1HNZT

Structure of the thermus thermophilus 30s ribosomal subunit in complex with hygromycin b
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAVQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structural basis for the action of the antibiotics tetracycline, pactamycin, and hygromycin B on the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 37
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2000-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 1hnzT00
4JV5T 4LF5T 4KHPT 1XNRT 4JYAT 2UXDT 4NXNT 4B3MT 4DR5T 4K0KT 4DV0T 4B3RT 2VQET 4DV3T 4OX9T 4DV6T 4JI3T 1XNQT 4B3ST 2UUCT 4JI2T 4DR4T 4LF6T 2HHHT 4X64T 1N36T 4DV7T 4YHHT 4DV5T 2ZM6T 2VQFT 3OTOT 2UXBT 4LF9T 4JI4T 4DV2T 5LMUT 1HNWT 1N34T 1IBLT 4DR2T 5BR8T 1J5ET 4LF7T 2UXCT 2F4VT 4DR7T 4LF8T 4JI8T 4LFCT 1FJGT 4B3TT 2E5LT 4LFBT 4DR3T 1XMOT 1HNXT 3T1HT 4AQYT 4JI5T 3T1YT 4JI7T 4DR1T 4JI1T 4JI6T 2UU9T 1HR0T 4YY3T 4X62T 4DUYT 1IBMT 4NXMT 4DV4T 1N32T 2UUBT 1XMQT 4LF4T 1I94T 4X66T 5LMNT 4DUZT 4X65T 2UUAT 4DV1T 4DR6T 4LFAT 4GKKT 4GKJT 5IWAT 1IBKT 1N33T 4JI0T 1HNZT
chains in the Genus database with same CATH superfamily
2C5IT 4LMKA 2FJDA 3AE8A 3GMIA 3RYHE 4U2ZA 2JQKA 2YDSA 4ILBA 4DO0A 2BBJA 4LF5T 3IBPA 2XZEA 4QX7B 1XNRT 2LSYA 3AXJB 4JYAT 3LBXA 4YTNA 2UXXB 2XQ3A 4DV0T 1MMAA 1H7CA 1I6ZA 4ANJA 3UU3A 5HWXA 4K0UA 4A56A 3NZQA 4HWCA 4YSZA 5KXJA 3AA0B 1QLBA 1XDOA 3CX8B 1XWMA 2VL0A 4DV6T 2E9XD 4Z90A 2LM2A 5HWYA 4NIQA 4ZZBA 5JDGA 4JI3T 4IDNA 2J4GA 2YOEA 2NR4A 4C90A 5LGNB 2UUCT 2NTXA 4O4LE 3VU7H 1OEDE 4JI2T 3RRCA 3Q2MA 4F8HA 1SHZC 3ZN0B 5JQGE 2CXDA 4CN6A 3OBVE 2QA7A 2V7KA 2HHHT 1KNPA 3DP7A 4UELA 4C91A 1WRDA 3PURA 1G8XA 2I59A 2ODVA 4PJNA 1YD8G 3JAFA 4U7IA 3N2OA 5F8PA 4LF9T 5LYJE 3RIUC 4UR9A 1NWMX 5M4YA 3LDQB 2X9XA 2WY2A 4IIJE 3T8OA 3WAJA 3ZT7A 4HGAA 4QH5A 3RC3A 2Q9QC 4DR3T 5LHGB 3UU8A 2IMLA 4CI2B 4TV9E 1KNZA 3DJBA 3U78A 5HEJA 2M6BA 2HPJA 4HN9A 4H9OC 1HG2A 1T7SA 3VR8A 4EZHA 5FVLA 4HWDA 2IDOB 5JR9B 3IHRA 3C98B 2KT9A 3KV9A 4U2YA 3HL6A 4L9IA 5AQSB 5CB4E 2VASA 3N9OA 2YU1A 2K9AA 4I55E 1VRBA 5BR8T 4XZCA 1J5ET 2WU2A 3EHZA 2JQQA 3PU3A 4CI3B 2YU2A 3IEEA 2R6GF 4O4HE 3ZSSA 2F4VT 2MYSA 2Q9QA 2VKJA 4N78D 3PU8A 5JH7E 2D0TA 3VRAA 5LOVE 1MMGA 1MIYA 2K3WA 5AQFB 4B3TT 3AE5A 3NRXA 2CBJA 3I1AA 2HN1A 2YEVC 3ZT5A 5LMNT 5FXWA 1WLXA 2L3LA 3LSVA 3Q5XA 2GK9A 1XMOT 1HFAA 1QUUA 4UV8B 2WZIA 2NTYA 3C50A 1BR0A 1ZV4X 3HR0A 3T1YT 4JLEA 5L3BB 5JR9A 2A3DA 2CM0A 3RF1A 1AJ3A 3JAEA 2L8KA 4WBOA 5AQNB 3AVSA 2WSSV 5LG4A 2BBHA 3AB3B 3O1HA 4QX8B 3VHLA 1CHUA 2MPKA 1W09A 2SPCA 1JNRA 2W4XA 5AQOB 3VRBA 1BR1A 4GOUA 3ZMSB 4YJ2E 2UU9T 3GN5B 3NZPA 3AE4A 2X9HA 2JQHA 4DMWA 2BVLA 3AA7B 4QH4A 3V5SA 1X79A 4YY3T 3QC9A 4QHOA 3TLUA 1WYBA 3AA1B 3ZEFB 2Y48B 3SS1A 1IBMT 2N2NA 3EUHA 3RIUA 3PJAJ 2WM9A 1WFDA 1ZHCA 2CLYB 2V1DB 3LJCA 4HE8A 5AQLB 1S94A 4KUMB 4ADZA 4AQFC 5JDLA 1XMQT 4LF4T 1UX5A 2BG9C 2X0LB 3C4WA 3KV6A 4AIUA 4PAGA 4X1IE 2WB5A 2IC9A 2LT3A 1MNEA 4I43B 3N2GE 4FJOA 4BJNA 3ZN1B 2W67A 4DV1T 2UUAT 5LA6E 1WCRA 5IUXA 4LFAT 2JMHA 3LFMA 3QB5K 5JDNA 4GKKT 3FB2A 4JI4T 1NEKA 1UX4A 2LSJA 2N9DA 3HKBE 1HX8A 2KNDA 2EHOC 2DNXA 4WNKA 5ADXL 4GKJT 2XASB 2YK0A 5FY1A 5DJQC 3RLFF 1IBKT 3UU4A 3UU5A 2XQ5A 3HKEE 3ONJA 2Q9QD 2K5BB 1QSDA 1VCTA 2XQ7A 3JC6D 3P4SA 5J0ZA 1W9RA 3LK3B 4ILCA 1JNZA 5JREA 5LJMA 3N9MA 4ZI7E 1E2AA 3UUMA 2XPKA 5HXCA 2E9XA 3Q9DA 5JR9C 2XQAA 4NXNT 5EK4A 5CJ5A 2AE9A 2BKOA 2KZ7B 3A5XA 1YKEB 5E0OA 1E7PA 1J5WA 4DR5T 3ZJ1A 4E7SA 3ZT6A 5HYAA 2EHOA 4AKLA 5DABA 4EEDA 1I94T 4P1NA 4DR4T 4U3CA 5LB7B 3ZC1A 4OX9T 5TAOA 2XAJB 3AEBA 3TKLB 2D2SA 1G73A 4PJMA 4UF0B 2ACXA 2V6YA 4DBRA 3A7MA 5C3JA 4DMVA 1US7B 5GONE 4PW8A 5L4HA 2XJ7A 2X51A 4MFRA 3PUVF 2D9DA 2YDRA 2W00A 3PUZF 3Q5EA 2WMNA 3FZKB 3K3OA 5J1GA 3N9QA 2X0YA 1UGOA 2JQ9A 2YKSA 5H6QB 3PE0A 5L4EA 1MIVA 2ODUA 3HA4A 4PFOA 4X64T 4YHHT 4G63A 3RGLA 1ZEEA 2G0UA 2ZM6T 1Y01A 2VQFT 4CXXA 2CEAA 2UXBT 1KNRA 3KINB 4MALA 2WAUA 5LNKA 4HWFA 5FKYA 5LBQB 5L3FB 3AE2A 2WS3A 1SE7A 2X67A 3X1DA 5AQGB 3L09A 4I50E 5F5WA 4EOZB 3ZYLA 4Z8XA 4TN7B 5FP3A 1LKXA 1UK5A 4A97A 4KHPT 3KVBA 2HPLA 3S4UA 2KXPB 2NP9A 4ERRA 2ZM0A 2IUBA 2V7IA 4IE6A 1HNWT 2H88A 1N34T 1FMVA 1VCSA 2FBWA 1Z8UA 3NWIA 4AKHA 1IBLT 4DR2T 5A1LA 5CA0E 4LF7T 1N32T 4EXTA 5BMVE 5L3GB 4KHZF 4XBFB 3ANWB 1XDPA 2KINB 4LF8T 3MACA 2ZM8A 5HEHA 2BVMA 1IAPA 2MOZA 3AA6B 4TWDA 4ZI3C 2VKOA 4GK0E 5HCMA 3ZLIA 4A98A 4LFBT 2C5KT 3OPCA 1HNXT 2DCFA 3L8RA 4AKRB 3T1HT 3CVRA 2LRKA 2XSBA 3OYXA 4H9PC 3NVOA 2Q9QB 4JI5T 2WZHA 3CWZB 1OWAA 5LGUB 4PJLA 4GYRA 1OXZA 4JI7T 2B1EA 4P0BA 3MJXA 2QVAA 5DQVA 3UULA 2QYWA 3ZCIA 3EVYA 5AQIB 4O4IE 4HFCA 4X20E 4DR1T 3LK2B 1KFYA 4ZEYA 4KBMB 4TWFA 1FEWA 5HXEA 5LHIB 3H37A 2BG9E 1OEDC 2H7OA 3N5LA 3J9X1 4BJMA 1GQEA 4IREA 4TZ4C 1FJGT 3AE9A 2VVNA 3ZMZB 5J2UE 3LBXB 2LRLA 3ZCJA 3AXJA 4X62T 3ZMUB 1CUNA 3CKDA 4DBQA 5C8YE 3SFDA 3DTOA 4LMLA 1WR6A 1U4QA 4MLKA 3QK6A 3PUSA 3P50A 4I4TE 3CQCB 2DWGA 3RYIE 2WCAA 4YFSA 1BR4A 3ETUA 2PBIA 4ZS2A 4ZI2D 3B13A 3PUAA 2BS4A 2K24A 3HKCE 3M65A 2Z6EA 4PNIA 3BQLA 4ZS3A 4EIWA 1MIWA 2PG8A 4O8SA 5AQRB 4CN1A 5C2TA 2XY8B 2ZLYA 4WW0A 2D5UA 2DWKA 1MMNA 1R8IA 5CA1E 4DR6T 1N33T 4Z91A 2EHOB 5AQVB 3AE6A 3KV5A 2BG9A 2BS3A 3JCFA 3NRYA 3PJAA 3QB5A 3RKOA 4AISA 4EB6E 1IJ6A 3Q5DA 4JEHB 2RA1A 3AEGA 1ZOYA 3OYZA 4HFBA 3ZJ2A 5AQQB 3I9WA 5AQHB 4YT0A 5LHHB 2CXLA 3WAKA 3KVAA 3BQKA 5ABFA 2ACZA 5HCJA 4HWIB 3F31A 2RP4A 2LKHA 3PUWF 4GIWA 4MHCA 3ZYKA 4OHFA 5JVDE 3L39A 2L9QA 3EABA 4TNWA 1L0VA 4B6XA 4KX6A 2XQYA 3UUNA 4JEUB 4EZ4A 5L2LA 4JV5T 2LJLA 1D0XA 2W0GA 2J62A 2WU5A 3O1JA 3ABVA 4CXWA 2UXDT 2FJBA 2CLYC 2VK9A 2CA5A 1EZ3A 4PK5A 4EV6A 4ZZCA 3UT5E 2X9WA 3EDVA 4OK0A 3SFEA 2PFVA 3OVUA 5HXSA 4YXDA 5AQJB 4B3RT 5FMNA 3K3QC 3AAIA 2W2UA 4WBNE 3P4QA 2H7VC 4UVAB 2VQET 4IL9A 4DV3T 2WQYA 2V6XA 3FHNA 4HFEA 2XAFB 2DHRA 4WZXA 5JDFA 4DVDA 5KDMC 1J1JA 4QKNA 2WWVA 4U72A 3VKHA 3ZKRA 1XNQT 3RPUA 4AI6A 3N9NA 2K48A 3AEDA 3P4PA 4B3ST 2CHNA 4GK5E 4JBWF 3R6NA 2LHRA 5LGTB 4IE7A 5JDHA 3AVRA 4UEMA 3K3NA 2VWAA 2PTFA 5L47A 3O9XA 2FJAA 3RIAA 2KWIB 3OTOT 2AXDS 1KK7A 2H3RA 1T98A 2QRXA 3CQGB 2CPTA 2V26A 3A8YC 4YHJA 3RH3A 3RYCE 4ISSA 4U31A 1VOMA 4QH1A 5EZYE 2VB6A 3RKGA 2LM9A 3TLTA 4YJ3E 5AQUB 4P09A 4HEAA 1UCUA 4TX5A 4GYSA 2NWBA 2NW9A 4O2BE 4QXCB 5AQKB 2VURA 3AE3A 2PJQA 5ABFB 1S35A 2LKGA 1E1HB 2XQ4A 2D0UA 3JC6C 1D0YA 3MXZA 4U33A 2A9UA 4ASKA 4CXYA 3N2KE 4HFDA 4YLHA 1IJ5A 4H9NC 3VKGA 5ETWA 3N9LA 4G2AA 2EHOD 3ZYMA 3EAMA 4JUYA 4DR7T 4QWNB 4U7YA 1Z0PA 5LXTE 4ZI2C 4IE4A 4L5GA 4X1YE 2KWHA 1HF8A 2ZMAA 5LP6E 2DL1A 2KSRA 2V7JA 5LBMA 2E5LT 3V5UA 3AE7A 4KI0F 1HCIA 4AQYT 4PJJA 2ZM2A 3QNUA 2LLYA 5KMGP 1HTJF 4MBQA 5FXXA 2CE7A 4TUYE 3ETVA 1UURA 4FI5A 2VKDA 3SRZA 3AAEB 3Q5WA 4IL4A 2LOSA 3RQUA 3CX7B 5HEGA 4UIGA 1D1BA 1UUSA 2XQ8A 3P4WA 4IGUA 4CN4A 4KP3C 4HTEA 3UUXB 4DV7T 3U3IA 4JI6T 4HFVA 2NW8A 3I0QA 4UXNB 1HR0T 5JRCA 2BKNA 3FBLA 1U5PA 1FIOA 1LVKA 3PUYF 3O4XE 5FL0A 1W0BA 3G06A 3M3ZB 1T8BA 5F3JA 5LCYA 3ZMTB 2E9XB 3FZMB 3CPZA 3H3AA 4ISTA 1NAFA 4ILAA 2J1DG 3EI0A 2XM2A 3F2EA 4HKAA 4BA9A 1KEYA 2X9YA 3ANWA 4V1Av 3TLVA 3L3PA 4CQIA 1DU2A 2IIUA 3UU6A 3UUBA 4CZZB 5LG3A 2UUBT 2M67A 4O4JE 3I0OA 3KBTA 3FZFB 3LG7A 4YTPA 2JRKA 3O1IA 4WYVA 4OYKA 3P8CD 1X9BA 4KMCA 2VL8A 5AQPB 2CMRA 5KX5E 4DUZT 4YTMA 4X65T 2C0SA 2IAKA 1WR0A 2V6YB 2IHR1 3ONLC 3E0ZA 2A72A 4TWHA 2HN2A 2BDEA 4HWHA 5FY7A 2V5CA 1B7TA 4AQFA 1ZKEA 2YDQA 4PFPA 4EYYR 5JDQA 2VVSA 3UFGA 4EYUA 3FZHB 3IF8B 1YW0A 2YN6A 3BQIA 3QUJA 1Y64B 2JMKA 5L3EB 5EK2A 3RIFA 5IWAT 3R84B 2CCQA 2X66A 2OLTA 2XM1A 3NKZA 3W15B 5AFUL 4HFIA 4JI0T 1HNZT 1T72A 2CHOA 2BS2A 4H9SE 3ZMVB 5HEOA 2WDQA 4IDQA 3IA3A 4AKIA 2X68A 4EAHA 1W0AA 2N1GA 2XTLA 3PDYA 3SWHA 4K0KT 3FXEB 2WBLA 2A2FX 3C4ZA 2ES0A 2V8SV 5IHYA 5FVKA 3B57A 2LSGA 3C51A 1IZNB 4M1PA 4CI1B 5L3CB 1HG5A 3OJAA 3D0TA 1LRZA 3FXDB 4QXHB 1XZYA 3SOLA 1D1AA 1ZP0A 4IDOA 4IE0A 3ZPOA 4B3MT 2NW7A 4A5XA 4F6RC 4E7ZA 5L3DB 3J7Yq 1M7KA 1MMDA 2Y8DA 1YXRA 2NOXA 2KLQA 1BR2A 3AECA 2W63A 2MAWA 4LF6T 5DQWA 3RX6A 2W62A 2MTQA 2XAGB 4O2AE 2JPFA 4H9RC 1N36T 4DV5T 3MA9A 4OYJA 4EGWA 2XUEA 1WYCA 2CWOA 2OV9A 4P0AA 4IE5A 2I0MA 4ZXLA 2M6IA 2FUPA 2CRBA 2XQ6A 3KV4A 4UVCB 4YSYA 5JDMA 3UQ7A 4DV2T 3ZSTA 4YSXA 1SUMB 2LEHA 3FZLB 4J2CA 5LMUT 4AXPA 4EEBA 4PK6A 2X0HA 1KF6A 3GN5A 5ABEA 5JRCB 5CFBA 1LVFA 4L0RA 4X5TA 1YQ4A 2WDRA 3C64A 3E08A 2W61A 3QOFA 4LMJA 2HH7A 5CGMA 2MBGA 2V7LA 2LSKA 4Q25A 3AAAB 5HEUA 3CQXC 3K8PC 2UXCT 2CWYA 4IDPA 4DNDA 2WP9A 4NUVA 1YKHB 3PUQA 1FMWA 4NUUA 3UTKA 4JI8T 4LFCT 2C5JA 3RRWA 2WWUA 2LOPA 3MZKB 2RPAA 1D0ZA 4TV8E 2H89A 2LHNA 5FXVA 2V5DA 3UQ4A 4QXBB 3VR9A 4HFHA 3GA8A 3PV0F 3TLSA 3EDUA 2E5VA 4H9QC 5FNVE 3WI3A 2XHEB 5ABHA 3LK42 2V7MA 4OFZA 4PK4A 5AQMB 1M62A 5FXZA 2LSIA 2P9BA 2E2AA 2CBIA 4IT4A 1YQ3A 4U74A 4ZOLE 2BKPA 3CK6A 2B76A 3OKQA 2W66A 3FBZA 2XAHB 3AE1A 2KMFA 3B5MA 3ONXA 5H6RB 4JI1T 5HAXA 4UV9B 4AQGA 2Y6XA 5EK3A 2JJ9A 1MNDA 4XAXB 3F57A 4BAYB 4I0UA 1NENA 2BG9B 3P4RA 5J2TE 4DIDB 3RQWA 2CXFA 3C4XA 5AQTB 5FYMA 4X1KE 2DI4A 2BZBA 2QGSA 5FY0A 3RC8A 3RI5A 1SA0E 3H3MA 4DUYT 5LJNA 4NXMT 3UFEA 3ZC0A 4DV4T 2UXNB 4COFA 2E8IA 3GWHA 1OEDB 2FJEA 2YINA 2VKHA 2IW5B 3HI2A 3CMLA 3I9YA 1HS7A 1HX1B 2XQ9A 3NBXX 2LE8A 3AEFA 3MK7C 3E22E 4H63H 4ZI3D 3RHWA 5ABGA 5JTGA 4IHJE 3RYFE 4X66T 3K1SA 4H63V 4UF0A 2WMOA 4ZHQE 3PUGA 2JIWA 3P7IA 4ILUA 4AKGA 2J47A 2XAQB 2XSAA 3BK9A 3ESLA 2OA5A 3JADA 3PTRB 2DLRA 5HXRA 5HXHA 5IYZE 3CX6B 2WDVA 3AEAA 4TNVA 4UVBB 5FL1A 1O3XA 3TLWA 3KDSE 3HKDE 4NPPA 3N9PA 3CIRA 3PUXF 2E9XC 1V9DA 1OEDA 2I6HA 1D1CA 3AEEA 2IC6A 3KFWX 3MKDA 4IDZA 3KBUA
chains in the Genus database with same CATH topology
4JV5T 4LF5T 4KHPT 1XNRT 4JYAT 2UXDT 4NXNT 4B3MT 4DR5T 4K0KT 4DV0T 4B3RT 2VQET 4DV3T 4OX9T 4DV6T 4JI3T 1XNQT 4B3ST 2UUCT 4JI2T 4DR4T 4LF6T 2HHHT 4X64T 1N36T 4DV7T 4YHHT 4DV5T 2ZM6T 2VQFT 3OTOT 2UXBT 4LF9T 4JI4T 4DV2T 5LMUT 1HNWT 1N34T 1IBLT 4DR2T 5BR8T 1J5ET 4LF7T 2UXCT 2F4VT 4DR7T 4LF8T 4JI8T 4LFCT 1FJGT 4B3TT 2E5LT 4LFBT 4DR3T 1XMOT 1HNXT 3T1HT 4AQYT 4JI5T 3T1YT 4JI7T 4DR1T 4JI1T 4JI6T 2UU9T 1HR0T 4YY3T 4X62T 4DUYT 1IBMT 4NXMT 4DV4T 1N32T 2UUBT 1XMQT 4LF4T 1I94T 4X66T 5LMNT 4DUZT 4X65T 2UUAT 4DV1T 4DR6T 4LFAT 4GKKT 4GKJT 5IWAT 1IBKT 1N33T 4JI0T 1HNZT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JV5 T;  4LF5 T;  4KHP T;  1XNR T;  4JYA T;  2UXD T;  4NXN T;  4B3M T;  4DR5 T;  4K0K T;  4DV0 T;  4B3R T;  2VQE T;  4DV3 T;  4OX9 T;  4DV6 T;  4JI3 T;  1XNQ T;  4B3S T;  2UUC T;  4JI2 T;  4DR4 T;  4LF6 T;  2HHH T;  4X64 T;  1N36 T;  4DV7 T;  4YHH T;  4DV5 T;  2ZM6 T;  2VQF T;  3OTO T;  2UXB T;  4LF9 T;  4JI4 T;  4DV2 T;  5LMU T;  1HNW T;  1N34 T;  1IBL T;  4DR2 T;  5BR8 T;  1J5E T;  4LF7 T;  2UXC T;  2F4V T;  4DR7 T;  4LF8 T;  4JI8 T;  4LFC T;  1FJG T;  4B3T T;  2E5L T;  4LFB T;  4DR3 T;  1XMO T;  1HNX T;  3T1H T;  4AQY T;  4JI5 T;  3T1Y T;  4JI7 T;  4DR1 T;  4JI1 T;  4JI6 T;  2UU9 T;  1HR0 T;  4YY3 T;  4X62 T;  4DUY T;  1IBM T;  4NXM T;  4DV4 T;  1N32 T;  2UUB T;  1XMQ T;  4LF4 T;  1I94 T;  4X66 T;  5LMN T;  4DUZ T;  4X65 T;  2UUA T;  4DV1 T;  4DR6 T;  4LFA T;  4GKK T;  4GKJ T;  5IWA T;  1IBK T;  1N33 T;  4JI0 T;  1HNZ T; 
#chains in the Genus database with same CATH topology
 2C5I T;  4LMK A;  2FJD A;  3AE8 A;  3GMI A;  3RYH E;  4U2Z A;  2JQK A;  2YDS A;  4ILB A;  4DO0 A;  2BBJ A;  4LF5 T;  3IBP A;  2XZE A;  4QX7 B;  1XNR T;  2LSY A;  3AXJ B;  4JYA T;  3LBX A;  4YTN A;  2UXX B;  2XQ3 A;  4DV0 T;  1MMA A;  1H7C A;  1I6Z A;  4ANJ A;  3UU3 A;  5HWX A;  4K0U A;  4A56 A;  3NZQ A;  4HWC A;  4YSZ A;  5KXJ A;  3AA0 B;  1QLB A;  1XDO A;  3CX8 B;  1XWM A;  2VL0 A;  4DV6 T;  2E9X D;  4Z90 A;  2LM2 A;  5HWY A;  4NIQ A;  4ZZB A;  5JDG A;  4JI3 T;  4IDN A;  2J4G A;  2YOE A;  2NR4 A;  4C90 A;  5LGN B;  2UUC T;  2NTX A;  4O4L E;  3VU7 H;  1OED E;  4JI2 T;  3RRC A;  3Q2M A;  4F8H A;  1SHZ C;  3ZN0 B;  5JQG E;  2CXD A;  4CN6 A;  3OBV E;  2QA7 A;  2V7K A;  2HHH T;  1KNP A;  3DP7 A;  4UEL A;  4C91 A;  1WRD A;  3PUR A;  1G8X A;  2I59 A;  2ODV A;  4PJN A;  1YD8 G;  3JAF A;  4U7I A;  3N2O A;  5F8P A;  4LF9 T;  5LYJ E;  3RIU C;  4UR9 A;  1NWM X;  5M4Y A;  3LDQ B;  2X9X A;  2WY2 A;  4IIJ E;  3T8O A;  3WAJ A;  3ZT7 A;  4HGA A;  4QH5 A;  3RC3 A;  2Q9Q C;  4DR3 T;  5LHG B;  3UU8 A;  2IML A;  4CI2 B;  4TV9 E;  1KNZ A;  3DJB A;  3U78 A;  5HEJ A;  2M6B A;  2HPJ A;  4HN9 A;  4H9O C;  1HG2 A;  1T7S A;  3VR8 A;  4EZH A;  5FVL A;  4HWD A;  2IDO B;  5JR9 B;  3IHR A;  3C98 B;  2KT9 A;  3KV9 A;  4U2Y A;  3HL6 A;  4L9I A;  5AQS B;  5CB4 E;  2VAS A;  3N9O A;  2YU1 A;  2K9A A;  4I55 E;  1VRB A;  5BR8 T;  4XZC A;  1J5E T;  2WU2 A;  3EHZ A;  2JQQ A;  3PU3 A;  4CI3 B;  2YU2 A;  3IEE A;  2R6G F;  4O4H E;  3ZSS A;  2F4V T;  2MYS A;  2Q9Q A;  2VKJ A;  4N78 D;  3PU8 A;  5JH7 E;  2D0T A;  3VRA A;  5LOV E;  1MMG A;  1MIY A;  2K3W A;  5AQF B;  4B3T T;  3AE5 A;  3NRX A;  2CBJ A;  3I1A A;  2HN1 A;  2YEV C;  3ZT5 A;  5LMN T;  5FXW A;  1WLX A;  2L3L A;  3LSV A;  3Q5X A;  2GK9 A;  1XMO T;  1HFA A;  1QUU A;  4UV8 B;  2WZI A;  2NTY A;  3C50 A;  1BR0 A;  1ZV4 X;  3HR0 A;  3T1Y T;  4JLE A;  5L3B B;  5JR9 A;  2A3D A;  2CM0 A;  3RF1 A;  1AJ3 A;  3JAE A;  2L8K A;  4WBO A;  5AQN B;  3AVS A;  2WSS V;  5LG4 A;  2BBH A;  3AB3 B;  3O1H A;  4QX8 B;  3VHL A;  1CHU A;  2MPK A;  1W09 A;  2SPC A;  1JNR A;  2W4X A;  5AQO B;  3VRB A;  1BR1 A;  4GOU A;  3ZMS B;  4YJ2 E;  2UU9 T;  3GN5 B;  3NZP A;  3AE4 A;  2X9H A;  2JQH A;  4DMW A;  2BVL A;  3AA7 B;  4QH4 A;  3V5S A;  1X79 A;  4YY3 T;  3QC9 A;  4QHO A;  3TLU A;  1WYB A;  3AA1 B;  3ZEF B;  2Y48 B;  3SS1 A;  1IBM T;  2N2N A;  3EUH A;  3RIU A;  3PJA J;  2WM9 A;  1WFD A;  1ZHC A;  2CLY B;  2V1D B;  3LJC A;  4HE8 A;  5AQL B;  1S94 A;  4KUM B;  4ADZ A;  4AQF C;  5JDL A;  1XMQ T;  4LF4 T;  1UX5 A;  2BG9 C;  2X0L B;  3C4W A;  3KV6 A;  4AIU A;  4PAG A;  4X1I E;  2WB5 A;  2IC9 A;  2LT3 A;  1MNE A;  4I43 B;  3N2G E;  4FJO A;  4BJN A;  3ZN1 B;  2W67 A;  4DV1 T;  2UUA T;  5LA6 E;  1WCR A;  5IUX A;  4LFA T;  2JMH A;  3LFM A;  3QB5 K;  5JDN A;  4GKK T;  3FB2 A;  4JI4 T;  1NEK A;  1UX4 A;  2LSJ A;  2N9D A;  3HKB E;  1HX8 A;  2KND A;  2EHO C;  2DNX A;  4WNK A;  5ADX L;  4GKJ T;  2XAS B;  2YK0 A;  5FY1 A;  5DJQ C;  3RLF F;  1IBK T;  3UU4 A;  3UU5 A;  2XQ5 A;  3HKE E;  3ONJ A;  2Q9Q D;  2K5B B;  1QSD A;  1VCT A;  2XQ7 A;  3JC6 D;  3P4S A;  5J0Z A;  1W9R A;  3LK3 B;  4ILC A;  1JNZ A;  5JRE A;  5LJM A;  3N9M A;  4ZI7 E;  1E2A A;  3UUM A;  2XPK A;  5HXC A;  2E9X A;  3Q9D A;  5JR9 C;  2XQA A;  4NXN T;  5EK4 A;  5CJ5 A;  2AE9 A;  2BKO A;  2KZ7 B;  3A5X A;  1YKE B;  5E0O A;  1E7P A;  1J5W A;  4DR5 T;  3ZJ1 A;  4E7S A;  3ZT6 A;  5HYA A;  2EHO A;  4AKL A;  5DAB A;  4EED A;  1I94 T;  4P1N A;  4DR4 T;  4U3C A;  5LB7 B;  3ZC1 A;  4OX9 T;  5TAO A;  2XAJ B;  3AEB A;  3TKL B;  2D2S A;  1G73 A;  4PJM A;  4UF0 B;  2ACX A;  2V6Y A;  4DBR A;  3A7M A;  5C3J A;  4DMV A;  1US7 B;  5GON E;  4PW8 A;  5L4H A;  2XJ7 A;  2X51 A;  4MFR A;  3PUV F;  2D9D A;  2YDR A;  2W00 A;  3PUZ F;  3Q5E A;  2WMN A;  3FZK B;  3K3O A;  5J1G A;  3N9Q A;  2X0Y A;  1UGO A;  2JQ9 A;  2YKS A;  5H6Q B;  3PE0 A;  5L4E A;  1MIV A;  2ODU A;  3HA4 A;  4PFO A;  4X64 T;  4YHH T;  4G63 A;  3RGL A;  1ZEE A;  2G0U A;  2ZM6 T;  1Y01 A;  2VQF T;  4CXX A;  2CEA A;  2UXB T;  1KNR A;  3KIN B;  4MAL A;  2WAU A;  5LNK A;  4HWF A;  5FKY A;  5LBQ B;  5L3F B;  3AE2 A;  2WS3 A;  1SE7 A;  2X67 A;  3X1D A;  5AQG B;  3L09 A;  4I50 E;  5F5W A;  4EOZ B;  3ZYL A;  4Z8X A;  4TN7 B;  5FP3 A;  1LKX A;  1UK5 A;  4A97 A;  4KHP T;  3KVB A;  2HPL A;  3S4U A;  2KXP B;  2NP9 A;  4ERR A;  2ZM0 A;  2IUB A;  2V7I A;  4IE6 A;  1HNW T;  2H88 A;  1N34 T;  1FMV A;  1VCS A;  2FBW A;  1Z8U A;  3NWI A;  4AKH A;  1IBL T;  4DR2 T;  5A1L A;  5CA0 E;  4LF7 T;  1N32 T;  4EXT A;  5BMV E;  5L3G B;  4KHZ F;  4XBF B;  3ANW B;  1XDP A;  2KIN B;  4LF8 T;  3MAC A;  2ZM8 A;  5HEH A;  2BVM A;  1IAP A;  2MOZ A;  3AA6 B;  4TWD A;  4ZI3 C;  2VKO A;  4GK0 E;  5HCM A;  3ZLI A;  4A98 A;  4LFB T;  2C5K T;  3OPC A;  1HNX T;  2DCF A;  3L8R A;  4AKR B;  3T1H T;  3CVR A;  2LRK A;  2XSB A;  3OYX A;  4H9P C;  3NVO A;  2Q9Q B;  4JI5 T;  2WZH A;  3CWZ B;  1OWA A;  5LGU B;  4PJL A;  4GYR A;  1OXZ A;  4JI7 T;  2B1E A;  4P0B A;  3MJX A;  2QVA A;  5DQV A;  3UUL A;  2QYW A;  3ZCI A;  3EVY A;  5AQI B;  4O4I E;  4HFC A;  4X20 E;  4DR1 T;  3LK2 B;  1KFY A;  4ZEY A;  4KBM B;  4TWF A;  1FEW A;  5HXE A;  5LHI B;  3H37 A;  2BG9 E;  1OED C;  2H7O A;  3N5L A;  3J9X 1;  4BJM A;  1GQE A;  4IRE A;  4TZ4 C;  1FJG T;  3AE9 A;  2VVN A;  3ZMZ B;  5J2U E;  3LBX B;  2LRL A;  3ZCJ A;  3AXJ A;  4X62 T;  3ZMU B;  1CUN A;  3CKD A;  4DBQ A;  5C8Y E;  3SFD A;  3DTO A;  4LML A;  1WR6 A;  1U4Q A;  4MLK A;  3QK6 A;  3PUS A;  3P50 A;  4I4T E;  3CQC B;  2DWG A;  3RYI E;  2WCA A;  4YFS A;  1BR4 A;  3ETU A;  2PBI A;  4ZS2 A;  4ZI2 D;  3B13 A;  3PUA A;  2BS4 A;  2K24 A;  3HKC E;  3M65 A;  2Z6E A;  4PNI A;  3BQL A;  4ZS3 A;  4EIW A;  1MIW A;  2PG8 A;  4O8S A;  5AQR B;  4CN1 A;  5C2T A;  2XY8 B;  2ZLY A;  4WW0 A;  2D5U A;  2DWK A;  1MMN A;  1R8I A;  5CA1 E;  4DR6 T;  1N33 T;  4Z91 A;  2EHO B;  5AQV B;  3AE6 A;  3KV5 A;  2BG9 A;  2BS3 A;  3JCF A;  3NRY A;  3PJA A;  3QB5 A;  3RKO A;  4AIS A;  4EB6 E;  1IJ6 A;  3Q5D A;  4JEH B;  2RA1 A;  3AEG A;  1ZOY A;  3OYZ A;  4HFB A;  3ZJ2 A;  5AQQ B;  3I9W A;  5AQH B;  4YT0 A;  5LHH B;  2CXL A;  3WAK A;  3KVA A;  3BQK A;  5ABF A;  2ACZ A;  5HCJ A;  4HWI B;  3F31 A;  2RP4 A;  2LKH A;  3PUW F;  4GIW A;  4MHC A;  3ZYK A;  4OHF A;  5JVD E;  3L39 A;  2L9Q A;  3EAB A;  4TNW A;  1L0V A;  4B6X A;  4KX6 A;  2XQY A;  3UUN A;  4JEU B;  4EZ4 A;  5L2L A;  4JV5 T;  2LJL A;  1D0X A;  2W0G A;  2J62 A;  2WU5 A;  3O1J A;  3ABV A;  4CXW A;  2UXD T;  2FJB A;  2CLY C;  2VK9 A;  2CA5 A;  1EZ3 A;  4PK5 A;  4EV6 A;  4ZZC A;  3UT5 E;  2X9W A;  3EDV A;  4OK0 A;  3SFE A;  2PFV A;  3OVU A;  5HXS A;  4YXD A;  5AQJ B;  4B3R T;  5FMN A;  3K3Q C;  3AAI A;  2W2U A;  4WBN E;  3P4Q A;  2H7V C;  4UVA B;  2VQE T;  4IL9 A;  4DV3 T;  2WQY A;  2V6X A;  3FHN A;  4HFE A;  2XAF B;  2DHR A;  4WZX A;  5JDF A;  4DVD A;  5KDM C;  1J1J A;  4QKN A;  2WWV A;  4U72 A;  3VKH A;  3ZKR A;  1XNQ T;  3RPU A;  4AI6 A;  3N9N A;  2K48 A;  3AED A;  3P4P A;  4B3S T;  2CHN A;  4GK5 E;  4JBW F;  3R6N A;  2LHR A;  5LGT B;  4IE7 A;  5JDH A;  3AVR A;  4UEM A;  3K3N A;  2VWA A;  2PTF A;  5L47 A;  3O9X A;  2FJA A;  3RIA A;  2KWI B;  3OTO T;  2AXD S;  1KK7 A;  2H3R A;  1T98 A;  2QRX A;  3CQG B;  2CPT A;  2V26 A;  3A8Y C;  4YHJ A;  3RH3 A;  3RYC E;  4ISS A;  4U31 A;  1VOM A;  4QH1 A;  5EZY E;  2VB6 A;  3RKG A;  2LM9 A;  3TLT A;  4YJ3 E;  5AQU B;  4P09 A;  4HEA A;  1UCU A;  4TX5 A;  4GYS A;  2NWB A;  2NW9 A;  4O2B E;  4QXC B;  5AQK B;  2VUR A;  3AE3 A;  2PJQ A;  5ABF B;  1S35 A;  2LKG A;  1E1H B;  2XQ4 A;  2D0U A;  3JC6 C;  1D0Y A;  3MXZ A;  4U33 A;  2A9U A;  4ASK A;  4CXY A;  3N2K E;  4HFD A;  4YLH A;  1IJ5 A;  4H9N C;  3VKG A;  5ETW A;  3N9L A;  4G2A A;  2EHO D;  3ZYM A;  3EAM A;  4JUY A;  4DR7 T;  4QWN B;  4U7Y A;  1Z0P A;  5LXT E;  4ZI2 C;  4IE4 A;  4L5G A;  4X1Y E;  2KWH A;  1HF8 A;  2ZMA A;  5LP6 E;  2DL1 A;  2KSR A;  2V7J A;  5LBM A;  2E5L T;  3V5U A;  3AE7 A;  4KI0 F;  1HCI A;  4AQY T;  4PJJ A;  2ZM2 A;  3QNU A;  2LLY A;  5KMG P;  1HTJ F;  4MBQ A;  5FXX A;  2CE7 A;  4TUY E;  3ETV A;  1UUR A;  4FI5 A;  2VKD A;  3SRZ A;  3AAE B;  3Q5W A;  4IL4 A;  2LOS A;  3RQU A;  3CX7 B;  5HEG A;  4UIG A;  1D1B A;  1UUS A;  2XQ8 A;  3P4W A;  4IGU A;  4CN4 A;  4KP3 C;  4HTE A;  3UUX B;  4DV7 T;  3U3I A;  4JI6 T;  4HFV A;  2NW8 A;  3I0Q A;  4UXN B;  1HR0 T;  5JRC A;  2BKN A;  3FBL A;  1U5P A;  1FIO A;  1LVK A;  3PUY F;  3O4X E;  5FL0 A;  1W0B A;  3G06 A;  3M3Z B;  1T8B A;  5F3J A;  5LCY A;  3ZMT B;  2E9X B;  3FZM B;  3CPZ A;  3H3A A;  4IST A;  1NAF A;  4ILA A;  2J1D G;  3EI0 A;  2XM2 A;  3F2E A;  4HKA A;  4BA9 A;  1KEY A;  2X9Y A;  3ANW A;  4V1A v;  3TLV A;  3L3P A;  4CQI A;  1DU2 A;  2IIU A;  3UU6 A;  3UUB A;  4CZZ B;  5LG3 A;  2UUB T;  2M67 A;  4O4J E;  3I0O A;  3KBT A;  3FZF B;  3LG7 A;  4YTP A;  2JRK A;  3O1I A;  4WYV A;  4OYK A;  3P8C D;  1X9B A;  4KMC A;  2VL8 A;  5AQP B;  2CMR A;  5KX5 E;  4DUZ T;  4YTM A;  4X65 T;  2C0S A;  2IAK A;  1WR0 A;  2V6Y B;  2IHR 1;  3ONL C;  3E0Z A;  2A72 A;  4TWH A;  2HN2 A;  2BDE A;  4HWH A;  5FY7 A;  2V5C A;  1B7T A;  4AQF A;  1ZKE A;  2YDQ A;  4PFP A;  4EYY R;  5JDQ A;  2VVS A;  3UFG A;  4EYU A;  3FZH B;  3IF8 B;  1YW0 A;  2YN6 A;  3BQI A;  3QUJ A;  1Y64 B;  2JMK A;  5L3E B;  5EK2 A;  3RIF A;  5IWA T;  3R84 B;  2CCQ A;  2X66 A;  2OLT A;  2XM1 A;  3NKZ A;  3W15 B;  5AFU L;  4HFI A;  4JI0 T;  1HNZ T;  1T72 A;  2CHO A;  2BS2 A;  4H9S E;  3ZMV B;  5HEO A;  2WDQ A;  4IDQ A;  3IA3 A;  4AKI A;  2X68 A;  4EAH A;  1W0A A;  2N1G A;  2XTL A;  3PDY A;  3SWH A;  4K0K T;  3FXE B;  2WBL A;  2A2F X;  3C4Z A;  2ES0 A;  2V8S V;  5IHY A;  5FVK A;  3B57 A;  2LSG A;  3C51 A;  1IZN B;  4M1P A;  4CI1 B;  5L3C B;  1HG5 A;  3OJA A;  3D0T A;  1LRZ A;  3FXD B;  4QXH B;  1XZY A;  3SOL A;  1D1A A;  1ZP0 A;  4IDO A;  4IE0 A;  3ZPO A;  4B3M T;  2NW7 A;  4A5X A;  4F6R C;  4E7Z A;  5L3D B;  3J7Y q;  1M7K A;  1MMD A;  2Y8D A;  1YXR A;  2NOX A;  2KLQ A;  1BR2 A;  3AEC A;  2W63 A;  2MAW A;  4LF6 T;  5DQW A;  3RX6 A;  2W62 A;  2MTQ A;  2XAG B;  4O2A E;  2JPF A;  4H9R C;  1N36 T;  4DV5 T;  3MA9 A;  4OYJ A;  4EGW A;  2XUE A;  1WYC A;  2CWO A;  2OV9 A;  4P0A A;  4IE5 A;  2I0M A;  4ZXL A;  2M6I A;  2FUP A;  2CRB A;  2XQ6 A;  3KV4 A;  4UVC B;  4YSY A;  5JDM A;  3UQ7 A;  4DV2 T;  3ZST A;  4YSX A;  1SUM B;  2LEH A;  3FZL B;  4J2C A;  5LMU T;  4AXP A;  4EEB A;  4PK6 A;  2X0H A;  1KF6 A;  3GN5 A;  5ABE A;  5JRC B;  5CFB A;  1LVF A;  4L0R A;  4X5T A;  1YQ4 A;  2WDR A;  3C64 A;  3E08 A;  2W61 A;  3QOF A;  4LMJ A;  2HH7 A;  5CGM A;  2MBG A;  2V7L A;  2LSK A;  4Q25 A;  3AAA B;  5HEU A;  3CQX C;  3K8P C;  2UXC T;  2CWY A;  4IDP A;  4DND A;  2WP9 A;  4NUV A;  1YKH B;  3PUQ A;  1FMW A;  4NUU A;  3UTK A;  4JI8 T;  4LFC T;  2C5J A;  3RRW A;  2WWU A;  2LOP A;  3MZK B;  2RPA A;  1D0Z A;  4TV8 E;  2H89 A;  2LHN A;  5FXV A;  2V5D A;  3UQ4 A;  4QXB B;  3VR9 A;  4HFH A;  3GA8 A;  3PV0 F;  3TLS A;  3EDU A;  2E5V A;  4H9Q C;  5FNV E;  3WI3 A;  2XHE B;  5ABH A;  3LK4 2;  2V7M A;  4OFZ A;  4PK4 A;  5AQM B;  1M62 A;  5FXZ A;  2LSI A;  2P9B A;  2E2A A;  2CBI A;  4IT4 A;  1YQ3 A;  4U74 A;  4ZOL E;  2BKP A;  3CK6 A;  2B76 A;  3OKQ A;  2W66 A;  3FBZ A;  2XAH B;  3AE1 A;  2KMF A;  3B5M A;  3ONX A;  5H6R B;  4JI1 T;  5HAX A;  4UV9 B;  4AQG A;  2Y6X A;  5EK3 A;  2JJ9 A;  1MND A;  4XAX B;  3F57 A;  4BAY B;  4I0U A;  1NEN A;  2BG9 B;  3P4R A;  5J2T E;  4DID B;  3RQW A;  2CXF A;  3C4X A;  5AQT B;  5FYM A;  4X1K E;  2DI4 A;  2BZB A;  2QGS A;  5FY0 A;  3RC8 A;  3RI5 A;  1SA0 E;  3H3M A;  4DUY T;  5LJN A;  4NXM T;  3UFE A;  3ZC0 A;  4DV4 T;  2UXN B;  4COF A;  2E8I A;  3GWH A;  1OED B;  2FJE A;  2YIN A;  2VKH A;  2IW5 B;  3HI2 A;  3CML A;  3I9Y A;  1HS7 A;  1HX1 B;  2XQ9 A;  3NBX X;  2LE8 A;  3AEF A;  3MK7 C;  3E22 E;  4H63 H;  4ZI3 D;  3RHW A;  5ABG A;  5JTG A;  4IHJ E;  3RYF E;  4X66 T;  3K1S A;  4H63 V;  4UF0 A;  2WMO A;  4ZHQ E;  3PUG A;  2JIW A;  3P7I A;  4ILU A;  4AKG A;  2J47 A;  2XAQ B;  2XSA A;  3BK9 A;  3ESL A;  2OA5 A;  3JAD A;  3PTR B;  2DLR A;  5HXR A;  5HXH A;  5IYZ E;  3CX6 B;  2WDV A;  3AEA A;  4TNV A;  4UVB B;  5FL1 A;  1O3X A;  3TLW A;  3KDS E;  3HKD E;  4NPP A;  3N9P A;  3CIR A;  3PUX F;  2E9X C;  1V9D A;  1OED A;  2I6H A;  1D1C A;  3AEE A;  2IC6 A;  3KFW X;  3MKD A;  4IDZ A;  3KBU A; 
#chains in the Genus database with same CATH homology
 4JV5 T;  4LF5 T;  4KHP T;  1XNR T;  4JYA T;  2UXD T;  4NXN T;  4B3M T;  4DR5 T;  4K0K T;  4DV0 T;  4B3R T;  2VQE T;  4DV3 T;  4OX9 T;  4DV6 T;  4JI3 T;  1XNQ T;  4B3S T;  2UUC T;  4JI2 T;  4DR4 T;  4LF6 T;  2HHH T;  4X64 T;  1N36 T;  4DV7 T;  4YHH T;  4DV5 T;  2ZM6 T;  2VQF T;  3OTO T;  2UXB T;  4LF9 T;  4JI4 T;  4DV2 T;  5LMU T;  1HNW T;  1N34 T;  1IBL T;  4DR2 T;  5BR8 T;  1J5E T;  4LF7 T;  2UXC T;  2F4V T;  4DR7 T;  4LF8 T;  4JI8 T;  4LFC T;  1FJG T;  4B3T T;  2E5L T;  4LFB T;  4DR3 T;  1XMO T;  1HNX T;  3T1H T;  4AQY T;  4JI5 T;  3T1Y T;  4JI7 T;  4DR1 T;  4JI1 T;  4JI6 T;  2UU9 T;  1HR0 T;  4YY3 T;  4X62 T;  4DUY T;  1IBM T;  4NXM T;  4DV4 T;  1N32 T;  2UUB T;  1XMQ T;  4LF4 T;  1I94 T;  4X66 T;  5LMN T;  4DUZ T;  4X65 T;  2UUA T;  4DV1 T;  4DR6 T;  4LFA T;  4GKK T;  4GKJ T;  5IWA T;  1IBK T;  1N33 T;  4JI0 T;  1HNZ T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...