8A 2E5LL 4H13C 4HSVA 2RSNA 4EQ5A 2AKWB 1L0WA 1IL8A 5FJ8H 3RZOB 2O4XA 5FLXE 2NUCA 1Q8KA 2EYPA 5JVG3 2F03A 3M4OB 2XNAC 3FKIG 3H0GH 4LF4Q 2ZTCA 3QR8A 1K28A 3U58A 5KGUA 4A3FG 5IODA 2I0QA 2R7ZG 1F9SA 1LABA 4MIUA 1SJHD 2AQ1B 1D5XC 4IUPA 1E24A 2JK8A 1XNRL 3OWEB 3S17H 2KEDA 3S1RB 5ELOA 2HUGA 1YITA 2B29A 2KENA 5FO9B 3T1YQ 3DHQA 1E2ZA 1WD1A 3DLLA 4DR7L 4JW0A 3OTOQ 1F2LA 4B3SQ 1HQMC 3MHBA 3NQTA 1HNZQ 1HXYD 4OIJA 1BOSA 4F87A 1X65A 2PNHA 1I6HB 2E2IH 4P73A 2F0KA 1TWCH 5C5MA 3TEHB 3J81i 3CC7A 2MFIA 1BVSA 2DUDA 3EROA 1Q12A 3IAYA 1QUQA 1TT2A 2N55A 3GTOH 3A5UA 4Q0FA 1NAPA 3I2ZA 4A3LG 3S24A 3EVQA 2HT1A 2PI2A 2QW7A 3HOVB 3MFYA 3HKZG 3H0GG 2RA4A 1NY4A 1K83H 1SNCA 1QZHA 2EY6A 1D7QA 2IJ0A 3WOEA 1AFPA 4AYBB 1PTOH 2I5HA 1C7YA 3S2HH 1RIPA 4H0LC 2A73B 1JORA 1BF4A 2RHQB 4IPHA 4BS9A 3UE0A 1G2SA 1ESFA 2F0JA 1YI2A 1ICWA 4QJFA 1XPOA 2K4KA 4CJ0B 2UXDQ 4FF3A 5IYCG 4LF6L 1EY5A 3PIOA 5IYDG 1AE2A 2OXPA 5KRUA 1BCPB 3KF6B 3VYSA 2N49A 3M4YA 1XMQQ 4LF7L 1B3AA 3C46A 1CZWA 3RN5A 4IALA 3CCVA 2NN6G 3PUXA 1SAPA 4N9TA 1QVGA 1JE4A 1PH8A 2WINB 1UE6A 3I4NB 2UXCQ 1Y8NB 1JR0D 3KFUA 2R92B 4V0BA 1A15A 2ZJPA 2D5DA 3CW2C 1V8QA 5M3MH 2A8VA 3S14B 4OELB 4X62Q 3DWQA 1RDPD 4PNYA 3T16A 2XGTA 4G57A 2UXBQ 2CQAA 1PRTF 3J7YW 1GD7A 2XVSA 4DV4L 1LM0A 1A3VA 2E74C 2JA6H 1WCMH 4A3KH 1G51A 4AYBG 4LWCA 1O7ZA 2EDGA 1SYFA 4C3JG 3MXPA 1G91A 3TZDA 3PUWA 3CP0A 1CSQA 4HJ9A 1YZ6A 4OL7A 4RMFA 4R8NA 1Z7TA 1Q1EA 1IBML 2A6HD 1AEXA 1AN8A 4OIKA 2VQFL 1IZ6A 2X6LA 3DXJC 3KF8B 5IP7H 4GOPB 3OW2A 4X65Q 4IN3A 4DV5L 5C6AA 2BDNA 3EIVA 1HJPA 4L63B 2MO0A 1DZ1A 2A6HC 4QUCA 1TWHH 2RSOA 2B63B 4DNRB 4IPDA 1K9MC 2UUAL 4POFA 1PDQA 1L0XB 1EEID 4JV5L 1HZCA 1DCZA 3MAQA 1SE4A 3R8BA 3GO5A 4XIGS 4GKJQ 4GLXA 2J7ZA 2EQSA 2EY1A 4JI0Q 4GKKQ 1SNPA 3HOYH 5AFWA 1EEFD 1F2MA 1MHWC 4HTHA 1X3QA 3GTQB 1G6PA 1VF7A 4XT3B 4OO1G 3MFGA 1SN8A 4UP9A 1XJVA 2Q2IA 2G9DA 2JA6G 1WCMG 5M5WB 1DGSA 5C4HA 1NTGA 1MJCA 2ICEC 2OF1A 1CKMA 1EY9A 4O1NA 4DR3L 1B53A 1EYGA 3S16B 1XWEA 2K33A 3GTKH 5I9PA 3J80c 2LS01 3A5ZB 3HOXH 1H95A 5AJ3L 4F88A 1KRTA 3AFQA 5JJLA 1STNA 1TS2A 3ND8A 3PSIA 5M3FH 5JPNC 1LTID 2CHBD 2N8NA 2XTIA 2VUMH 3CF5A 3PIP3 3CPFA 4LJZC 4XTCS 4K0KQ 2NVXB 1B2TA 3MA2B 2B2VC 4WJ3M 1HZ9A 5T1GA 3CHBD 4FXDA 2WB1E 4YCUA 3D3RA 4XDXA 4Y7NH 1XTCD 2F0WA 3NBHB 4K6DA 1N36Q 2AUJD 1OXUA 1RD9D 2JEAI 3HOYG 1GVPA 4M8AA 2BE5D 3LWEA 3RLOA 1EYCA 4QIWB 1D5MC 1PVOA 2A69D 4LF5Q 3S2DH 1GHJA 1IBLQ 2RCNA 4KD3A 3SK8A 3WDNA 1O78A 2YTXA 1SXTA 2BE5C 3E6ZX 4B3TL 3GTLH 1FGBD 2WP8J 1QNKA 1U4MA 2VY3A 4J6HA 4JI4Q 2B2WA 5C0XH 5JJZA 2OQ0A 5CV9A 2XRQD 1ZEQX 3HG9A 2KUMA 1CQFA 3E0EA 3Q8DA 4NPSA 2KOLA 2QEJC 2VZAA 3P20A 3VR2A 1P8LA 3GQBA 2F0IA 5BN4A 1SNOA 4KY5A 4J8QA 4NXMQ 1KDAA 3NSWA 1M90C 1JB7A 1VDZA 4XXEA 1IL2A 3BS1A 1I4QA 1X3PA 4XQQA 4IPGA 2UU9L 1A2TA 3NENA 4XT1B 4JI5L 2MGSA 2R93H 2DGYA 5IYBG 2F3WA 3HFZB 4R4CA 2QCPX 5A35A 2FMMA 4DAVA 2L9HA 4PMCA 2RCFA 4X64L 4BY7H 1CK1A 1JOKA 4L5RC 5ELFA 3A8IE 3CCLA 1S4ZA 1OXVA 4OEMB 3EQLC 3D31A 2HQEA 5IT9c 4QCLA 4HR7B 5CV8A 4A3GB 4JI3L 1F9PA 3KBGA 5C0XG 4PQXA 2DJFC 1MBYA 4FXKC 1Y1WH 3K7AH 2BCOA 4V190 3KLWA 3TS0A 4YIJA 3J80L 2HIVA 4R9WA 5KNBA 4C3IH 3NEMA 2PZUA 1EQVA 1DOLA 1Y8OB 4C1NK 4FVMA 1YNXA 2IL8A 1N32L 1HUMA 1LO5D 1CKOA 4GNXA 1L1OB 4Y52H 4RG1A 1XTDA 4A3MB 1ASZA 3I4MB 4KD4A 1ML0D 3M4QA 1I3QH 3Q6SA 3TREA 4JI6L 1TVXA 2JA9A 3F2DA 2BH8A 3EBEA 2KHJA 3AFPA 2R93G 3VDYA 2EYJA 4K6LA 2R6GA 4DR6Q 1HA5A 3ZJYC 1BR9A 4AQYL 3NXWA 1VQOA 4R8IA 1S5DD 5GROA 4HJ5A 3M3YB 4BBSH 3UE1A 2OQKA 1A62A 3PIPA 1PA6A 2I5LX 3OYYA 1I4PA 1O80A 1PHJA 3PO3H 1PFBA 4I65A 1WTPA 3A7AB 1CSPA 4YHHL 3FP9A 4NXNL 1SJED 3X3NA 3AQQA 1VQFA 2KBNA 2PQAB 2IX3A 4DV3L 3ER0A 4L8JA 1VQBA 1VQEA 3G4SA 2BA0A 1X32A 3MEFA 4GN4B 1L0YB 4WRDA 1PH2A 4QB4A 2YTVA 1IBKL 4B3MQ 2K28A 3I4LA 5IP9H 1H9SA 5IY0A 3DEOA 1QB5D 1SFOH 2NTSA 5ELNA 4X66Q 1K73C 5BR8Q 4A3IB 3PF5A 1CZGA 3OIPA 3D6CA 3SGIA 1VQMA 1BNZA 3RUZA 2BDOA 3JAME 5FLXc 2VB3X 3QWNA 1K8MA 4TSSA 1KAAA 1E3PA 3FRPB 3VR5A 5HGTA 3QG1A 1VQAA 1C0AA 3ITPA 1HPCA 5TSSA 2ASBA 2B2TC 3C2PA 1V1PB 2CFMA 2Z6KC 1FGUA 2AWOA 4CDFC 4GN3B 2F0NA 4H02A 1SYDA 1T5EA 2JA7B 1C8CA 5JVH3 1PH3A 3PO3G 4O0AA 2CCZA 5CV7A 1JT8A
chains in the Genus database with same CATH topology
3CXCA 3PF4A 2K5NA 1HNXQ 1WOCA 1KQSA 1HNZQ 2NVYH 1Z9FA 4UPAA 1X65A 2PNHA 4DR1Q 4BXXH 2E2IH 4OWXB 2JA6H 4P73A 1TWCH 4JOIC 3TEHB 3J81i 3CC7A 2MFIA 4DKAC 4JYAQ 4JI7Q 2EIFA 3GTPH 4JI1Q 1BVSA 2DUDA 4YWMA 5IP9G 5C3EH 2VQEQ 1HZAA 1VQKA 1Q12A 1QUQA 4JBMA 1K0RA 2BA1A 3A5UA 4DR3Q 3I2ZA 2B63H 3GTOH 4A3LG 3S24A 3RN2A 2PI2A 2HT1A 1QVFA 3HKSA 3HKZG 4LFCQ 3HOWH 3H0GG 2GVBA 5AJ3Q 2ZM6Q 1MJEA 4KLKA 4DV6Q 3I4NG 4GS3A 1NY4A 4OX9L 1EOVA 2B3GA 1TWFH 2LXKA 3I55A 1VQ6A 1K83H 3F8TA 1QZHA 4P74A 1D7QA 2NVTH 2R92G 3W1BA 4YCVA 2I5HA 1C7YA 3S2HH 2MO1A 4A3IG 4JC0A 1RIPA 4DUYL 3H15A 1QVCA 2LSSA 3HOZG 2RHQB 3J7A5 3WWVA 1OTCA 3GTQH 3I56A 3L7ZC 4HIMA 4A3DH 1U0LA 4IPHA 3K0XA 1K8GA 3UE0A 1YI2A 3EN2A 5HGQA 5M5WH 2OWOA 4JI8L 2IX1A 1CKNB 4QJFA 1WJJA 2K4KA 3J81c 1XPOA 3H3VH 4BY7G 3GTJH 1Z47A 2UXDQ 3S1NH 1HH2P 3S16H 5IYCG 5GAHC 4DV1L 4LF6L 5FLMG 1SMXA 4PZ7A 3CC2A 3PIOA 5IYDG 1AE2A 1PH1A 2F52A 4DV2Q 2JA5H 1B8AA 1FJGL 2N3SA 1QZGA 1K3RA 1CUKA 2YYZA 3KF6B 2N49A 1XMQQ 2HIXA 2K75A 5C4XH 1XPRA 3CCSA 4LF8L 4DR6L 1KHIA 2WFWA 2YU9H 4LF7L 1PH6A 3T1HL 5IWAL 1Y1WG 3H3VI 3RN5A 1KC8C 1GM5A 2NVXH 3JAMi 4R4IA 3CCVA 2NN6G 4B3TQ 3PUXA 2MNAA 2B63G 1XNQL 4TVAB 3PCOB 2H5XA 5LMNQ 1VQDA 1QVGA 1PH8A 3MXNB 4A3EH 3RR5A 1UE6A 3F2CA 2UXCQ 3CCEA 5IYBH 3F1ZA 1NBWA 4GLAC 3KFUA 4LUZA 3UDGA 4JI2L 4OWWB 3HKZE 5LMUL 1R9TH 4A3BG 1E22A 4P75A 2ZJPA 3CW2C 5M3MH 2A8VA 4KHZA 2ZTDA 4P71A 4X62Q 1N33L 1FL0A 1CKNA 4LUVA 3U4VA 2HHHL 2UUBQ 2XGTA 1S3OA 2JQOA 4UP8A 3RLFA 1JMCA 4A3DG 5C44H 2EXDA 2Y0SE 3UDIA 3TRZA 2K52A 4DAMA 1GD7A 4LFBQ 2UXCL 4DV4L 1N34Q 3JC66 1LM0A 4B3ML 3AEVA 2KCTA 1WCMH 2I5MX 2PMZE 4A3KH 1G51A 1VQHA 4APVA 4AYBG 4DR5Q 1SROA 1HR0Q 2JA8H 4WJ4A 4X66L 4KHPQ 1VQ4A 5BR8L 4LWCA 3S1QH 2D0PA 1GO3E 3CAMA 3KF6A 1YBYA 3ULJA 2IY5B 3PUWA 1KRSA 2IHEA 1CSQA 3CP0A 1YZ6A 4OONA 4RMFA 4HJ9A 4BBSG 2PI2E 3ULLA 3RNUA 3BU2A 1Q1EA 2RHSB 4IFDJ 4LF4L 1IBML 4OWTB 4DUZQ 2UU9Q 2VQFL 2JA5G 1SLJA 1IZ6A 4DV7Q 1J5EL 1V9PA 3CCJA 4JI5Q 1WFQA 3KF8B 5IP7H 4A3JH 4O2DA 3A74A 1YEZA 5C4XG 4GOPB 3OW2A 4X65Q 4OO1I 2V1CC 4JG2A 2UUCQ 4X64Q 4DV5L 2N78A 3PGZA 3EIVA 5GAGC 1HJPA 1EIFA 3RLNA 2MO0A 4KI0A 3J80i 1VQLA 1UEBA 1TWHH 5K36G 1YJWA 1YHBA 4HJAA 4IPDA 1K9MC 2WB1G 2NZOA 2UUAL 3T1YL 4POFA 2BH2A 1IXRA 4DR4Q 4BA1I 4JV5L 4A3EG 1O7IA 2Q2UA 1HZCA 1S72A 3OTOL 2L15A 4YY3Q 4JI3Q 3GO5A 4R4QA 4XIGS 2AWNA 1JJ2A 4GKJQ 1Y14B 4GLXA 4B3SL 1B70B 1A0IA 4YWLA 5FJ8G 2VL6A 1D8LA 2EQSA 1X56A 1HNXL 1EUJA 4JI0Q 3PO2G 1Q81C 4GKKQ 3STBD 3CCQA 1E1TA 3CQZH 4LF9Q 1HNZL 3G48A 3NELA 4BY1H 3HOYH 3PUYA 1I94Q 5M5YH 3CD6A 3J7ZC 1E7ZA 3D0FA 4HJ7A 4J15A 3PV0A 4DR1L 1XMOQ 4A93H 1G6PA 2LXJA 5J3BA 3M7NA 1EFWA 3M85A 4JYAL 4OO1G 2VNUD 4JI7L 1SN8A 4UP9A 3W1GA 2JA7H 1XJVA 4JI1L 2Q2IA 2QEXA 2VQEL 1HZBA 1WCMG 1DGSA 2JA6G 1NTGA 2C35B 4HJ8A 1OXTA 3F2BA 1N32Q 1MJCA 1VCIA 2JA8G 4QY7A 3STBC 1CKMA 1IYJB 2Y0SG 4EX5A 4IFDI 4DR3L 1EYGA 1TWGH 5M5XH 2K14A 3KYHC 4UP7A 4GOPA 1EIYB 1OXXK 1PYBA 2VS1A 4MNOA 4AYBE 4LFCL 3J80c 3GTKH 4IOAA 3A5ZB 3HOXH 1H95A 1BBWA 1YJNA 5AJ3L 2ZM6L 4JBJA 4DV6L 4JI6Q 1KRTA 3AFQA 3GDEA 1VQ5A 4A3GH 4PZ6A 5JJLA 1HR0W 2GN5A 3PSIA 2IT1A 4LUOA 5M3FH 3E9HA 2OCEA 2CWPA 1OXSC 1PV4A 2N8NA 1TWAH 2XTIA 4AQYQ 2VUMH 3CF5A 2Q2TA 3CPFA 3RZDH 1VQ8A 1BBUA 4XTCS 1X6OA 3G71A 4K0KQ 2NVQH 4P72A 4L5TA 4DPGA 2UXBQ 4ME3A 3FKIH 3CMEA 4BXXG 3TQYA 4NB3A 4LFAQ 1HZ9A 4WJ3M 1HNWQ 4A3FH 3ERSX 3UDXA 2R7ZH 1E1OA 5C3EG 2WB1E 4DR2Q 1J6QA 4YCUA 4A75A 1M1KC 2F4VQ 4IFDG 2UXDL 1JE5A 4DV0Q 4A3MH 2R7FA 4DAYB 4MZ9A 4Y7NH 4LNQA 4C3HH 3NBHB 1N36Q 3I4MH 1OXUA 4R1JA 1UWVA 4YHHQ 2ZJRA 4NXNQ 2JEAI 4MTNA 4IJLA 3S15H 3HOYG 1PH7A 3L0OA 1GVPA 3HOWG 5C0XJ 3RLOA 4AIMA 4DV3Q 4DV2L 4A93G 1KAWA 1N8RC 1PVOA 4JCVE 1YJ9A 4LF5Q 3S2DH 4JBWA 4B3RQ 3ULPA 1XMQL 2AMCB 3HOUH 3G6EA 1IBLQ 1IBKQ 2RCNA 1L2FA 2E5LQ 4GOPC 3E9IA 4BBRH 2YTXA 4C2MH 1W3SA 4QIWE 1EQRA 4A3CH 3M3YH 5IE8A 3K7UC 2CQOA 4B3TL 1S40A 3KDFB 3GTLH 1NMGA 2WP8J 5LMNL 3U50C 3I4OA 1AE3A 2QGQA 1LYLA 4A3GG 2VY3A 1RL2A 4JI4Q 1MIUA 1V1QA 1X3GA 3DM3A 3W5OA 2K5HA 1X3EA 4YWKA 5C4JH 2HQLA 2OQ0A 4GN5A 1A63A 1X9NA 3M4PA 5EAYA 4X62L 4A3LH 2JEBI 3E0EA 1GKHA 3Q8DA 2VW9A 4HIDA 2UUBL 2CCZA 4NPSA 3BJUA 4PG3A 2UXBL 4LFBL 2VZAA 3I7FA 1N34L 1VQ7A 1KXLA 1P8LA 2E8GA 1Y1VH 4YCWA 1HR0L 4DR7Q 1G291 4DR5L 1C9OA 4QGUA 4KHPL 4NXMQ 4DK3C 4A3MG 3RZOH 1B7YB 4A3IH 2CWAA 5C0XI 2RF4A 1M90C 1JB7A 1SE8A 3I4MG 1IL2A 3HOZH 3M4OH 1PH5A 3K81C 1EQQA 1WI5A 2K5VA 4LW1A 4DUZL 4IPGA 2UU9L 2JE6I 1VS0A 3NENA 5JEAJ 4GNXB 2GVAA 2KCMA 2ZTEA 3M9BA 4DV7L 4JI5L 1VQIA 3TS2A 3KDFA 2DGYA 3PUZA 5IYBG 2R93H 3HFZB 4R4CA 4TQUS 3KOJA 4AH6A 4X65L 3ICEA 1X55A 5GAEC 2UUCL 4BBRG 2E2HH 4X64L 4BY7H 2KHIA 5M3MG 1NMFA 5IYCH 4JBKA 4L5RC 2NZHA 4A3CG 5GQOA 5FLMH 3S1RH 1OXVA 2OTLA 5LMNW 3CCLA 1Q1BA 1UE5A 3D31A 5IYDH 5IT9c 4DR4L 2ID0A 5C44G 4OX9Q 3IRBA 1XPUA 4YY3L 1PYSB 4JI3L 4A3KG 4GKJL 4QQBX 4IJHA 5C0XG 3CCUA 1Q82C 3CCMA 1SRUA 1Y1WH 4UY8C 3K7AH 3KLWA 4JI0L 2ATWA 1BKBA 4R4OA 4DUYQ 1I5FA 3TS0A 4LF9L 2HIVA 1VQCA 4GKKL 1A8VA 4C3IH 1YVCA 3NEMA 3CMAA 3CPWA 1I94L 1I6HH 1XMOL 1X3FA 1VQ9A 2WAQE 1YNXA 1KL9A 1LTLA 3AYHB 5IP7G 4A3JG 4A76A 1Y1VG 2F3IA 4DNIA 1N9WA 5H1SE 1N32L 4JI8Q 1KIXA 3B6YA 1CKOA 4PZ8A 4GNXA 1EWIA 4A3BH 3FHWA 2MQHA 1L1OB 4IO9A 2IHFA 4Y52H 2K50A 4RG1A 1XTDA 4LF6Q 4DV1Q 1ASZA 4L5QA 3HOVH 3K8AA 2Z0SA 3M4QA 1I3QH 4GLVB 2Q2HA 1LUZA 5HY6A 3TREA 1YHQA 4JI6L 2NN6I 1SR3A 2JA9A 3F2DA 2BH8A 1JJCB 3GTGH 3EBEA 2AHOB 2KHJA 3AFPA 1FJGQ 2R93G 1YHAA 3VDYA 1KD1C 1WYDA 4LF8Q 2R6GA 4DR6Q 4LF7Q 3ZJYC 4AQYL 1NJIC 1VQOA 3T1HQ 5IWAQ 5GROA 1PFSA 4C3JH 4HJ5A 4K0KL 4FDBA 1ASYA 3S1MH 4BY1G 4BBSH 3UE1A 1T9HA 3KJOA 1XNQQ 1NE3A 2OQKA 3KJPA 1W2BA 1A62A 2YTYA 3PUVA 3U4ZA 3PIPA 1PA6A 4R4TA 3GTMH 2I5LX 3OYYA 1AH9A 2QA4A 2A19A 1VQPA 3L2PA 4LFAL 1HNWL 2JA7G 1PH9A 1TXYA 4DR2L 1PHJA 2F4VL 2Z6KA 3PO3H 4JI2Q 4DV0L 2ZJQA 5JEAG 5LMUQ 2FXQA 2D0OA 1N36L 1K8AC 1CSPA 2R7DA 1P16A 3FP9A 4NXNL 4YHHL 4HIKA 1Q7YC 1VQFA 3AQQA 1N33Q 2KBNA 2PQAB 5GADC 1U5KA 1L1OA 3HOXG 4DV3L 1I50H 1PH4A 4OXPA 2HHHQ 1FVIA 3ER0A 4A4IA 4GNXC 4LF5L 1VQBA 1VQEA 3BZCA 2IX0A 3LGJA 4DK6C 3G4SA 2E2JH 4B3RL 4X6AH 2BA0A 1IBLL 3MEFA 4GN4B 4DV4Q 1PH2A 1IBKL 2E5LL 2YTVA 5M3FG 4B3MQ 5IP9H 1UE1A 5IY0A 1V43A 3BZKA 1SFOH 4EQ5A 2AKWB 5ELNA 4X66Q 1K73C 3GD7A 2VUMG 4JOIA 4QL5A 1L0WA 2WAQG 5BR8Q 3K80C 5FJ8H 2ES2A 4PMWA 1XNRQ 2YV5A 3PO2H 3PF5A 4BA2I 1VQJA 3HOVG 1Q8KA 1VQNA 3SGIA 3FKIG 3H0GH 1IBMQ 4LF4Q 3UDFA 3I4NH 1VQMA 4ALPA 2OTJA 2ZTCA 3CCRA 4HIOA 2VQFQ 1QUQB 3U58A 1J5EQ 4JI4L 4A3FG 1X54A 2I0QA 2R7ZG 2R92H 5JJKA 5FLXc 4POGA 5JJIA 1YIJA 3S14H 4DV5Q 1E24A 1E3PA 2JJQA 2JK8A 3J81j 1XNRL 3S17H 3A0JA 4IOCA 1VQAA 5ELOA 3CC4A 1C0AA 1UE7A 1YITA 2ASBA 2B29A 3JAMc 2A1AA 2CFMA 2KENA 3T1YQ 2Z6KC 1Q86C 2UUAQ 4L5SA 1Q46A 5E7NA 4JV5Q 1FGUA 2ALYB 2AWOA 3HOUG 2PQAA 4GN3B 3DLLA 2D62A 4H02A 4IPCA 4DR7L 3OTOQ 1MKHA 1VQGA 2CKZB 1PH3A 4NXML 3PO3G 4O0AA 1L1OC 1JJGA 1JT8A 5DLQE 4B3SQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CXC A;  3PF4 A;  2K5N A;  1HNX Q;  1WOC A;  1KQS A;  1HNZ Q;  2NVY H;  1Z9F A;  4UPA A;  1X65 A;  2PNH A;  4DR1 Q;  4BXX H;  2E2I H;  4OWX B;  2JA6 H;  4P73 A;  1TWC H;  4JOI C;  3TEH B;  3J81 i;  3CC7 A;  2MFI A;  4DKA C;  4JYA Q;  4JI7 Q;  2EIF A;  3GTP H;  4JI1 Q;  1BVS A;  2DUD A;  4YWM A;  5IP9 G;  5C3E H;  2VQE Q;  1HZA A;  1VQK A;  1Q12 A;  1QUQ A;  4JBM A;  1K0R A;  2BA1 A;  3A5U A;  4DR3 Q;  3I2Z A;  2B63 H;  3GTO H;  4A3L G;  3S24 A;  3RN2 A;  2PI2 A;  2HT1 A;  1QVF A;  3HKS A;  3HKZ G;  4LFC Q;  3HOW H;  3H0G G;  2GVB A;  5AJ3 Q;  2ZM6 Q;  1MJE A;  4KLK A;  4DV6 Q;  3I4N G;  4GS3 A;  1NY4 A;  4OX9 L;  1EOV A;  2B3G A;  1TWF H;  2LXK A;  3I55 A;  1VQ6 A;  1K83 H;  3F8T A;  1QZH A;  4P74 A;  1D7Q A;  2NVT H;  2R92 G;  3W1B A;  4YCV A;  2I5H A;  1C7Y A;  3S2H H;  2MO1 A;  4A3I G;  4JC0 A;  1RIP A;  4DUY L;  3H15 A;  1QVC A;  2LSS A;  3HOZ G;  2RHQ B;  3J7A 5;  3WWV A;  1OTC A;  3GTQ H;  3I56 A;  3L7Z C;  4HIM A;  4A3D H;  1U0L A;  4IPH A;  3K0X A;  1K8G A;  3UE0 A;  1YI2 A;  3EN2 A;  5HGQ A;  5M5W H;  2OWO A;  4JI8 L;  2IX1 A;  1CKN B;  4QJF A;  1WJJ A;  2K4K A;  3J81 c;  1XPO A;  3H3V H;  4BY7 G;  3GTJ H;  1Z47 A;  2UXD Q;  3S1N H;  1HH2 P;  3S16 H;  5IYC G;  5GAH C;  4DV1 L;  4LF6 L;  5FLM G;  1SMX A;  4PZ7 A;  3CC2 A;  3PIO A;  5IYD G;  1AE2 A;  1PH1 A;  2F52 A;  4DV2 Q;  2JA5 H;  1B8A A;  1FJG L;  2N3S A;  1QZG A;  1K3R A;  1CUK A;  2YYZ A;  3KF6 B;  2N49 A;  1XMQ Q;  2HIX A;  2K75 A;  5C4X H;  1XPR A;  3CCS A;  4LF8 L;  4DR6 L;  1KHI A;  2WFW A;  2YU9 H;  4LF7 L;  1PH6 A;  3T1H L;  5IWA L;  1Y1W G;  3H3V I;  3RN5 A;  1KC8 C;  1GM5 A;  2NVX H;  3JAM i;  4R4I A;  3CCV A;  2NN6 G;  4B3T Q;  3PUX A;  2MNA A;  2B63 G;  1XNQ L;  4TVA B;  3PCO B;  2H5X A;  5LMN Q;  1VQD A;  1QVG A;  1PH8 A;  3MXN B;  4A3E H;  3RR5 A;  1UE6 A;  3F2C A;  2UXC Q;  3CCE A;  5IYB H;  3F1Z A;  1NBW A;  4GLA C;  3KFU A;  4LUZ A;  3UDG A;  4JI2 L;  4OWW B;  3HKZ E;  5LMU L;  1R9T H;  4A3B G;  1E22 A;  4P75 A;  2ZJP A;  3CW2 C;  5M3M H;  2A8V A;  4KHZ A;  2ZTD A;  4P71 A;  4X62 Q;  1N33 L;  1FL0 A;  1CKN A;  4LUV A;  3U4V A;  2HHH L;  2UUB Q;  2XGT A;  1S3O A;  2JQO A;  4UP8 A;  3RLF A;  1JMC A;  4A3D G;  5C44 H;  2EXD A;  2Y0S E;  3UDI A;  3TRZ A;  2K52 A;  4DAM A;  1GD7 A;  4LFB Q;  2UXC L;  4DV4 L;  1N34 Q;  3JC6 6;  1LM0 A;  4B3M L;  3AEV A;  2KCT A;  1WCM H;  2I5M X;  2PMZ E;  4A3K H;  1G51 A;  1VQH A;  4APV A;  4AYB G;  4DR5 Q;  1SRO A;  1HR0 Q;  2JA8 H;  4WJ4 A;  4X66 L;  4KHP Q;  1VQ4 A;  5BR8 L;  4LWC A;  3S1Q H;  2D0P A;  1GO3 E;  3CAM A;  3KF6 A;  1YBY A;  3ULJ A;  2IY5 B;  3PUW A;  1KRS A;  2IHE A;  1CSQ A;  3CP0 A;  1YZ6 A;  4OON A;  4RMF A;  4HJ9 A;  4BBS G;  2PI2 E;  3ULL A;  3RNU A;  3BU2 A;  1Q1E A;  2RHS B;  4IFD J;  4LF4 L;  1IBM L;  4OWT B;  4DUZ Q;  2UU9 Q;  2VQF L;  2JA5 G;  1SLJ A;  1IZ6 A;  4DV7 Q;  1J5E L;  1V9P A;  3CCJ A;  4JI5 Q;  1WFQ A;  3KF8 B;  5IP7 H;  4A3J H;  4O2D A;  3A74 A;  1YEZ A;  5C4X G;  4GOP B;  3OW2 A;  4X65 Q;  4OO1 I;  2V1C C;  4JG2 A;  2UUC Q;  4X64 Q;  4DV5 L;  2N78 A;  3PGZ A;  3EIV A;  5GAG C;  1HJP A;  1EIF A;  3RLN A;  2MO0 A;  4KI0 A;  3J80 i;  1VQL A;  1UEB A;  1TWH H;  5K36 G;  1YJW A;  1YHB A;  4HJA A;  4IPD A;  1K9M C;  2WB1 G;  2NZO A;  2UUA L;  3T1Y L;  4POF A;  2BH2 A;  1IXR A;  4DR4 Q;  4BA1 I;  4JV5 L;  4A3E G;  1O7I A;  2Q2U A;  1HZC A;  1S72 A;  3OTO L;  2L15 A;  4YY3 Q;  4JI3 Q;  3GO5 A;  4R4Q A;  4XIG S;  2AWN A;  1JJ2 A;  4GKJ Q;  1Y14 B;  4GLX A;  4B3S L;  1B70 B;  1A0I A;  4YWL A;  5FJ8 G;  2VL6 A;  1D8L A;  2EQS A;  1X56 A;  1HNX L;  1EUJ A;  4JI0 Q;  3PO2 G;  1Q81 C;  4GKK Q;  3STB D;  3CCQ A;  1E1T A;  3CQZ H;  4LF9 Q;  1HNZ L;  3G48 A;  3NEL A;  4BY1 H;  3HOY H;  3PUY A;  1I94 Q;  5M5Y H;  3CD6 A;  3J7Z C;  1E7Z A;  3D0F A;  4HJ7 A;  4J15 A;  3PV0 A;  4DR1 L;  1XMO Q;  4A93 H;  1G6P A;  2LXJ A;  5J3B A;  3M7N A;  1EFW A;  3M85 A;  4JYA L;  4OO1 G;  2VNU D;  4JI7 L;  1SN8 A;  4UP9 A;  3W1G A;  2JA7 H;  1XJV A;  4JI1 L;  2Q2I A;  2QEX A;  2VQE L;  1HZB A;  1WCM G;  1DGS A;  2JA6 G;  1NTG A;  2C35 B;  4HJ8 A;  1OXT A;  3F2B A;  1N32 Q;  1MJC A;  1VCI A;  2JA8 G;  4QY7 A;  3STB C;  1CKM A;  1IYJ B;  2Y0S G;  4EX5 A;  4IFD I;  4DR3 L;  1EYG A;  1TWG H;  5M5X H;  2K14 A;  3KYH C;  4UP7 A;  4GOP A;  1EIY B;  1OXX K;  1PYB A;  2VS1 A;  4MNO A;  4AYB E;  4LFC L;  3J80 c;  3GTK H;  4IOA A;  3A5Z B;  3HOX H;  1H95 A;  1BBW A;  1YJN A;  5AJ3 L;  2ZM6 L;  4JBJ A;  4DV6 L;  4JI6 Q;  1KRT A;  3AFQ A;  3GDE A;  1VQ5 A;  4A3G H;  4PZ6 A;  5JJL A;  1HR0 W;  2GN5 A;  3PSI A;  2IT1 A;  4LUO A;  5M3F H;  3E9H A;  2OCE A;  2CWP A;  1OXS C;  1PV4 A;  2N8N A;  1TWA H;  2XTI A;  4AQY Q;  2VUM H;  3CF5 A;  2Q2T A;  3CPF A;  3RZD H;  1VQ8 A;  1BBU A;  4XTC S;  1X6O A;  3G71 A;  4K0K Q;  2NVQ H;  4P72 A;  4L5T A;  4DPG A;  2UXB Q;  4ME3 A;  3FKI H;  3CME A;  4BXX G;  3TQY A;  4NB3 A;  4LFA Q;  1HZ9 A;  4WJ3 M;  1HNW Q;  4A3F H;  3ERS X;  3UDX A;  2R7Z H;  1E1O A;  5C3E G;  2WB1 E;  4DR2 Q;  1J6Q A;  4YCU A;  4A75 A;  1M1K C;  2F4V Q;  4IFD G;  2UXD L;  1JE5 A;  4DV0 Q;  4A3M H;  2R7F A;  4DAY B;  4MZ9 A;  4Y7N H;  4LNQ A;  4C3H H;  3NBH B;  1N36 Q;  3I4M H;  1OXU A;  4R1J A;  1UWV A;  4YHH Q;  2ZJR A;  4NXN Q;  2JEA I;  4MTN A;  4IJL A;  3S15 H;  3HOY G;  1PH7 A;  3L0O A;  1GVP A;  3HOW G;  5C0X J;  3RLO A;  4AIM A;  4DV3 Q;  4DV2 L;  4A93 G;  1KAW A;  1N8R C;  1PVO A;  4JCV E;  1YJ9 A;  4LF5 Q;  3S2D H;  4JBW A;  4B3R Q;  3ULP A;  1XMQ L;  2AMC B;  3HOU H;  3G6E A;  1IBL Q;  1IBK Q;  2RCN A;  1L2F A;  2E5L Q;  4GOP C;  3E9I A;  4BBR H;  2YTX A;  4C2M H;  1W3S A;  4QIW E;  1EQR A;  4A3C H;  3M3Y H;  5IE8 A;  3K7U C;  2CQO A;  4B3T L;  1S40 A;  3KDF B;  3GTL H;  1NMG A;  2WP8 J;  5LMN L;  3U50 C;  3I4O A;  1AE3 A;  2QGQ A;  1LYL A;  4A3G G;  2VY3 A;  1RL2 A;  4JI4 Q;  1MIU A;  1V1Q A;  1X3G A;  3DM3 A;  3W5O A;  2K5H A;  1X3E A;  4YWK A;  5C4J H;  2HQL A;  2OQ0 A;  4GN5 A;  1A63 A;  1X9N A;  3M4P A;  5EAY A;  4X62 L;  4A3L H;  2JEB I;  3E0E A;  1GKH A;  3Q8D A;  2VW9 A;  4HID A;  2UUB L;  2CCZ A;  4NPS A;  3BJU A;  4PG3 A;  2UXB L;  4LFB L;  2VZA A;  3I7F A;  1N34 L;  1VQ7 A;  1KXL A;  1P8L A;  2E8G A;  1Y1V H;  4YCW A;  1HR0 L;  4DR7 Q;  1G29 1;  4DR5 L;  1C9O A;  4QGU A;  4KHP L;  4NXM Q;  4DK3 C;  4A3M G;  3RZO H;  1B7Y B;  4A3I H;  2CWA A;  5C0X I;  2RF4 A;  1M90 C;  1JB7 A;  1SE8 A;  3I4M G;  1IL2 A;  3HOZ H;  3M4O H;  1PH5 A;  3K81 C;  1EQQ A;  1WI5 A;  2K5V A;  4LW1 A;  4DUZ L;  4IPG A;  2UU9 L;  2JE6 I;  1VS0 A;  3NEN A;  5JEA J;  4GNX B;  2GVA A;  2KCM A;  2ZTE A;  3M9B A;  4DV7 L;  4JI5 L;  1VQI A;  3TS2 A;  3KDF A;  2DGY A;  3PUZ A;  5IYB G;  2R93 H;  3HFZ B;  4R4C A;  4TQU S;  3KOJ A;  4AH6 A;  4X65 L;  3ICE A;  1X55 A;  5GAE C;  2UUC L;  4BBR G;  2E2H H;  4X64 L;  4BY7 H;  2KHI A;  5M3M G;  1NMF A;  5IYC H;  4JBK A;  4L5R C;  2NZH A;  4A3C G;  5GQO A;  5FLM H;  3S1R H;  1OXV A;  2OTL A;  5LMN W;  3CCL A;  1Q1B A;  1UE5 A;  3D31 A;  5IYD H;  5IT9 c;  4DR4 L;  2ID0 A;  5C44 G;  4OX9 Q;  3IRB A;  1XPU A;  4YY3 L;  1PYS B;  4JI3 L;  4A3K G;  4GKJ L;  4QQB X;  4IJH A;  5C0X G;  3CCU A;  1Q82 C;  3CCM A;  1SRU A;  1Y1W H;  4UY8 C;  3K7A H;  3KLW A;  4JI0 L;  2ATW A;  1BKB A;  4R4O A;  4DUY Q;  1I5F A;  3TS0 A;  4LF9 L;  2HIV A;  1VQC A;  4GKK L;  1A8V A;  4C3I H;  1YVC A;  3NEM A;  3CMA A;  3CPW A;  1I94 L;  1I6H H;  1XMO L;  1X3F A;  1VQ9 A;  2WAQ E;  1YNX A;  1KL9 A;  1LTL A;  3AYH B;  5IP7 G;  4A3J G;  4A76 A;  1Y1V G;  2F3I A;  4DNI A;  1N9W A;  5H1S E;  1N32 L;  4JI8 Q;  1KIX A;  3B6Y A;  1CKO A;  4PZ8 A;  4GNX A;  1EWI A;  4A3B H;  3FHW A;  2MQH A;  1L1O B;  4IO9 A;  2IHF A;  4Y52 H;  2K50 A;  4RG1 A;  1XTD A;  4LF6 Q;  4DV1 Q;  1ASZ A;  4L5Q A;  3HOV H;  3K8A A;  2Z0S A;  3M4Q A;  1I3Q H;  4GLV B;  2Q2H A;  1LUZ A;  5HY6 A;  3TRE A;  1YHQ A;  4JI6 L;  2NN6 I;  1SR3 A;  2JA9 A;  3F2D A;  2BH8 A;  1JJC B;  3GTG H;  3EBE A;  2AHO B;  2KHJ A;  3AFP A;  1FJG Q;  2R93 G;  1YHA A;  3VDY A;  1KD1 C;  1WYD A;  4LF8 Q;  2R6G A;  4DR6 Q;  4LF7 Q;  3ZJY C;  4AQY L;  1NJI C;  1VQO A;  3T1H Q;  5IWA Q;  5GRO A;  1PFS A;  4C3J H;  4HJ5 A;  4K0K L;  4FDB A;  1ASY A;  3S1M H;  4BY1 G;  4BBS H;  3UE1 A;  1T9H A;  3KJO A;  1XNQ Q;  1NE3 A;  2OQK A;  3KJP A;  1W2B A;  1A62 A;  2YTY A;  3PUV A;  3U4Z A;  3PIP A;  1PA6 A;  4R4T A;  3GTM H;  2I5L X;  3OYY A;  1AH9 A;  2QA4 A;  2A19 A;  1VQP A;  3L2P A;  4LFA L;  1HNW L;  2JA7 G;  1PH9 A;  1TXY A;  4DR2 L;  1PHJ A;  2F4V L;  2Z6K A;  3PO3 H;  4JI2 Q;  4DV0 L;  2ZJQ A;  5JEA G;  5LMU Q;  2FXQ A;  2D0O A;  1N36 L;  1K8A C;  1CSP A;  2R7D A;  1P16 A;  3FP9 A;  4NXN L;  4YHH L;  4HIK A;  1Q7Y C;  1VQF A;  3AQQ A;  1N33 Q;  2KBN A;  2PQA B;  5GAD C;  1U5K A;  1L1O A;  3HOX G;  4DV3 L;  1I50 H;  1PH4 A;  4OXP A;  2HHH Q;  1FVI A;  3ER0 A;  4A4I A;  4GNX C;  4LF5 L;  1VQB A;  1VQE A;  3BZC A;  2IX0 A;  3LGJ A;  4DK6 C;  3G4S A;  2E2J H;  4B3R L;  4X6A H;  2BA0 A;  1IBL L;  3MEF A;  4GN4 B;  4DV4 Q;  1PH2 A;  1IBK L;  2E5L L;  2YTV A;  5M3F G;  4B3M Q;  5IP9 H;  1UE1 A;  5IY0 A;  1V43 A;  3BZK A;  1SFO H;  4EQ5 A;  2AKW B;  5ELN A;  4X66 Q;  1K73 C;  3GD7 A;  2VUM G;  4JOI A;  4QL5 A;  1L0W A;  2WAQ G;  5BR8 Q;  3K80 C;  5FJ8 H;  2ES2 A;  4PMW A;  1XNR Q;  2YV5 A;  3PO2 H;  3PF5 A;  4BA2 I;  1VQJ A;  3HOV G;  1Q8K A;  1VQN A;  3SGI A;  3FKI G;  3H0G H;  1IBM Q;  4LF4 Q;  3UDF A;  3I4N H;  1VQM A;  4ALP A;  2OTJ A;  2ZTC A;  3CCR A;  4HIO A;  2VQF Q;  1QUQ B;  3U58 A;  1J5E Q;  4JI4 L;  4A3F G;  1X54 A;  2I0Q A;  2R7Z G;  2R92 H;  5JJK A;  5FLX c;  4POG A;  5JJI A;  1YIJ A;  3S14 H;  4DV5 Q;  1E24 A;  1E3P A;  2JJQ A;  2JK8 A;  3J81 j;  1XNR L;  3S17 H;  3A0J A;  4IOC A;  1VQA A;  5ELO A;  3CC4 A;  1C0A A;  1UE7 A;  1YIT A;  2ASB A;  2B29 A;  3JAM c;  2A1A A;  2CFM A;  2KEN A;  3T1Y Q;  2Z6K C;  1Q86 C;  2UUA Q;  4L5S A;  1Q46 A;  5E7N A;  4JV5 Q;  1FGU A;  2ALY B;  2AWO A;  3HOU G;  2PQA A;  4GN3 B;  3DLL A;  2D62 A;  4H02 A;  4IPC A;  4DR7 L;  3OTO Q;  1MKH A;  1VQG A;  2CKZ B;  1PH3 A;  4NXM L;  3PO3 G;  4O0A A;  1L1O C;  1JJG A;  1JT8 A;  5DLQ E;  4B3S Q; 
#chains in the Genus database with same CATH topology
 1TS3 A;  4P2C B;  4NDX A;  3CXC A;  1IYU A;  3GV6 A;  3PF4 A;  4DA2 A;  5IT9 L;  1HNX Q;  1WOC A;  1KQS A;  2NVY H;  5L37 A;  2B2U C;  4DR1 Q;  4OWX B;  4JOI C;  1VMP A;  4DKA C;  2K1B A;  4JI7 Q;  4JI1 Q;  5IP9 G;  5C3E H;  2VQE Q;  3SHL A;  1VQK A;  1HZA A;  4A3B B;  2EJM A;  3LWU A;  1ET9 A;  5A2Q E;  3R3O A;  4IQZ A;  3K5N A;  3RN2 A;  3EFX D;  4RGO S;  3AU7 A;  3H94 A;  4DFA A;  3HKS A;  4LFC Q;  1G2T A;  4KKU A;  4OHJ A;  2ZM6 Q;  4KLK A;  4OX9 L;  1ENA A;  2B3G A;  3GTG B;  3I55 A;  1TKW B;  2K6A A;  3W1B A;  4YCV A;  2M2L A;  1H9J A;  5COY A;  4A3I G;  1V1O A;  4DUY L;  1QVC A;  4UAI A;  4CGY B;  3WWV A;  3RMH A;  4HIM A;  4A3D H;  1U0L A;  3K0X A;  2D9U A;  3SR1 A;  3OMC A;  1O7Y A;  2OWO A;  3EN2 A;  5C3W A;  2L12 A;  1ILQ A;  2EOT A;  1CKN B;  4JI8 L;  3GTJ H;  1TS4 A;  1RF2 D;  4DV1 L;  2RQX A;  1JOO A;  1ZKO A;  1ENC A;  1ET6 A;  2F52 A;  1I50 B;  2JA5 H;  1QZG A;  3PMF A;  2E2J B;  1STY A;  5C4X H;  4KY7 A;  2Q8T A;  3CCS A;  1XPR A;  4LF8 L;  4LK1 C;  2YU9 H;  4RFB A;  3T1H L;  3H3V I;  2K5Q A;  3JAM i;  3OW7 A;  4OGQ C;  2MNA A;  3D6W A;  1GUN A;  1VQD A;  3HKZ B;  3H0G B;  3MXN B;  4A3E H;  3RR5 A;  5E4W C;  4ZKB B;  3CCE A;  2NTT A;  1PZK D;  3QOJ A;  4JI2 L;  2XSC A;  5LMU L;  1R9T H;  1HQR D;  4A3B G;  1JWU D;  1FNW A;  2C9O A;  4ME5 A;  4P71 A;  1N33 L;  3S17 B;  4LUV A;  2HHH L;  2UUB Q;  3RLF A;  2JQO A;  1JMC A;  4A3D G;  5C44 H;  2EXD A;  2Y0S E;  2UXC L;  2K52 A;  4IUR A;  4DAM A;  5FLX L;  4G4K A;  1N34 Q;  2KCT A;  2I5M X;  4RGN A;  4WJ4 A;  4DR5 Q;  1SRO A;  3EJI A;  2B2Y C;  2EY5 A;  4KHP Q;  3S1Q H;  5EQ0 A;  3ULJ A;  2DNE A;  1PTO C;  3BVG A;  1KRS A;  2IHE A;  4FP5 D;  2PI2 E;  4H44 C;  4OWT B;  4DUZ Q;  5KYL A;  2JA5 G;  5EKI A;  2E2I B;  1J5E L;  1B44 D;  1WFQ A;  1TWC B;  3Q22 A;  3W3A A;  4A3J H;  5C4X G;  4TKO B;  2V1C C;  2UUC Q;  2QDB A;  2RVL A;  2N78 A;  4IZ8 A;  3PGZ A;  5GAG C;  1EYA A;  3TP8 A;  3GTO B;  1Q8I A;  2WB1 G;  4S3S A;  5IOC A;  3BVM A;  4DR4 Q;  4A3E G;  4K8J A;  2G5D A;  1K83 B;  4YY3 Q;  4R4Q A;  1EY6 A;  2MHV A;  2AWN A;  1JJ2 A;  1BCP D;  1HCZ A;  1IKL A;  2B2V A;  1B70 B;  5FJ8 G;  1EZ8 A;  2VL6 A;  1PTO B;  1D8L A;  3URY A;  2EZV A;  3J7A F;  3S2H B;  3CCQ A;  4LF9 Q;  1E1T A;  3CQZ H;  5BN3 A;  4BY1 H;  3G48 A;  3A54 A;  3FMC A;  3PUY A;  1I94 Q;  5M5Y H;  3H09 A;  3CD6 A;  3D0F A;  4A93 H;  3M7N A;  4JYA L;  1BCP C;  2VNU D;  3W1G A;  1JWS D;  3V05 A;  1LT4 D;  2J0T D;  2KQ3 A;  1VCI A;  2DN8 A;  4QY7 A;  1TWG H;  4C3J B;  1WTO A;  4WJW A;  2K14 A;  1HA6 A;  1OXX K;  1FNU A;  1W6J A;  1YJN A;  3GTM B;  4JBJ A;  4DV6 L;  2F0F A;  4HCE A;  3GDE A;  1S5E D;  4PZ6 A;  1HR0 W;  1EWH A;  1QG7 A;  4CKC A;  1B4O A;  3E9H A;  2OCE A;  2CWP A;  4KJO A;  5FKA C;  1ROD A;  4I7A A;  2ZT9 C;  2O2L D;  2EYM A;  3RZD H;  2Q2T A;  5JAV A;  5I6W A;  3F2U A;  4ME3 A;  4O42 A;  2L11 A;  2F0V A;  1O7L A;  3CME A;  4JK1 C;  4LFA Q;  2F0O A;  1M4V A;  2I46 A;  4ILW A;  3ERS X;  3Q24 A;  3UDX A;  4GZY C;  1LTS D;  1E1O A;  4DR2 Q;  1J6Q A;  4A75 A;  1KLU D;  4DV0 Q;  4DAY B;  3K58 A;  4LNQ A;  4ZUI A;  4C3H H;  5M3M B;  4R1J A;  5ELE A;  4MTN A;  4IJL A;  1PH7 A;  5HUR A;  4DV2 L;  4AIM A;  1TU2 B;  4A93 G;  1KLG D;  2AUK A;  4B3R Q;  1U4L A;  5G3L D;  3ULP A;  2AMC B;  1EU3 A;  3HOU H;  1F2Y A;  2E5L Q;  4GOP C;  3E9I A;  4BBR H;  1WCM B;  2JA6 B;  4A3K B;  5EBC A;  1HFG A;  2F0E A;  2CQO A;  3GP7 A;  1S40 A;  3KDF B;  2Q8R E;  2JP1 A;  1M8A A;  4RHS A;  5LMN L;  2WII B;  1JIC A;  3IFD A;  1AE3 A;  2QGQ A;  4DAP A;  1LYL A;  1SYE A;  5C3X A;  5IGE A;  1SDF A;  1V1Q A;  3HGB A;  2HCI A;  2HQL A;  2K5W A;  1LV9 A;  1WTX A;  3Q23 A;  4B9X A;  2K01 A;  2JEB I;  2VW9 A;  1CQV A;  5M9O A;  3BJU A;  1EY4 A;  4LFB L;  1VQ7 A;  1KXL A;  2E8G A;  1Y1V H;  2FHT A;  2PNR C;  5KNC A;  1T5X D;  1HR0 L;  4DR7 Q;  1G29 1;  1C9O A;  1FD7 D;  2AQ2 B;  3I91 A;  3GTP B;  3BVZ A;  4QGU A;  4DK3 C;  3K5L A;  2CWA A;  3FPU B;  3HOZ H;  3K81 C;  1EQQ A;  1WI5 A;  3V2T A;  3D4D A;  3HOY B;  2F4I A;  2GVA A;  4DV7 L;  3OHX C;  3PUZ A;  2B8G A;  4IUQ A;  2PW5 A;  4AH6 A;  5CBE E;  1J9O A;  4EVO A;  1X55 A;  3VYR A;  4ZK9 B;  3NTK A;  4BBR G;  2E2H H;  5M3M G;  2NZH A;  1DJR D;  5FLM H;  2OTL A;  3J7A V;  1DON A;  2NZ1 D;  3NQI A;  4KJN A;  3GTK B;  2ID0 A;  3HOX B;  2R61 A;  4DN4 M;  1XXG A;  3IRB A;  1XPU A;  4ZYS A;  4A3K G;  4CKE A;  1FNV A;  4IJH A;  5M3F B;  1Q82 C;  1AW7 A;  1PFN A;  1NCV A;  4UY8 C;  1LTB D;  2VUM B;  5FOB B;  3TP7 A;  2ATW A;  2WAQ B;  1GOZ A;  4NP5 A;  1YVC A;  3CPW A;  1XMO L;  1X3F A;  1S5B D;  3RD4 A;  1KL9 A;  3AYH B;  1A6X A;  1GJX A;  5IP7 G;  4A76 A;  1Y1V G;  5C5L A;  1N9W A;  1KIX A;  3FHW A;  3E5S A;  3R93 A;  4K5X A;  4F7X A;  4Y7N B;  3CRK C;  4LF6 Q;  2EYH A;  1EZ6 A;  4DU9 A;  4X3S A;  1NR2 A;  1R4P B;  1RTN A;  5CGK A;  1KAB A;  4GLV B;  4EQO A;  2EYL A;  1SR3 A;  2NN6 I;  5CV4 A;  1JJC B;  1U4R A;  3DUZ A;  3S2D B;  1YHA A;  4KN4 C;  5I2Y A;  1E2W A;  4LF7 Q;  2F0G A;  3FPP A;  1QE6 A;  1D5Z C;  2KHS A;  3I72 A;  2RBM A;  1ASY A;  2F0H A;  3S1M H;  2PZW A;  1TR5 A;  2RDH A;  2ZXR A;  1PMR A;  3GTL B;  3KJP A;  3PUV A;  3SK4 A;  3A7L A;  2XWB B;  1HNW L;  2B2T A;  2F4V L;  2O5J C;  1VMC A;  2Z6K A;  2KCC A;  5EKK A;  2ZJQ A;  2FXQ A;  4PMB A;  1LT3 D;  3SE0 A;  1K8A C;  1Q7Y C;  2OT2 A;  2VB2 X;  5K36 H;  3HOX G;  1PH4 A;  1WD0 A;  4DK6 C;  3TP5 A;  5E4X A;  4DV4 Q;  2JXM B;  1MSG A;  5M3F G;  2C5C A;  2B2U A;  1LAC A;  1I4X A;  2VUM G;  3GD7 A;  3FVQ A;  4JOI A;  4QL5 A;  2WAQ G;  1IW7 D;  4PMW A;  3PO2 H;  4DXG A;  1VQJ A;  1HTP A;  2M9V A;  1IBM Q;  1PZI D;  4ALP A;  4HIO A;  1JWM D;  2VQF Q;  1QUQ B;  1D2B A;  2FJ2 A;  5D3D A;  2R93 B;  1X54 A;  3H91 A;  1IW7 C;  1NR4 A;  1EY7 A;  3R2T A;  1ZXT A;  4DV5 Q;  2L5T A;  1DOM A;  3D4R A;  3J81 j;  1Z6H A;  4IOC A;  1UE7 A;  3G7L A;  3Q0A A;  4X3K A;  3JAM c;  2UUA Q;  1Q86 C;  1ILP A;  1ENF A;  1Q46 A;  5CYU A;  5E7N A;  4JV5 Q;  2ALY B;  1PRT B;  2D62 A;  4ZLT F;  5DNF A;  2CKZ B;  5LHY 1;  2Z1C A;  2F0U A;  1L1O C;  2RDG A;  2XIW A;  1Y1W B;  3K7A B;  1I4H A;  4RHR A;  4C3I B;  1CA5 A;  4UPA A;  4EQP A;  4BXX H;  2L55 A;  3MEH A;  1IKM A;  2D2C C;  3DM1 A;  1G6Z A;  1B9M A;  3BG3 A;  2EIF A;  3MXG A;  4YWM A;  1KDB A;  2BOS A;  4I7Z C;  5EPJ A;  4N8F A;  4JBM A;  4HN7 A;  3MVV A;  1UUP A;  1K0R A;  4DR3 Q;  3A55 A;  3HZX A;  2TMP A;  3S9W A;  1K8O A;  3TBI B;  2LKV A;  3HOW H;  4HSP A;  5AJ3 Q;  1MJE A;  4GS3 A;  1TWF H;  4MHE A;  3F8T A;  2L0C A;  4DXF A;  3J80 E;  2NVT H;  1XX8 A;  5F2D A;  5COR A;  1MGS A;  3BDO A;  2MO1 A;  1E0B A;  1ZYR D;  1OTC A;  1BXT A;  4BBS B;  4F8M A;  3I56 A;  4U67 3;  4NMZ A;  1B1Z A;  4DGZ A;  1ONL A;  1K8G A;  3SVM A;  4KV6 A;  4NKL A;  5HGQ A;  3J81 c;  3H3V H;  4XQN A;  3A8K E;  4BY7 G;  1Z47 A;  4C2M B;  3S1N H;  3PO3 B;  1ZYR C;  5J39 A;  5GAH C;  4RKB A;  3QB3 A;  1STE A;  3KLR A;  4PZ7 A;  4EQN A;  1PZJ D;  2B2Y A;  3VA7 A;  4DK1 A;  2QIL A;  2P5Z X;  2K04 A;  4KK7 A;  1B8A A;  3C3L A;  4KTA A;  4RCN A;  1FJG L;  2IPK D;  2N3S A;  1DXM A;  2YYZ A;  2HIX A;  2K75 A;  3CKI B;  2WFW A;  1PH6 A;  3I90 A;  5IWA L;  2CVR A;  1SFO B;  1Y1W G;  1SMY D;  4K5V A;  1GM5 A;  4R4I A;  4B3T Q;  4C3I G;  1STH A;  1XNQ L;  4TVA B;  3PCO B;  2QF7 A;  3ND9 A;  2QDL A;  4KN7 C;  3F2C A;  4FF4 A;  5IGF A;  1PLF A;  1NBW A;  3F1Z A;  4B9W A;  2SOB A;  4LUZ A;  1SMY C;  3G6J B;  3ZYY X;  2Z4I A;  1HHV A;  3NUC A;  1EU4 A;  1RCV D;  1SYG A;  1GUT A;  1S3O A;  4ZRZ A;  1QWY A;  3TME A;  4UHV A;  2N88 A;  3N6R A;  3UDI A;  2MJ8 A;  2PMZ E;  2Z8L A;  1VQH A;  4APV A;  2JA8 H;  1VQ4 A;  2D0P A;  3KF6 A;  1STG A;  1YBY A;  1I4R A;  3JAM L;  4OON A;  4BBS G;  3RNU A;  4K8I A;  2RHS B;  4IFD J;  4LF4 L;  1B50 A;  2F0D A;  2UU9 Q;  2EJF C;  3SK6 A;  1GUG A;  2OEO A;  4HMJ A;  1XYI A;  1V9P A;  3CCJ A;  1CHQ D;  4JI5 Q;  3A74 A;  5E1F A;  4JG2 A;  5C3E B;  4X64 Q;  1AP0 A;  1SEB D;  5IGC A;  3RLN A;  4KI0 A;  3J80 i;  3IL8 A;  4WOR A;  1YJW A;  1YHB A;  5IGG A;  4HJA A;  5LL6 X;  2NZO A;  3T1Y L;  2BH2 A;  1IXR A;  4BA1 I;  2Q2U A;  3OTO L;  5BN5 A;  2L15 A;  4RAU C;  4JI3 Q;  1CM9 A;  1Y14 B;  4B3S L;  1A0I A;  5ISR A;  1LLR D;  4L6T B;  1X56 A;  1IYV A;  2Z6B A;  1Q81 C;  3STB D;  1HNZ L;  1SNM A;  2PO4 A;  4HJ7 A;  4J15 A;  3PV0 A;  2LXJ A;  1D1K A;  5J3B A;  4A3D B;  3M85 A;  4B08 A;  2JA7 H;  3EA6 A;  1HZB A;  4ABN A;  2C35 B;  1N32 Q;  1OXT A;  2JA8 G;  3MC0 B;  2KEE A;  3STB C;  1IYJ B;  3GTJ B;  4IFD I;  3KF8 A;  3NTH A;  2A5H A;  5M5X H;  2SNS A;  3KYH C;  3UI2 A;  4GOP A;  1EIY B;  1PXU A;  1Q90 A;  1JC7 A;  1PYB A;  4RA8 A;  1TY2 A;  4JI6 Q;  1BCP F;  2JA5 B;  3J81 L;  1GHK A;  2GN5 A;  1DYQ A;  3I3C A;  4LUO A;  4CJ2 C;  5C4X B;  1WTQ A;  4BWG B;  2YU9 B;  1TWA H;  4AQY Q;  1UAP A;  4RH6 A;  1VQ8 A;  3KK7 A;  2MP1 A;  3G71 A;  2NVQ H;  3U9O A;  1Y8P B;  2EVB A;  2WB1 B;  3FKI H;  1GXD C;  3I73 A;  4A3E B;  1SYB A;  1WTH A;  4A3F H;  2R7Z H;  3OSO A;  4KKT A;  5C3E G;  2UXD L;  1JE5 A;  2R7F A;  4MZ9 A;  1R9T B;  1FR3 A;  4RCO A;  2HCC A;  4IUN A;  5J1Z A;  4YHH Q;  4NXN Q;  2F0T A;  4QF4 A;  3S15 H;  5C4Z A;  2EYF A;  4DV3 Q;  1KAW A;  1N8R C;  1NNX A;  4JCV E;  1YJ9 A;  5C44 B;  1RHP A;  1XMQ L;  3E0J A;  3G6E A;  1PFM A;  1IBK Q;  1HUN A;  3OPO A;  4CKB A;  4FF2 A;  1W3S A;  2AQ3 B;  4QIW E;  3T56 B;  4A3C H;  5IE8 A;  3S1Q B;  3TDQ A;  1NMG A;  1JQY D;  1PTO D;  3QO2 A;  3I4O A;  3U50 C;  4KKS A;  4X3U A;  4H7B A;  1RL2 A;  5FO7 B;  3C1F A;  4A3J B;  3W5O A;  1H9K A;  2K32 A;  2K5H A;  1X3E A;  2WKD A;  2A6E D;  3QJY A;  4YWK A;  5C4J H;  4GN5 A;  4X62 L;  4A3L H;  4ID6 A;  1GKH A;  2X6G A;  5G3L F;  4HID A;  2DJG C;  2UXB L;  3NBH A;  1EQT A;  1EWC A;  4E6I A;  2A6E C;  2MPM A;  1SSO A;  1OO9 B;  2F0M A;  3RZO H;  1B7Y B;  2RF4 A;  3M4O H;  1PH5 A;  4LW1 A;  2XRS D;  3CQZ B;  4BY1 B;  4HAE A;  1VS0 A;  5JEA J;  5M5Y B;  4GNX B;  4A93 B;  2RKS A;  3M9B A;  2SEB D;  3TS2 A;  1LT5 D;  1HFN A;  3KOJ A;  2K03 A;  4X65 L;  2SDF A;  1NMF A;  5IYC H;  4A3C G;  5GQO A;  2KCN A;  3S1R H;  1EYD A;  5LMN W;  1TWG B;  1BBX C;  1UE5 A;  3L9A X;  2A74 C;  5IYD H;  1BDO A;  5C44 G;  2VXW A;  4ZKC B;  3SXH A;  4OX9 Q;  5JPM C;  4GKJ L;  4Z9C B;  5ELB A;  3TSS A;  1GUS A;  1WVL A;  3ONA B;  4RKL A;  5EGT A;  4JI0 L;  1BKB A;  4DUY Q;  4GKK L;  1I5F A;  3RZD B;  1RJT A;  2NN6 H;  2PYK A;  3CMA A;  4ZAI A;  1IHZ A;  3GV3 A;  1I6H H;  4MN3 A;  1LTL A;  3DMU A;  4A3J G;  4X3T A;  4DNI A;  4JI8 Q;  4PZ8 A;  1NUC A;  2IHF A;  2F0P A;  2J4X A;  1KNA A;  1BO0 A;  2DNC A;  4DV1 Q;  1G8Z D;  4C3H B;  3HOV H;  3K8A A;  4C56 C;  1S5F D;  3K5M A;  5HY6 A;  2Q2H A;  1LUZ A;  1H9S B;  4G7Z C;  2AHO B;  2EE1 A;  4CJ1 B;  5J22 A;  1EIH A;  2Z9H A;  3NK9 A;  3HOU B;  1KD1 C;  1WYD A;  4LF8 Q;  3I8Z A;  4BBR B;  4FNF A;  3T1H Q;  4LMQ D;  5KEE A;  4C3J H;  4K0K L;  3VYU A;  4FDB A;  4BY1 G;  3KJO A;  1TQO A;  1NE3 A;  1A63 A;  2YTY A;  3GTM H;  1TS5 A;  3VYT A;  1AH9 A;  2A19 A;  1VQP A;  4K2K A;  1FYC A;  3VR4 A;  3TP6 A;  4JI2 Q;  5D3I B;  5LMU Q;  3NWT A;  1BQQ T;  2PW7 A;  2CH4 W;  2D0O A;  1N36 L;  1STA A;  2DY7 A;  5T1I A;  1ESR A;  2E75 C;  1N33 Q;  1II3 A;  4IUT A;  1H9R A;  3K59 A;  1L1O A;  2HHH Q;  3P1H A;  4OXP A;  1FVI A;  3A56 A;  4A4I A;  4CDD C;  1WTW A;  4LF5 L;  3BZC A;  1IBL L;  1Y1V B;  1UE1 A;  1V43 A;  3BZK A;  1J8I A;  1K0S A;  2ES2 A;  5DEH A;  3K80 C;  2EXZ A;  1XNR Q;  3NWS A;  2YV5 A;  2K7V A;  1U9R A;  4BA2 I;  3HOV G;  1TWH B;  1VQN A;  3HOZ B;  3D4W A;  2PMZ B;  3UDF A;  3I4N H;  2OTJ A;  1BUV T;  3CCR A;  3K6O A;  3H6M A;  1J5E Q;  4JI4 L;  4OO1 H;  1RTO A;  2R92 H;  2B39 A;  5JJK A;  4MTK A;  4POG A;  1TY0 A;  5JJI A;  2E2H B;  1YIJ A;  1D1I A;  3S14 H;  4C3H G;  1UEA B;  2JJQ A;  1MI2 A;  2LY7 A;  3A0J A;  3DEP A;  3CC4 A;  1ICF B;  2A1A A;  4L5S A;  5NUC A;  2NB0 A;  4FF1 A;  3HOU G;  2PQA A;  4IPC A;  1MKH A;  1VQG A;  5IIF A;  4NXM L;  5JOB A;  4UDU C;  3NBI A;  1JJG A;  5DLQ E;  1C48 A;  2K5N A;  3WOF A;  2TSS A;  1I6V C;  3I70 A;  1Z9F A;  4QUF A;  4RGM A;  2EPB A;  5EPL A;  4DNT B;  4JYA Q;  4G7H C;  3GTP H;  4LAA A;  4RGT A;  2BA1 A;  1WTV A;  2B63 H;  3NTI A;  1QVF A;  2GVB A;  4TRD A;  4DV6 Q;  3I4N G;  3OWF A;  3K57 A;  1EOV A;  2FFK B;  2LXK A;  1VQ6 A;  4P74 A;  1V1P A;  2R92 G;  1CTM A;  1UNS A;  2A68 D;  4JC0 A;  3H15 A;  2LSS A;  3HOZ G;  3KLS X;  3FDT A;  2K05 A;  3LX0 A;  3GTQ H;  3J7A 5;  3S1M B;  3L7Z C;  4FXG C;  2H1E A;  2ZXP A;  4M1U B;  1U4P A;  1QOH A;  3OOC A;  5M5W H;  2FMC A;  2A68 C;  2IX1 A;  1WJJ A;  1HH2 P;  3S16 H;  4CDC C;  3MTS A;  4XYO A;  5FLM G;  1SMX A;  1RKN A;  1JB3 A;  3CC2 A;  3U9S A;  1PH1 A;  4DV2 Q;  2EYO A;  3QIA A;  1K3R A;  1CUK A;  2CH4 A;  4DR6 L;  1KHI A;  2F0Q A;  2L1B A;  1PRT D;  2B8F A;  3PQI A;  1WTR A;  1KC8 C;  2NVX H;  1AZQ A;  1KTK A;  3NPP A;  2B63 G;  3PO2 B;  1QIL A;  2H5X A;  5EPK A;  3O13 A;  5LMN Q;  3TZU A;  2F3V A;  2O5I C;  5EKL A;  5IYB H;  4GLA C;  1EY0 A;  1PRT C;  2JYO A;  4K14 A;  4EGV A;  5KND A;  3UDG A;  1STB A;  4OWW B;  3HKZ E;  2FIN B;  3MWY W;  1E22 A;  4P75 A;  3W2D A;  4KHZ A;  2Y0S B;  2ZTD A;  5E3F A;  1FL0 A;  1CKN A;  3U4V A;  4K2L A;  5I4D A;  2A69 C;  2K5D A;  3SDZ A;  1Q3L A;  4UP8 A;  5IGB A;  4WFN 3;  1W6K A;  3TRZ A;  4LFB Q;  3JC6 6;  4B3M L;  4HED A;  1E2V A;  3AEV A;  1HR0 Q;  5EJW A;  1K3B C;  4X66 L;  4BY7 B;  5BR8 L;  1GO3 E;  3CAM A;  1DD2 A;  2IY5 B;  4NW2 A;  3K0Y A;  1HRJ A;  3ULL A;  3BDC A;  3BU2 A;  5CMD A;  4HCS A;  1QCB D;  4N8X 1;  1SLJ A;  4DV7 Q;  2CW0 D;  4O2D A;  1YEZ A;  2PCF B;  3KUP A;  3VR6 A;  1LTA D;  4OO1 I;  3M7G A;  3MXN A;  3SEB A;  1MSH A;  3H3V C;  1EIF A;  2WAC A;  1VQL A;  1UEB A;  2SNM A;  5K36 G;  2CW0 C;  3AB9 A;  3HOW B;  1B9N A;  1O7I A;  1S72 A;  5IGD A;  1TWF B;  4XQJ A;  4IFD H;  2NVT B;  4YWL A;  1HNX L;  1EUJ A;  3PO2 G;  4HMI A;  3NEL A;  3TN2 A;  3VA5 A;  1I3Q B;  3J7Z C;  1E7Z A;  4DR1 L;  1XMO Q;  3DWP A;  1EOT A;  2ENB A;  1EFW A;  5FK9 C;  3T13 A;  4JI7 L;  3T51 B;  4JI1 L;  2QEX A;  1VF5 C;  2VQE L;  1HTL D;  4HJ8 A;  2KVM A;  3F2B A;  3BDL A;  4KHV A;  1CHP D;  1D6E C;  4ODG A;  2Y0S G;  4PV1 C;  4EX5 A;  3S1N B;  2QKI C;  4UP7 A;  2GA4 B;  1F77 A;  2VS1 A;  4MNO A;  4AYB E;  4LFC L;  4IOA A;  1BBW A;  2ZM6 L;  1DM0 B;  4FO2 A;  5I9O A;  1VQ5 A;  4A3G H;  4Q5V A;  1CA6 A;  2IT1 A;  5DAU A;  3A8J E;  1A3T A;  2F0L A;  1OXS C;  5DM7 3;  1PV4 A;  4G7O C;  5I2X A;  2NYZ D;  3LNN A;  1CFM A;  3AMU A;  5ELC A;  1BBU A;  1X6O A;  3MZ5 A;  4P72 A;  2F1M A;  2ICI A;  4L5T A;  4DPG A;  2HD3 A;  2R3Z A;  2F0S A;  4BXX G;  3TQY A;  2DY8 A;  5CBA E;  4NB3 A;  1S5C D;  4K5W A;  1HNW Q;  2X69 A;  1LTT D;  1M1K C;  4IFD G;  2F4V Q;  5I6Y A;  4A3M H;  1A2U A;  2EY2 A;  3E3X A;  5K5P A;  3I4M H;  4U68 A;  2HDL A;  1AZP A;  1UWV A;  2ZJR A;  4IUV A;  3NHH A;  4DF7 A;  2EJG C;  2KEC A;  3L0O A;  3HOW G;  1LT6 D;  5C0X J;  2G9H D;  1YNN D;  3IKJ A;  2JN4 A;  4JBW A;  1L2F A;  4C2M H;  2JA8 B;  1EQR A;  3M3Y H;  1SBB B;  3P7J A;  3CU7 A;  1R4Q B;  3K7U C;  4N9P A;  5CR3 A;  1YNN C;  3P75 A;  1SE3 A;  3BYT B;  2Q8I B;  1CI3 M;  4A3G G;  1F2Z A;  1MIU A;  2WV6 D;  2ZXO A;  1X3G A;  1A3U A;  3DM3 A;  5ELD A;  1F9Q A;  1TII D;  3X3M A;  1X9N A;  3BYY B;  3M4P A;  4RWS C;  5EAY A;  1EFI D;  2UUB L;  4C1N I;  4CHT B;  2NVY B;  4DAY A;  4PG3 A;  2KJX A;  3C1E A;  4KMU C;  3I7F A;  1N34 L;  4YCW A;  2IW3 A;  2PPB C;  4DR5 L;  5CV6 A;  3IFT A;  4KHP L;  1PTO F;  2XWJ B;  4CBV A;  4A3M G;  3KLS A;  3T53 B;  5DM6 3;  5D65 A;  4A3I H;  1SE2 A;  5C0X I;  1SE8 A;  3I4M G;  3FEW X;  2NBF A;  5KIX A;  1JOQ A;  2K5V A;  3KBX A;  4DUZ L;  2JE6 I;  1QJO A;  4JVZ A;  2KCM A;  2ZTE A;  4DK0 A;  1SNQ A;  1VQI A;  3R2I A;  3KDF A;  3K5O A;  3ERQ A;  4TQU S;  3DWA A;  1SND A;  5FO8 B;  5IT9 E;  3ICE A;  5GAE C;  2UUC L;  4ZQ3 A;  2KHI A;  3HRZ C;  1YNJ D;  2M00 A;  4ZUJ A;  4JBK A;  4ULL A;  1Q1B A;  2I07 B;  5M5X B;  2LMC B;  2B2W C;  4DR4 L;  1H9M A;  1KNE A;  5A2Q L;  1B3Q A;  2LFN A;  1F9R A;  1YNJ C;  4YY3 L;  1PYS B;  1LTG D;  4QQB X;  5JEA H;  3CCU A;  3CRL C;  2NWG A;  3CCM A;  3HS0 C;  1SRU A;  3SK5 A;  3N52 A;  1TWA B;  4R4O A;  4LF9 L;  4J1M A;  1VQC A;  1A8V A;  2RDF A;  3NE5 B;  1I94 L;  2NVQ B;  5EBD A;  1KDC A;  2WKC A;  1SYC A;  3FKI B;  1PYW D;  1VQ9 A;  2WAQ E;  2HDM A;  2V4D A;  4IUU A;  2F3I A;  4A3F B;  5H1S E;  2R7Z B;  3B6Y A;  3OIQ A;  1EWI A;  3PIO 3;  4A3B H;  2MQH A;  1GUW A;  4IO9 A;  2K50 A;  1MD2 D;  5D14 A;  1GUO A;  2PQE A;  4L5Q A;  2XN9 C;  1JCK B;  2IWH A;  3BZD B;  1EL0 A;  3J81 E;  3T4A C;  2Z0S A;  3S15 B;  1YHQ A;  2H4O A;  3GTG H;  1I4G A;  1FJG Q;  4CDE C;  1LTR D;  2E2D C;  2JSO A;  3MXU A;  1NJI C;  2PZT A;  4QMG A;  1NSN S;  5IWA Q;  1PFS A;  4JPB W;  3QOL A;  1DOK A;  1QNU A;  3D8G A;  1CT1 D;  1T9H A;  1XNQ Q;  1W2B A;  3U4Z A;  3VR3 A;  3HP3 A;  3HEJ A;  4R4T A;  1C4Q A;  2QA4 A;  2MUY A;  2Z4H A;  5CV5 A;  4XYQ A;  3L2P A;  4LFA L;  3L3O C;  1Y69 U;  2JA7 G;  1PH9 A;  1TXY A;  3V96 A;  4DR2 L;  3OMG A;  4DV0 L;  4KY6 A;  5JEA G;  5C4J B;  2R7D A;  1P16 A;  2KA7 A;  2E76 C;  2L4N A;  4HIK A;  5GAD C;  5KYI A;  1U5K A;  1EIG A;  1EY8 A;  1I50 H;  5CC4 A;  4GNX C;  2IX0 A;  3LGJ A;  2E2J H;  4B3R L;  4FYD A;  4X6A H;  4ZCK A;  5LL6 S;  3NP8 A;  2E5L L;  4H13 C;  4HSV A;  2RSN A;  4EQ5 A;  2AKW B;  1L0W A;  1IL8 A;  5FJ8 H;  3RZO B;  2O4X A;  5FLX E;  2NUC A;  1Q8K A;  2EYP A;  5JVG 3;  2F03 A;  3M4O B;  2XNA C;  3FKI G;  3H0G H;  4LF4 Q;  2ZTC A;  3QR8 A;  1K28 A;  3U58 A;  5KGU A;  4A3F G;  5IOD A;  2I0Q A;  2R7Z G;  1F9S A;  1LAB A;  4MIU A;  1SJH D;  2AQ1 B;  1D5X C;  4IUP A;  1E24 A;  2JK8 A;  1XNR L;  3OWE B;  3S17 H;  2KED A;  3S1R B;  5ELO A;  2HUG A;  1YIT A;  2B29 A;  2KEN A;  5FO9 B;  3T1Y Q;  3DHQ A;  1E2Z A;  1WD1 A;  3DLL A;  4DR7 L;  4JW0 A;  3OTO Q;  1F2L A;  4B3S Q;  1HQM C;  3MHB A;  3NQT A;  1HNZ Q;  1HXY D;  4OIJ A;  1BOS A;  4F87 A;  1X65 A;  2PNH A;  1I6H B;  2E2I H;  4P73 A;  2F0K A;  1TWC H;  5C5M A;  3TEH B;  3J81 i;  3CC7 A;  2MFI A;  1BVS A;  2DUD A;  3ERO A;  1Q12 A;  3IAY A;  1QUQ A;  1TT2 A;  2N55 A;  3GTO H;  3A5U A;  4Q0F A;  1NAP A;  3I2Z A;  4A3L G;  3S24 A;  3EVQ A;  2HT1 A;  2PI2 A;  2QW7 A;  3HOV B;  3MFY A;  3HKZ G;  3H0G G;  2RA4 A;  1NY4 A;  1K83 H;  1SNC A;  1QZH A;  2EY6 A;  1D7Q A;  2IJ0 A;  3WOE A;  1AFP A;  4AYB B;  1PTO H;  2I5H A;  1C7Y A;  3S2H H;  1RIP A;  4H0L C;  2A73 B;  1JOR A;  1BF4 A;  2RHQ B;  4IPH A;  4BS9 A;  3UE0 A;  1G2S A;  1ESF A;  2F0J A;  1YI2 A;  1ICW A;  4QJF A;  1XPO A;  2K4K A;  4CJ0 B;  2UXD Q;  4FF3 A;  5IYC G;  4LF6 L;  1EY5 A;  3PIO A;  5IYD G;  1AE2 A;  2OXP A;  5KRU A;  1BCP B;  3KF6 B;  3VYS A;  2N49 A;  3M4Y A;  1XMQ Q;  4LF7 L;  1B3A A;  3C46 A;  1CZW A;  3RN5 A;  4IAL A;  3CCV A;  2NN6 G;  3PUX A;  1SAP A;  4N9T A;  1QVG A;  1JE4 A;  1PH8 A;  2WIN B;  1UE6 A;  3I4N B;  2UXC Q;  1Y8N B;  1JR0 D;  3KFU A;  2R92 B;  4V0B A;  1A15 A;  2ZJP A;  2D5D A;  3CW2 C;  1V8Q A;  5M3M H;  2A8V A;  3S14 B;  4OEL B;  4X62 Q;  3DWQ A;  1RDP D;  4PNY A;  3T16 A;  2XGT A;  4G57 A;  2UXB Q;  2CQA A;  1PRT F;  3J7Y W;  1GD7 A;  2XVS A;  4DV4 L;  1LM0 A;  1A3V A;  2E74 C;  2JA6 H;  1WCM H;  4A3K H;  1G51 A;  4AYB G;  4LWC A;  1O7Z A;  2EDG A;  1SYF A;  4C3J G;  3MXP A;  1G91 A;  3TZD A;  3PUW A;  3CP0 A;  1CSQ A;  4HJ9 A;  1YZ6 A;  4OL7 A;  4RMF A;  4R8N A;  1Z7T A;  1Q1E A;  1IBM L;  2A6H D;  1AEX A;  1AN8 A;  4OIK A;  2VQF L;  1IZ6 A;  2X6L A;  3DXJ C;  3KF8 B;  5IP7 H;  4GOP B;  3OW2 A;  4X65 Q;  4IN3 A;  4DV5 L;  5C6A A;  2BDN A;  3EIV A;  1HJP A;  4L63 B;  2MO0 A;  1DZ1 A;  2A6H C;  4QUC A;  1TWH H;  2RSO A;  2B63 B;  4DNR B;  4IPD A;  1K9M C;  2UUA L;  4POF A;  1PDQ A;  1L0X B;  1EEI D;  4JV5 L;  1HZC A;  1DCZ A;  3MAQ A;  1SE4 A;  3R8B A;  3GO5 A;  4XIG S;  4GKJ Q;  4GLX A;  2J7Z A;  2EQS A;  2EY1 A;  4JI0 Q;  4GKK Q;  1SNP A;  3HOY H;  5AFW A;  1EEF D;  1F2M A;  1MHW C;  4HTH A;  1X3Q A;  3GTQ B;  1G6P A;  1VF7 A;  4XT3 B;  4OO1 G;  3MFG A;  1SN8 A;  4UP9 A;  1XJV A;  2Q2I A;  2G9D A;  2JA6 G;  1WCM G;  5M5W B;  1DGS A;  5C4H A;  1NTG A;  1MJC A;  2ICE C;  2OF1 A;  1CKM A;  1EY9 A;  4O1N A;  4DR3 L;  1B53 A;  1EYG A;  3S16 B;  1XWE A;  2K33 A;  3GTK H;  5I9P A;  3J80 c;  2LS0 1;  3A5Z B;  3HOX H;  1H95 A;  5AJ3 L;  4F88 A;  1KRT A;  3AFQ A;  5JJL A;  1STN A;  1TS2 A;  3ND8 A;  3PSI A;  5M3F H;  5JPN C;  1LTI D;  2CHB D;  2N8N A;  2XTI A;  2VUM H;  3CF5 A;  3PIP 3;  3CPF A;  4LJZ C;  4XTC S;  4K0K Q;  2NVX B;  1B2T A;  3MA2 B;  2B2V C;  4WJ3 M;  1HZ9 A;  5T1G A;  3CHB D;  4FXD A;  2WB1 E;  4YCU A;  3D3R A;  4XDX A;  4Y7N H;  1XTC D;  2F0W A;  3NBH B;  4K6D A;  1N36 Q;  2AUJ D;  1OXU A;  1RD9 D;  2JEA I;  3HOY G;  1GVP A;  4M8A A;  2BE5 D;  3LWE A;  3RLO A;  1EYC A;  4QIW B;  1D5M C;  1PVO A;  2A69 D;  4LF5 Q;  3S2D H;  1GHJ A;  1IBL Q;  2RCN A;  4KD3 A;  3SK8 A;  3WDN A;  1O78 A;  2YTX A;  1SXT A;  2BE5 C;  3E6Z X;  4B3T L;  3GTL H;  1FGB D;  2WP8 J;  1QNK A;  1U4M A;  2VY3 A;  4J6H A;  4JI4 Q;  2B2W A;  5C0X H;  5JJZ A;  2OQ0 A;  5CV9 A;  2XRQ D;  1ZEQ X;  3HG9 A;  2KUM A;  1CQF A;  3E0E A;  3Q8D A;  4NPS A;  2KOL A;  2QEJ C;  2VZA A;  3P20 A;  3VR2 A;  1P8L A;  3GQB A;  2F0I A;  5BN4 A;  1SNO A;  4KY5 A;  4J8Q A;  4NXM Q;  1KDA A;  3NSW A;  1M90 C;  1JB7 A;  1VDZ A;  4XXE A;  1IL2 A;  3BS1 A;  1I4Q A;  1X3P A;  4XQQ A;  4IPG A;  2UU9 L;  1A2T A;  3NEN A;  4XT1 B;  4JI5 L;  2MGS A;  2R93 H;  2DGY A;  5IYB G;  2F3W A;  3HFZ B;  4R4C A;  2QCP X;  5A35 A;  2FMM A;  4DAV A;  2L9H A;  4PMC A;  2RCF A;  4X64 L;  4BY7 H;  1CK1 A;  1JOK A;  4L5R C;  5ELF A;  3A8I E;  3CCL A;  1S4Z A;  1OXV A;  4OEM B;  3EQL C;  3D31 A;  2HQE A;  5IT9 c;  4QCL A;  4HR7 B;  5CV8 A;  4A3G B;  4JI3 L;  1F9P A;  3KBG A;  5C0X G;  4PQX A;  2DJF C;  1MBY A;  4FXK C;  1Y1W H;  3K7A H;  2BCO A;  4V19 0;  3KLW A;  3TS0 A;  4YIJ A;  3J80 L;  2HIV A;  4R9W A;  5KNB A;  4C3I H;  3NEM A;  2PZU A;  1EQV A;  1DOL A;  1Y8O B;  4C1N K;  4FVM A;  1YNX A;  2IL8 A;  1N32 L;  1HUM A;  1LO5 D;  1CKO A;  4GNX A;  1L1O B;  4Y52 H;  4RG1 A;  1XTD A;  4A3M B;  1ASZ A;  3I4M B;  4KD4 A;  1ML0 D;  3M4Q A;  1I3Q H;  3Q6S A;  3TRE A;  4JI6 L;  1TVX A;  2JA9 A;  3F2D A;  2BH8 A;  3EBE A;  2KHJ A;  3AFP A;  2R93 G;  3VDY A;  2EYJ A;  4K6L A;  2R6G A;  4DR6 Q;  1HA5 A;  3ZJY C;  1BR9 A;  4AQY L;  3NXW A;  1VQO A;  4R8I A;  1S5D D;  5GRO A;  4HJ5 A;  3M3Y B;  4BBS H;  3UE1 A;  2OQK A;  1A62 A;  3PIP A;  1PA6 A;  2I5L X;  3OYY A;  1I4P A;  1O80 A;  1PHJ A;  3PO3 H;  1PFB A;  4I65 A;  1WTP A;  3A7A B;  1CSP A;  4YHH L;  3FP9 A;  4NXN L;  1SJE D;  3X3N A;  3AQQ A;  1VQF A;  2KBN A;  2PQA B;  2IX3 A;  4DV3 L;  3ER0 A;  4L8J A;  1VQB A;  1VQE A;  3G4S A;  2BA0 A;  1X32 A;  3MEF A;  4GN4 B;  1L0Y B;  4WRD A;  1PH2 A;  4QB4 A;  2YTV A;  1IBK L;  4B3M Q;  2K28 A;  3I4L A;  5IP9 H;  1H9S A;  5IY0 A;  3DEO A;  1QB5 D;  1SFO H;  2NTS A;  5ELN A;  4X66 Q;  1K73 C;  5BR8 Q;  4A3I B;  3PF5 A;  1CZG A;  3OIP A;  3D6C A;  3SGI A;  1VQM A;  1BNZ A;  3RUZ A;  2BDO A;  3JAM E;  5FLX c;  2VB3 X;  3QWN A;  1K8M A;  4TSS A;  1KAA A;  1E3P A;  3FRP B;  3VR5 A;  5HGT A;  3QG1 A;  1VQA A;  1C0A A;  3ITP A;  1HPC A;  5TSS A;  2ASB A;  2B2T C;  3C2P A;  1V1P B;  2CFM A;  2Z6K C;  1FGU A;  2AWO A;  4CDF C;  4GN3 B;  2F0N A;  4H02 A;  1SYD A;  1T5E A;  2JA7 B;  1C8C A;  5JVH 3;  1PH3 A;  3PO3 G;  4O0A A;  2CCZ A;  5CV7 A;  1JT8 A; 
#chains in the Genus database with same CATH homology
 3CXC A;  3PF4 A;  2K5N A;  1HNX Q;  1WOC A;  1KQS A;  1HNZ Q;  2NVY H;  1Z9F A;  4UPA A;  1X65 A;  2PNH A;  4DR1 Q;  4BXX H;  2E2I H;  4OWX B;  2JA6 H;  4P73 A;  1TWC H;  4JOI C;  3TEH B;  3J81 i;  3CC7 A;  2MFI A;  4DKA C;  4JYA Q;  4JI7 Q;  2EIF A;  3GTP H;  4JI1 Q;  1BVS A;  2DUD A;  4YWM A;  5IP9 G;  5C3E H;  2VQE Q;  1HZA A;  1VQK A;  1Q12 A;  1QUQ A;  4JBM A;  1K0R A;  2BA1 A;  3A5U A;  4DR3 Q;  3I2Z A;  2B63 H;  3GTO H;  4A3L G;  3S24 A;  3RN2 A;  2PI2 A;  2HT1 A;  1QVF A;  3HKS A;  3HKZ G;  4LFC Q;  3HOW H;  3H0G G;  2GVB A;  5AJ3 Q;  2ZM6 Q;  1MJE A;  4KLK A;  4DV6 Q;  3I4N G;  4GS3 A;  1NY4 A;  4OX9 L;  1EOV A;  2B3G A;  1TWF H;  2LXK A;  3I55 A;  1VQ6 A;  1K83 H;  3F8T A;  1QZH A;  4P74 A;  1D7Q A;  2NVT H;  2R92 G;  3W1B A;  4YCV A;  2I5H A;  1C7Y A;  3S2H H;  2MO1 A;  4A3I G;  4JC0 A;  1RIP A;  4DUY L;  3H15 A;  1QVC A;  2LSS A;  3HOZ G;  2RHQ B;  3J7A 5;  3WWV A;  1OTC A;  3GTQ H;  3I56 A;  3L7Z C;  4HIM A;  4A3D H;  1U0L A;  4IPH A;  3K0X A;  1K8G A;  3UE0 A;  1YI2 A;  3EN2 A;  5HGQ A;  5M5W H;  2OWO A;  4JI8 L;  2IX1 A;  1CKN B;  4QJF A;  1WJJ A;  2K4K A;  3J81 c;  1XPO A;  3H3V H;  4BY7 G;  3GTJ H;  1Z47 A;  2UXD Q;  3S1N H;  1HH2 P;  3S16 H;  5IYC G;  5GAH C;  4DV1 L;  4LF6 L;  5FLM G;  1SMX A;  4PZ7 A;  3CC2 A;  3PIO A;  5IYD G;  1AE2 A;  1PH1 A;  2F52 A;  4DV2 Q;  2JA5 H;  1B8A A;  1FJG L;  2N3S A;  1QZG A;  1K3R A;  1CUK A;  2YYZ A;  3KF6 B;  2N49 A;  1XMQ Q;  2HIX A;  2K75 A;  5C4X H;  1XPR A;  3CCS A;  4LF8 L;  4DR6 L;  1KHI A;  2WFW A;  2YU9 H;  4LF7 L;  1PH6 A;  3T1H L;  5IWA L;  1Y1W G;  3H3V I;  3RN5 A;  1KC8 C;  1GM5 A;  2NVX H;  3JAM i;  4R4I A;  3CCV A;  2NN6 G;  4B3T Q;  3PUX A;  2MNA A;  2B63 G;  1XNQ L;  4TVA B;  3PCO B;  2H5X A;  5LMN Q;  1VQD A;  1QVG A;  1PH8 A;  3MXN B;  4A3E H;  3RR5 A;  1UE6 A;  3F2C A;  2UXC Q;  3CCE A;  5IYB H;  3F1Z A;  1NBW A;  4GLA C;  3KFU A;  4LUZ A;  3UDG A;  4JI2 L;  4OWW B;  3HKZ E;  5LMU L;  1R9T H;  4A3B G;  1E22 A;  4P75 A;  2ZJP A;  3CW2 C;  5M3M H;  2A8V A;  4KHZ A;  2ZTD A;  4P71 A;  4X62 Q;  1N33 L;  1FL0 A;  1CKN A;  4LUV A;  3U4V A;  2HHH L;  2UUB Q;  2XGT A;  1S3O A;  2JQO A;  4UP8 A;  3RLF A;  1JMC A;  4A3D G;  5C44 H;  2EXD A;  2Y0S E;  3UDI A;  3TRZ A;  2K52 A;  4DAM A;  1GD7 A;  4LFB Q;  2UXC L;  4DV4 L;  1N34 Q;  3JC6 6;  1LM0 A;  4B3M L;  3AEV A;  2KCT A;  1WCM H;  2I5M X;  2PMZ E;  4A3K H;  1G51 A;  1VQH A;  4APV A;  4AYB G;  4DR5 Q;  1SRO A;  1HR0 Q;  2JA8 H;  4WJ4 A;  4X66 L;  4KHP Q;  1VQ4 A;  5BR8 L;  4LWC A;  3S1Q H;  2D0P A;  1GO3 E;  3CAM A;  3KF6 A;  1YBY A;  3ULJ A;  2IY5 B;  3PUW A;  1KRS A;  2IHE A;  1CSQ A;  3CP0 A;  1YZ6 A;  4OON A;  4RMF A;  4HJ9 A;  4BBS G;  2PI2 E;  3ULL A;  3RNU A;  3BU2 A;  1Q1E A;  2RHS B;  4IFD J;  4LF4 L;  1IBM L;  4OWT B;  4DUZ Q;  2UU9 Q;  2VQF L;  2JA5 G;  1SLJ A;  1IZ6 A;  4DV7 Q;  1J5E L;  1V9P A;  3CCJ A;  4JI5 Q;  1WFQ A;  3KF8 B;  5IP7 H;  4A3J H;  4O2D A;  3A74 A;  1YEZ A;  5C4X G;  4GOP B;  3OW2 A;  4X65 Q;  4OO1 I;  2V1C C;  4JG2 A;  2UUC Q;  4X64 Q;  4DV5 L;  2N78 A;  3PGZ A;  3EIV A;  5GAG C;  1HJP A;  1EIF A;  3RLN A;  2MO0 A;  4KI0 A;  3J80 i;  1VQL A;  1UEB A;  1TWH H;  5K36 G;  1YJW A;  1YHB A;  4HJA A;  4IPD A;  1K9M C;  2WB1 G;  2NZO A;  2UUA L;  3T1Y L;  4POF A;  2BH2 A;  1IXR A;  4DR4 Q;  4BA1 I;  4JV5 L;  4A3E G;  1O7I A;  2Q2U A;  1HZC A;  1S72 A;  3OTO L;  2L15 A;  4YY3 Q;  4JI3 Q;  3GO5 A;  4R4Q A;  4XIG S;  2AWN A;  1JJ2 A;  4GKJ Q;  1Y14 B;  4GLX A;  4B3S L;  1B70 B;  1A0I A;  4YWL A;  5FJ8 G;  2VL6 A;  1D8L A;  2EQS A;  1X56 A;  1HNX L;  1EUJ A;  4JI0 Q;  3PO2 G;  1Q81 C;  4GKK Q;  3STB D;  3CCQ A;  1E1T A;  3CQZ H;  4LF9 Q;  1HNZ L;  3G48 A;  3NEL A;  4BY1 H;  3HOY H;  3PUY A;  1I94 Q;  5M5Y H;  3CD6 A;  3J7Z C;  1E7Z A;  3D0F A;  4HJ7 A;  4J15 A;  3PV0 A;  4DR1 L;  1XMO Q;  4A93 H;  1G6P A;  2LXJ A;  5J3B A;  3M7N A;  1EFW A;  3M85 A;  4JYA L;  4OO1 G;  2VNU D;  4JI7 L;  1SN8 A;  4UP9 A;  3W1G A;  2JA7 H;  1XJV A;  4JI1 L;  2Q2I A;  2QEX A;  2VQE L;  1HZB A;  1WCM G;  1DGS A;  2JA6 G;  1NTG A;  2C35 B;  4HJ8 A;  1OXT A;  3F2B A;  1N32 Q;  1MJC A;  1VCI A;  2JA8 G;  4QY7 A;  3STB C;  1CKM A;  1IYJ B;  2Y0S G;  4EX5 A;  4IFD I;  4DR3 L;  1EYG A;  1TWG H;  5M5X H;  2K14 A;  3KYH C;  4UP7 A;  4GOP A;  1EIY B;  1OXX K;  1PYB A;  2VS1 A;  4MNO A;  4AYB E;  4LFC L;  3J80 c;  3GTK H;  4IOA A;  3A5Z B;  3HOX H;  1H95 A;  1BBW A;  1YJN A;  5AJ3 L;  2ZM6 L;  4JBJ A;  4DV6 L;  4JI6 Q;  1KRT A;  3AFQ A;  3GDE A;  1VQ5 A;  4A3G H;  4PZ6 A;  5JJL A;  1HR0 W;  2GN5 A;  3PSI A;  2IT1 A;  4LUO A;  5M3F H;  3E9H A;  2OCE A;  2CWP A;  1OXS C;  1PV4 A;  2N8N A;  1TWA H;  2XTI A;  4AQY Q;  2VUM H;  3CF5 A;  2Q2T A;  3CPF A;  3RZD H;  1VQ8 A;  1BBU A;  4XTC S;  1X6O A;  3G71 A;  4K0K Q;  2NVQ H;  4P72 A;  4L5T A;  4DPG A;  2UXB Q;  4ME3 A;  3FKI H;  3CME A;  4BXX G;  3TQY A;  4NB3 A;  4LFA Q;  1HZ9 A;  4WJ3 M;  1HNW Q;  4A3F H;  3ERS X;  3UDX A;  2R7Z H;  1E1O A;  5C3E G;  2WB1 E;  4DR2 Q;  1J6Q A;  4YCU A;  4A75 A;  1M1K C;  2F4V Q;  4IFD G;  2UXD L;  1JE5 A;  4DV0 Q;  4A3M H;  2R7F A;  4DAY B;  4MZ9 A;  4Y7N H;  4LNQ A;  4C3H H;  3NBH B;  1N36 Q;  3I4M H;  1OXU A;  4R1J A;  1UWV A;  4YHH Q;  2ZJR A;  4NXN Q;  2JEA I;  4MTN A;  4IJL A;  3S15 H;  3HOY G;  1PH7 A;  3L0O A;  1GVP A;  3HOW G;  5C0X J;  3RLO A;  4AIM A;  4DV3 Q;  4DV2 L;  4A93 G;  1KAW A;  1N8R C;  1PVO A;  4JCV E;  1YJ9 A;  4LF5 Q;  3S2D H;  4JBW A;  4B3R Q;  3ULP A;  1XMQ L;  2AMC B;  3HOU H;  3G6E A;  1IBL Q;  1IBK Q;  2RCN A;  1L2F A;  2E5L Q;  4GOP C;  3E9I A;  4BBR H;  2YTX A;  4C2M H;  1W3S A;  4QIW E;  1EQR A;  4A3C H;  3M3Y H;  5IE8 A;  3K7U C;  2CQO A;  4B3T L;  1S40 A;  3KDF B;  3GTL H;  1NMG A;  2WP8 J;  5LMN L;  3U50 C;  3I4O A;  1AE3 A;  2QGQ A;  1LYL A;  4A3G G;  2VY3 A;  1RL2 A;  4JI4 Q;  1MIU A;  1V1Q A;  1X3G A;  3DM3 A;  3W5O A;  2K5H A;  1X3E A;  4YWK A;  5C4J H;  2HQL A;  2OQ0 A;  4GN5 A;  1A63 A;  1X9N A;  3M4P A;  5EAY A;  4X62 L;  4A3L H;  2JEB I;  3E0E A;  1GKH A;  3Q8D A;  2VW9 A;  4HID A;  2UUB L;  2CCZ A;  4NPS A;  3BJU A;  4PG3 A;  2UXB L;  4LFB L;  2VZA A;  3I7F A;  1N34 L;  1VQ7 A;  1KXL A;  1P8L A;  2E8G A;  1Y1V H;  4YCW A;  1HR0 L;  4DR7 Q;  1G29 1;  4DR5 L;  1C9O A;  4QGU A;  4KHP L;  4NXM Q;  4DK3 C;  4A3M G;  3RZO H;  1B7Y B;  4A3I H;  2CWA A;  5C0X I;  2RF4 A;  1M90 C;  1JB7 A;  1SE8 A;  3I4M G;  1IL2 A;  3HOZ H;  3M4O H;  1PH5 A;  3K81 C;  1EQQ A;  1WI5 A;  2K5V A;  4LW1 A;  4DUZ L;  4IPG A;  2UU9 L;  2JE6 I;  1VS0 A;  3NEN A;  5JEA J;  4GNX B;  2GVA A;  2KCM A;  2ZTE A;  3M9B A;  4DV7 L;  4JI5 L;  1VQI A;  3TS2 A;  3KDF A;  2DGY A;  3PUZ A;  5IYB G;  2R93 H;  3HFZ B;  4R4C A;  4TQU S;  3KOJ A;  4AH6 A;  4X65 L;  3ICE A;  1X55 A;  5GAE C;  2UUC L;  4BBR G;  2E2H H;  4X64 L;  4BY7 H;  2KHI A;  5M3M G;  1NMF A;  5IYC H;  4JBK A;  4L5R C;  2NZH A;  4A3C G;  5GQO A;  5FLM H;  3S1R H;  1OXV A;  2OTL A;  5LMN W;  3CCL A;  1Q1B A;  1UE5 A;  3D31 A;  5IYD H;  5IT9 c;  4DR4 L;  2ID0 A;  5C44 G;  4OX9 Q;  3IRB A;  1XPU A;  4YY3 L;  1PYS B;  4JI3 L;  4A3K G;  4GKJ L;  4QQB X;  4IJH A;  5C0X G;  3CCU A;  1Q82 C;  3CCM A;  1SRU A;  1Y1W H;  4UY8 C;  3K7A H;  3KLW A;  4JI0 L;  2ATW A;  1BKB A;  4R4O A;  4DUY Q;  1I5F A;  3TS0 A;  4LF9 L;  2HIV A;  1VQC A;  4GKK L;  1A8V A;  4C3I H;  1YVC A;  3NEM A;  3CMA A;  3CPW A;  1I94 L;  1I6H H;  1XMO L;  1X3F A;  1VQ9 A;  2WAQ E;  1YNX A;  1KL9 A;  1LTL A;  3AYH B;  5IP7 G;  4A3J G;  4A76 A;  1Y1V G;  2F3I A;  4DNI A;  1N9W A;  5H1S E;  1N32 L;  4JI8 Q;  1KIX A;  3B6Y A;  1CKO A;  4PZ8 A;  4GNX A;  1EWI A;  4A3B H;  3FHW A;  2MQH A;  1L1O B;  4IO9 A;  2IHF A;  4Y52 H;  2K50 A;  4RG1 A;  1XTD A;  4LF6 Q;  4DV1 Q;  1ASZ A;  4L5Q A;  3HOV H;  3K8A A;  2Z0S A;  3M4Q A;  1I3Q H;  4GLV B;  2Q2H A;  1LUZ A;  5HY6 A;  3TRE A;  1YHQ A;  4JI6 L;  2NN6 I;  1SR3 A;  2JA9 A;  3F2D A;  2BH8 A;  1JJC B;  3GTG H;  3EBE A;  2AHO B;  2KHJ A;  3AFP A;  1FJG Q;  2R93 G;  1YHA A;  3VDY A;  1KD1 C;  1WYD A;  4LF8 Q;  2R6G A;  4DR6 Q;  4LF7 Q;  3ZJY C;  4AQY L;  1NJI C;  1VQO A;  3T1H Q;  5IWA Q;  5GRO A;  1PFS A;  4C3J H;  4HJ5 A;  4K0K L;  4FDB A;  1ASY A;  3S1M H;  4BY1 G;  4BBS H;  3UE1 A;  1T9H A;  3KJO A;  1XNQ Q;  1NE3 A;  2OQK A;  3KJP A;  1W2B A;  1A62 A;  2YTY A;  3PUV A;  3U4Z A;  3PIP A;  1PA6 A;  4R4T A;  3GTM H;  2I5L X;  3OYY A;  1AH9 A;  2QA4 A;  2A19 A;  1VQP A;  3L2P A;  4LFA L;  1HNW L;  2JA7 G;  1PH9 A;  1TXY A;  4DR2 L;  1PHJ A;  2F4V L;  2Z6K A;  3PO3 H;  4JI2 Q;  4DV0 L;  2ZJQ A;  5JEA G;  5LMU Q;  2FXQ A;  2D0O A;  1N36 L;  1K8A C;  1CSP A;  2R7D A;  1P16 A;  3FP9 A;  4NXN L;  4YHH L;  4HIK A;  1Q7Y C;  1VQF A;  3AQQ A;  1N33 Q;  2KBN A;  2PQA B;  5GAD C;  1U5K A;  1L1O A;  3HOX G;  4DV3 L;  1I50 H;  1PH4 A;  4OXP A;  2HHH Q;  1FVI A;  3ER0 A;  4A4I A;  4GNX C;  4LF5 L;  1VQB A;  1VQE A;  3BZC A;  2IX0 A;  3LGJ A;  4DK6 C;  3G4S A;  2E2J H;  4B3R L;  4X6A H;  2BA0 A;  1IBL L;  3MEF A;  4GN4 B;  4DV4 Q;  1PH2 A;  1IBK L;  2E5L L;  2YTV A;  5M3F G;  4B3M Q;  5IP9 H;  1UE1 A;  5IY0 A;  1V43 A;  3BZK A;  1SFO H;  4EQ5 A;  2AKW B;  5ELN A;  4X66 Q;  1K73 C;  3GD7 A;  2VUM G;  4JOI A;  4QL5 A;  1L0W A;  2WAQ G;  5BR8 Q;  3K80 C;  5FJ8 H;  2ES2 A;  4PMW A;  1XNR Q;  2YV5 A;  3PO2 H;  3PF5 A;  4BA2 I;  1VQJ A;  3HOV G;  1Q8K A;  1VQN A;  3SGI A;  3FKI G;  3H0G H;  1IBM Q;  4LF4 Q;  3UDF A;  3I4N H;  1VQM A;  4ALP A;  2OTJ A;  2ZTC A;  3CCR A;  4HIO A;  2VQF Q;  1QUQ B;  3U58 A;  1J5E Q;  4JI4 L;  4A3F G;  1X54 A;  2I0Q A;  2R7Z G;  2R92 H;  5JJK A;  5FLX c;  4POG A;  5JJI A;  1YIJ A;  3S14 H;  4DV5 Q;  1E24 A;  1E3P A;  2JJQ A;  2JK8 A;  3J81 j;  1XNR L;  3S17 H;  3A0J A;  4IOC A;  1VQA A;  5ELO A;  3CC4 A;  1C0A A;  1UE7 A;  1YIT A;  2ASB A;  2B29 A;  3JAM c;  2A1A A;  2CFM A;  2KEN A;  3T1Y Q;  2Z6K C;  1Q86 C;  2UUA Q;  4L5S A;  1Q46 A;  5E7N A;  4JV5 Q;  1FGU A;  2ALY B;  2AWO A;  3HOU G;  2PQA A;  4GN3 B;  3DLL A;  2D62 A;  4H02 A;  4IPC A;  4DR7 L;  3OTO Q;  1MKH A;  1VQG A;  2CKZ B;  1PH3 A;  4NXM L;  3PO3 G;  4O0A A;  1L1O C;  1JJG A;  1JT8 A;  5DLQ E;  4B3S Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...