1HNZT

Structure of the thermus thermophilus 30s ribosomal subunit in complex with hygromycin b
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAVQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structural basis for the action of the antibiotics tetracycline, pactamycin, and hygromycin B on the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 37
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2000-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 1hnzT00
1HNXT 1XNQT 4LFAT 4B3RT 5LMUT 4DR7T 2HHHT 1HNWT 4DUYT 2VQET 4NXMT 4LF5T 2F4VT 4DR5T 2VQFT 2UU9T 4JI6T 1N36T 4DV2T 3T1YT 4JI5T 4DV1T 5LMNT 4X64T 1N32T 4B3MT 4DR6T 4DR2T 4JI3T 4DUZT 1N33T 4YY3T 1XNRT 4NXNT 2UXDT 4X66T 4DV6T 4LF4T 4DV7T 1XMQT 3T1HT 2ZM6T 4OX9T 4DR4T 4X65T 4LF6T 4DV4T 1HNZT 1HR0T 5IWAT 2UUBT 4LFBT 1IBMT 1FJGT 4DV0T 2UUAT 4JYAT 2UXBT 4GKJT 4K0KT 2UUCT 3OTOT 4DR3T 4X62T 4JI1T 4LF8T 4B3ST 4B3TT 4DR1T 1I94T 4JI0T 4LF7T 4DV5T 4DV3T 4LFCT 4KHPT 4GKKT 1XMOT 2UXCT 4LF9T 4JI7T 4JV5T 4AQYT 4JI2T 1N34T 4YHHT 1J5ET 1IBKT 4JI8T 5BR8T 1IBLT 4JI4T 2E5LT
chains in the Genus database with same CATH superfamily
4I43B 1OEDC 2QGSA 3OKQA 3NRYA 3QB5K 3LBXA 4H63V 1HNXT 3N9QA 4ILAA 2WWUA 2Z6EA 5HXSA 2B76A 3MZKB 5JREA 4LF4T 3U78A 1KNZA 3KV6A 2LT3A 4TWDA 4LFAT 2W00A 2VWAA 3EABA 2LLYA 4DR7T 4I55E 1MIWA 5KMGP 2Y48B 2HHHT 3JC6C 2IUBA 4DBQA 3Q5WA 5L3GB 5LHHB 5LJNA 2X66A 1U5PA 4HTEA 2VQET 2CWOA 3ZC1A 4IE7A 4PNIA 2W66A 3I0QA 5EK3A 2JQQA 4E7SA 5LBMA 2OA5A 2ZM8A 3NVOA 4GYRA 4Z8XA 3ZCJA 3MKDA 4DV2T 3AEDA 2UU9T 3B5MA 5FXZA 1SHZC 3ZCIA 5HCMA 4H9QC 2ZM2A 3GMIA 4XZCA 3PUZF 5JH7E 1N36T 1S94A 2DWKA 1W9RA 1KNRA 3ZYLA 3VU7H 3M3ZB 1W0BA 2BKOA 2JRKA 3N9OA 1T98A 2BS2A 2I0MA 2XAJB 3C4ZA 3CQCB 4PK6A 1L0VA 2RA1A 5HWXA 4LMLA 1E2AA 5LMNT 3PUVF 3I9WA 4KI0F 1HTJF 1QSDA 3P50A 4IE6A 3VKHA 3P7IA 4CI3B 5FXVA 4ADZA 5EK4A 5HYAA 4DR6T 2XM2A 3C98B 3ZMZB 2V6YB 2K3WA 4N78D 3PJAA 1HX8A 2ES0A 1QLBA 2HPLA 3F57A 2C0SA 5HWYA 4DR2T 4HFHA 2X9YA 5AQVB 1M7KA 1N33T 4CXXA 3U3IA 2CCQA 4NXNT 2XQ7A 1CHUA 1YQ4A 2WMNA 4X66T 1E7PA 5L4EA 4OK0A 4ZZBA 5KDMC 4UV9B 3JAEA 1T8BA 2QA7A 3AXJB 3FZHB 3Q2MA 3TLSA 4KUMB 3ZMTB 2V6XA 3ZN0B 2ZM6T 5CA0E 2QRXA 2W0GA 3OVUA 2NW7A 3N9NA 5E0OA 3LG7A 2VB6A 2X0YA 2CBJA 2WCAA 4ZOLE 3QNUA 4DV4T 3ZN1B 3KVAA 1HR0T 5IHYA 4NPPA 1O3XA 4H9NC 2RP4A 1J1JA 2H7OA 4TN7B 3RC3A 3AE9A 1OEDA 3UU5A 3UFEA 2N9DA 1SE7A 2CLYC 2CM0A 4KBMB 4CN1A 4DR1T 3T8OA 1NAFA 4HWFA 3CIRA 2D2SA 4QH4A 2Y8DA 2A2FX 3A7MA 3C4WA 4H9RC 1HG5A 2MYSA 3AE4A 4B6XA 3ZT6A 2V1DB 4EZ4A 5BMVE 2UUAT 3ESLA 4IE4A 1FIOA 4GKJT 4JYAT 4ZI3D 3RKOA 2A72A 4BAYB 3QC9A 3PUXF 4ZS2A 2LE8A 2XM1A 4UVAB 2BVLA 4XAXB 3VHLA 2BS4A 3L09A 4EXTA 5JDLA 1G73A 2YDRA 3HKEE 3K3QC 2NTXA 2X51A 5L4HA 4BJNA 3GN5A 4B3TT 3AVRA 4AKLA 3LSVA 2Q9QB 3H3MA 2EHOB 3O1IA 4PJMA 5FVKA 3KDSE 5JR9C 2LM2A 4HFEA 4QH5A 1I94T 4LF7T 2KLQA 4OYKA 4TV8E 4EIWA 4TUYE 4J2CA 1I6ZA 5ETWA 2PFVA 2XUEA 3C64A 3Q9DA 4PJLA 4UXNB 3RF1A 4O4LE 2PG8A 4QX7B 3K3NA 3I0OA 4YSZA 3ANWB 5F8PA 5JQGE 5JDGA 3GA8A 2OLTA 2NWBA 2YINA 4JI7T 3EHZA 4PK4A 4ZZCA 5ABFB 5L3DB 2J62A 1NEKA 2KMFA 3FZMB 3MK7C 3N2KE 4U3CA 4JI2T 3DP7A 4JI8T 4GYSA 5M4YA 4ISSA 2KWIB 3UU6A 4DMWA 4GK5E 5L47A 1X9BA 3UULA 2UXCT 2WU2A 3KBUA 2YK0A 3CQXC 3PUQA 4IHJE 4EV6A 1BR0A 4ERRA 2JPFA 4IL9A 3AB3B 3EVYA 4GK0E 2E9XD 3P4WA 4HFCA 1HCIA 2FBWA 2WY2A 1WR6A 2GK9A 2NP9A 4ASKA 1IAPA 3HKCE 4DIDB 4B3RT 2J1DG 2BBJA 3FHNA 3MACA 5CB4E 3I1AA 4QKNA 2QVAA 1MMAA 4DUYT 2V5CA 4O4HE 3AAIA 4CN6A 5IUXA 5HEHA 5LMUT 1UGOA 4O2AE 4NXMT 3AA7B 4HN9A 3GN5B 3WI3A 4HWCA 5FYMA 3OPCA 1KK7A 4Z91A 1XZYA 3Q5XA 1W0AA 3AAAB 3EDVA 4AISA 2VQFT 1UURA 2E2AA 3RQUA 1LKXA 3ANWA 1LRZA 1XDOA 3UU4A 3T1YT 3SRZA 3E22E 3IBPA 4NUVA 4O4IE 2MBGA 3KV5A 5CFBA 2DL1A 4HFIA 3EUHA 2A3DA 1YQ3A 4UV8B 4CI1B 5J2UE 3C51A 4FJOA 3SWHA 3K1SA 2V5DA 2PTFA 4WYVA 2V26A 2WS3A 1HFAA 3F2EA 5HCJA 1OEDB 5LP6E 1D0XA 5EK2A 4AKRB 2LSGA 2XQAA 5J2TE 4HEAA 4ZI2C 3PUGA 2X67A 1B7TA 1WLXA 2BG9E 5ABEA 2IC9A 3UUMA 3ZT5A 5DQVA 3KVBA 3TKLB 1IJ6A 2LSIA 3PUWF 5FMNA 4HWIB 4PW8A 1J5WA 3FB2A 3RRCA 4JUYA 2CXFA 5LCYA 2H88A 1S35A 2MAWA 3RRWA 5FKYA 5F3JA 4IE0A 2JQKA 2XQYA 3UUXB 3V5UA 3UUNA 4HE8A 1VCSA 1WYBA 2XAGB 2KZ7B 2YKSA 3CMLA 4QXHB 4HFBA 4YFSA 1SUMB 1Z0PA 2W61A 5EZYE 2VKDA 3TLVA 2CE7A 5LGUB 1Y64B 5LG3A 3AA0B 2WAUA 4PJJA 3ZSTA 5ABFA 2DWGA 5LYJE 2XQ9A 3WAKA 1YKEB 1XWMA 2AE9A 3BQIA 3L39A 2KXPB 2BKPA 2JJ9A 4EB6E 3AE5A 5FL0A 2NOXA 1UCUA 2X9HA 3EDUA 3ZMUB 2H7VC 2XTLA 3UQ7A 3RYHE 1VRBA 4ZXLA 3WAJA 4LFBT 1ZKEA 2XQ8A 4OHFA 3E0ZA 3LFMA 4G63A 2JQ9A 5AQNB 2M6IA 4KMCA 3G06A 3TLTA 4COFA 3ZEFB 2Y6XA 3OBVE 2IW5B 3P4PA 4PFOA 2D5UA 4EEDA 3SOLA 4ISTA 5FY1A 2XAHB 5C8YE 2KINB 3QOFA 4M1PA 4A56A 4K0KT 2UUCT 2PJQA 3AE1A 3X1DA 1HS7A 3W15B 5FY7A 2Q9QC 2D9DA 4DR3T 2FJBA 4JI1T 2KNDA 2KWHA 4NIQA 5AQOB 4YT0A 1MIYA 2IHR1 3R84B 4ILUA 4LF8T 5LHIB 5LNKA 3RC8A 3H3AA 5DABA 3AA1B 4B3ST 1UX5A 3C4XA 3LK3B 2V7KA 2XAQB 2NTYA 4UR9A 1Y01A 4MFRA 4DV3T 1D1BA 1ZV4X 4OFZA 5HEUA 3QB5A 1E1HB 2CA5A 2VL8A 4WZXA 2XHEB 4L0RA 3ETUA 2CPTA 3NWIA 4L5GA 4X1IE 3RGLA 5FXXA 3SS1A 2YU1A 2WWVA 3RIUC 3ZC0A 3PU3A 4ILCA 4KX6A 4TNWA 1NENA 2CRBA 3AVSA 3K3OA 5FL1A 1HG2A 4LF9T 2ODVA 4DNDA 2XASB 2WZHA 4YLHA 1US7B 2C5KT 4P0BA 3FBZA 5F5WA 5JVDE 2BDEA 2X0LB 3KV9A 4YSYA 4YTPA 5LXTE 3J7Yq 3RYIE 3ZJ1A 1XDPA 4AQYT 3PU8A 2BZBA 1IJ5A 1LVKA 2LSJA 2P9BA 5AQGB 3TLWA 1J5ET 5GONE 1BR2A 4DMVA 3ZKRA 1ZOYA 3O1JA 4PFPA 1IBLT 4IL4A 3VRAA 3NZQA 2E5LT 1ZHCA 4TX5A 4U74A 2J47A 5IWAT 4GKKT 2Q9QA 2KSRA 1KEYA 2BKNA 3OJAA 4H9SE 5AQLB 3S4UA 3ZYMA 4P09A 3SFEA 3HI2A 1XNQT 3OYZA 5AQHB 2LSYA 4DV6T 4X1YE 2HN1A 5HEGA 4NUUA 2EHOD 5JTGA 2NR4A 4H9PC 4IDNA 1LVFA 2FUPA 1M62A 2RPAA 3GWHA 1WRDA 2H89A 2SPCA 4IREA 3AEEA 2R6GF 4CI2B 4AKHA 1FMWA 3RLFF 1YD8G 5J0ZA 4QHOA 2IMLA 2DHRA 4OX9T 2ACXA 2NW8A 2BVMA 2OV9A 4JEHB 2W67A 4TWHA 4ZHQE 4DR5T 3P8CD 2HPJA 1W09A 2WB5A 5CA1E 3PJAJ 3LDQB 4E7ZA 3Q5EA 3UQ4A 3PUYF 1BR4A 4EGWA 5AQUB 2CHOA 2LM9A 2VVSA 3KV4A 4H9OC 4AI6A 5HXEA 3FBLA 3H37A 2WU5A 4QX8B 4BA9A 4WBNE 2V7MA 4B3MT 4KHZF 1N32T 2XQ3A 3F31A 2IDOB 3PURA 4WBOA 3UT5E 1ZP0A 1KF6A 3RI5A 1Z8UA 4QXBB 4UVCB 4L9IA 4EOZB 4JEUB 5ABHA 2KT9A 5LA6E 2K5BB 3V5SA 3HR0A 2HH7A 2WZIA 4DUZT 2VKJA 1H7CA 5AQJB 5LHGB 2UXDT 2WQYA 5L3FB 3KINB 4DO0A 2WBLA 1EZ3A 1R8IA 3VR8A 2WDRA 4DV7T 2LRKA 2Q9QD 3JCFA 4ANJA 4F6RC 4YSXA 3HKDE 3AECA 3AE8A 2HN2A 3ZJ2A 5HEJA 3IF8B 2CXDA 2AXDS 2L3LA 2ZM0A 3AE3A 4LMJA 1YXRA 4AXPA 4LF6T 4AKIA 2LRLA 2W2UA 3VKGA 1MNEA 2V7JA 5JDNA 1MIVA 2LEHA 2X9WA 1HNZT 2VKOA 2XSBA 1MMGA 5CGMA 3B13A 5AQKB 1WYCA 1X79A 4IDZA 5AQPB 3RX6A 4A97A 5KX5E 2UUBT 3P4RA 4PAGA 2VK9A 1IBMT 4YJ2E 3RYFE 2VASA 2JIWA 3UFGA 1FJGT 3IEEA 5LG4A 3N5LA 4O2BE 4F8HA 4DV0T 3L8RA 3M65A 2IIUA 5J1GA 3BQKA 2JMKA 5AQRB 3NKZA 2K24A 1DU2A 1T7SA 3CVRA 4YHJA 3HKBE 4ZI7E 5H6QB 3OTOT 4EZHA 3O4XE 2ODUA 2VVNA 3LJCA 4LMKA 4MLKA 2J4GA 3ONJA 4C90A 4ZI2D 4CZZB 4X62T 2WP9A 4HGAA 2CXLA 1U4QA 2C5IT 2IAKA 4AQFA 5L3BB 2DLRA 1T72A 3AEAA 3JADA 3RIUA 2YEVC 5CJ5A 3RPUA 4K0UA 3O1HA 5L3EB 4JI0T 3NBXX 2ACZA 4DV5T 1D0ZA 4I0UA 4Q25A 3IA3A 4KHPT 3R6NA 4Z90A 3RH3A 1XMOT 4JI3T 4TNVA 3O9XA 2I59A 4O8SA 5DJQC 4ZEYA 4ILBA 2LKGA 2CHNA 3AEGA 3MXZA 2N2NA 4JLEA 1YKHB 4UELA 1ZEEA 3EI0A 3IHRA 4XBFB 4AKGA 3ZMVB 2BG9C 2XPKA 4QWNB 3MJXA 3RHWA 3UTKA 2FJEA 2YN6A 3L3PA 1IZNB 1VCTA 3LK42 5H6RB 1N34T 1FEWA 1HX1B 1KFYA 2XJ7A 3LK2B 5JR9A 3ZYKA 4YHHT 1IBKT 2XY8B 3FZFB 1V9DA 3JC6D 3N9MA 3P4QA 5JDFA 4TZ4C 2D0UA 3JAFA 3CK6A 3FXDB 5DQWA 4KP3C 3CPZA 3UU3A 5AQFB 4IGUA 3CKDA 4MHCA 5FXWA 2CWYA 2CBIA 3CX6B 4EYUA 4G2AA 5C2TA 4AQFC 1OWAA 3AEBA 3HA4A 4PJNA 4YTMA 4OYJA 5AQSB 5JRCA 2DNXA 2QYWA 3BQLA 2H3RA 2W62A 2LKHA 2LSKA 4YJ3E 4UEMA 4X5TA 4AQGA 3KBTA 4I50E 1HNWT 4U72A 4CXYA 3ETVA 3AA6B 3A5XA 5JDMA 1JNRA 2EHOA 2MPKA 3PV0F 2VKHA 3AE7A 4EEBA 4LF5T 5JDQA 1UX4A 2IC6A 3AAEB 2M6BA 1FMVA 1MMNA 4YTNA 1D1CA 2G0UA 5ADXL 3RYCE 2F4VT 2L9QA 3NRXA 4GIWA 2MTQA 2PBIA 3RQWA 1D0YA 4JI6T 1BR1A 2XQ5A 4UVBB 4H63H 2WDQA 5AQMB 4X20E 4U7IA 2BG9B 4UF0A 5LJMA 3CX7B 4JI5T 4DV1T 3FZKB 5ABGA 4TWFA 3K8PC 1MNDA 1YW0A 4U33A 5AQIB 2C5JA 3ABVA 3N2GE 4IE5A 2CLYB 3RKGA 3B57A 4X64T 4HKAA 4U31A 3VR9A 5HAXA 4IDPA 5C3JA 2E9XA 3QUJA 2ZMAA 3D0TA 5AFUL 3NZPA 3ONLC 1MMDA 2N1GA 4P1NA 3AE6A 3PUAA 5IYZE 5L2LA 2A9UA 1HF8A 2UXXB 3I9YA 2LOPA 3N2OA 4QXCB 3LBXB 2X9XA 4CXWA 4EYYR 2DCFA 2L8KA 4YY3T 4PK5A 1XNRT 2JMHA 3N9PA 3ZLIA 1GQEA 1WFDA 2W63A 3MA9A 1UUSA 3FZLB 4MBQA 1OEDE 5HXCA 5TAOA 3VRBA 2V7LA 4FI5A 3ZSSA 4CN4A 4C91A 5HXHA 2EHOC 1WCRA 4DVDA 1XMQT 3PUSA 3T1HT 1AJ3A 3TLUA 2WMOA 2BBHA 2E5VA 2XSAA 3FXEB 3RIFA 4DR4T 4HWDA 5LB7B 4UIGA 4V1Av 4WW0A 4I4TE 5LOVE 2BG9A 4IT4A 4IDOA 4X65T 5HEOA 2VURA 5FVLA 1NWMX 3KFWX 5FY0A 4YXDA 2CMRA 1VOMA 5LBQB 4P0AA 1QUUA 2BS3A 3Q5DA 3ZMSB 2E8IA 2W4XA 3PE0A 2V7IA 2XZEA 3EAMA 2YDSA 3PDYA 3PTRB 3AE2A 5HXRA 3OYXA 2UXNB 3CX8B 4HFVA 5JDHA 2DI4A 1KNPA 4DBRA 4A98A 2VL0A 4HFDA 3J9X1 1JNZA 1G8XA 2UXBT 5JRCB 4U2ZA 2V8SV 4A5XA 2YDQA 3CWZB 5AQTB 2WDVA 2WM9A 2NW9A 5LGTB 5L3CB 2WSSV 2LJLA 2B1EA 2E9XB 5AQQB 3QK6A 3DTOA 2ZLYA 1SA0E 4UF0B 2LHNA 2MOZA 4WNKA 3RIAA 2YU2A 2X0HA 3CQGB 3UU8A 3DJBA 1CUNA 4MALA 5KXJA 4O4JE 4BJMA 4LFCT 3UUBA 2I6HA 2CEAA 2X68A 1OXZA 3AXJA 3ZPOA 4IIJE 2LOSA 5A1LA 3ZT7A 4IDQA 3A8YC 4CQIA 5JR9B 5FNVE 2K48A 3AEFA 3C50A 3HL6A 2K9AA 4QH1A 3SFDA 2FJDA 1WR0A 1D1AA 2LHRA 2XQ6A 2XQ4A 2XAFB 3N9LA 2D0TA 5LGNB 2E9XC 4U7YA 4JV5T 3E08A 2FJAA 2YOEA 2M67A 3ONXA 4U2YA 4ZI3C 4ZS3A 2V6YA 5FP3A 4X1KE 4TV9E 4EAHA 3BK9A 4AIUA 5BR8T 4HWHA 4JBWF 4JI4T 4GOUA 2JQHA 3P4SA 1UK5A
chains in the Genus database with same CATH topology
1HNXT 1XNQT 4LFAT 4B3RT 5LMUT 4DR7T 2HHHT 1HNWT 4DUYT 2VQET 4NXMT 4LF5T 2F4VT 4DR5T 2VQFT 2UU9T 4JI6T 1N36T 4DV2T 3T1YT 4JI5T 4DV1T 5LMNT 4X64T 1N32T 4B3MT 4DR6T 4DR2T 4JI3T 4DUZT 1N33T 4YY3T 1XNRT 4NXNT 2UXDT 4X66T 4DV6T 4LF4T 4DV7T 1XMQT 3T1HT 2ZM6T 4OX9T 4DR4T 4X65T 4LF6T 4DV4T 1HNZT 1HR0T 5IWAT 2UUBT 4LFBT 1IBMT 1FJGT 4DV0T 2UUAT 4JYAT 2UXBT 4GKJT 4K0KT 2UUCT 3OTOT 4DR3T 4X62T 4JI1T 4LF8T 4B3ST 4B3TT 4DR1T 1I94T 4JI0T 4LF7T 4DV5T 4DV3T 4LFCT 4KHPT 4GKKT 1XMOT 2UXCT 4LF9T 4JI7T 4JV5T 4AQYT 4JI2T 1N34T 4YHHT 1J5ET 1IBKT 4JI8T 5BR8T 1IBLT 4JI4T 2E5LT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HNX T;  1XNQ T;  4LFA T;  4B3R T;  5LMU T;  4DR7 T;  2HHH T;  1HNW T;  4DUY T;  2VQE T;  4NXM T;  4LF5 T;  2F4V T;  4DR5 T;  2VQF T;  2UU9 T;  4JI6 T;  1N36 T;  4DV2 T;  3T1Y T;  4JI5 T;  4DV1 T;  5LMN T;  4X64 T;  1N32 T;  4B3M T;  4DR6 T;  4DR2 T;  4JI3 T;  4DUZ T;  1N33 T;  4YY3 T;  1XNR T;  4NXN T;  2UXD T;  4X66 T;  4DV6 T;  4LF4 T;  4DV7 T;  1XMQ T;  3T1H T;  2ZM6 T;  4OX9 T;  4DR4 T;  4X65 T;  4LF6 T;  4DV4 T;  1HNZ T;  1HR0 T;  5IWA T;  2UUB T;  4LFB T;  1IBM T;  1FJG T;  4DV0 T;  2UUA T;  4JYA T;  2UXB T;  4GKJ T;  4K0K T;  2UUC T;  3OTO T;  4DR3 T;  4X62 T;  4JI1 T;  4LF8 T;  4B3S T;  4B3T T;  4DR1 T;  1I94 T;  4JI0 T;  4LF7 T;  4DV5 T;  4DV3 T;  4LFC T;  4KHP T;  4GKK T;  1XMO T;  2UXC T;  4LF9 T;  4JI7 T;  4JV5 T;  4AQY T;  4JI2 T;  1N34 T;  4YHH T;  1J5E T;  1IBK T;  4JI8 T;  5BR8 T;  1IBL T;  4JI4 T;  2E5L T; 
#chains in the Genus database with same CATH topology
 4I43 B;  1OED C;  2QGS A;  3OKQ A;  3NRY A;  3QB5 K;  3LBX A;  4H63 V;  1HNX T;  3N9Q A;  4ILA A;  2WWU A;  2Z6E A;  5HXS A;  2B76 A;  3MZK B;  5JRE A;  4LF4 T;  3U78 A;  1KNZ A;  3KV6 A;  2LT3 A;  4TWD A;  4LFA T;  2W00 A;  2VWA A;  3EAB A;  2LLY A;  4DR7 T;  4I55 E;  1MIW A;  5KMG P;  2Y48 B;  2HHH T;  3JC6 C;  2IUB A;  4DBQ A;  3Q5W A;  5L3G B;  5LHH B;  5LJN A;  2X66 A;  1U5P A;  4HTE A;  2VQE T;  2CWO A;  3ZC1 A;  4IE7 A;  4PNI A;  2W66 A;  3I0Q A;  5EK3 A;  2JQQ A;  4E7S A;  5LBM A;  2OA5 A;  2ZM8 A;  3NVO A;  4GYR A;  4Z8X A;  3ZCJ A;  3MKD A;  4DV2 T;  3AED A;  2UU9 T;  3B5M A;  5FXZ A;  1SHZ C;  3ZCI A;  5HCM A;  4H9Q C;  2ZM2 A;  3GMI A;  4XZC A;  3PUZ F;  5JH7 E;  1N36 T;  1S94 A;  2DWK A;  1W9R A;  1KNR A;  3ZYL A;  3VU7 H;  3M3Z B;  1W0B A;  2BKO A;  2JRK A;  3N9O A;  1T98 A;  2BS2 A;  2I0M A;  2XAJ B;  3C4Z A;  3CQC B;  4PK6 A;  1L0V A;  2RA1 A;  5HWX A;  4LML A;  1E2A A;  5LMN T;  3PUV F;  3I9W A;  4KI0 F;  1HTJ F;  1QSD A;  3P50 A;  4IE6 A;  3VKH A;  3P7I A;  4CI3 B;  5FXV A;  4ADZ A;  5EK4 A;  5HYA A;  4DR6 T;  2XM2 A;  3C98 B;  3ZMZ B;  2V6Y B;  2K3W A;  4N78 D;  3PJA A;  1HX8 A;  2ES0 A;  1QLB A;  2HPL A;  3F57 A;  2C0S A;  5HWY A;  4DR2 T;  4HFH A;  2X9Y A;  5AQV B;  1M7K A;  1N33 T;  4CXX A;  3U3I A;  2CCQ A;  4NXN T;  2XQ7 A;  1CHU A;  1YQ4 A;  2WMN A;  4X66 T;  1E7P A;  5L4E A;  4OK0 A;  4ZZB A;  5KDM C;  4UV9 B;  3JAE A;  1T8B A;  2QA7 A;  3AXJ B;  3FZH B;  3Q2M A;  3TLS A;  4KUM B;  3ZMT B;  2V6X A;  3ZN0 B;  2ZM6 T;  5CA0 E;  2QRX A;  2W0G A;  3OVU A;  2NW7 A;  3N9N A;  5E0O A;  3LG7 A;  2VB6 A;  2X0Y A;  2CBJ A;  2WCA A;  4ZOL E;  3QNU A;  4DV4 T;  3ZN1 B;  3KVA A;  1HR0 T;  5IHY A;  4NPP A;  1O3X A;  4H9N C;  2RP4 A;  1J1J A;  2H7O A;  4TN7 B;  3RC3 A;  3AE9 A;  1OED A;  3UU5 A;  3UFE A;  2N9D A;  1SE7 A;  2CLY C;  2CM0 A;  4KBM B;  4CN1 A;  4DR1 T;  3T8O A;  1NAF A;  4HWF A;  3CIR A;  2D2S A;  4QH4 A;  2Y8D A;  2A2F X;  3A7M A;  3C4W A;  4H9R C;  1HG5 A;  2MYS A;  3AE4 A;  4B6X A;  3ZT6 A;  2V1D B;  4EZ4 A;  5BMV E;  2UUA T;  3ESL A;  4IE4 A;  1FIO A;  4GKJ T;  4JYA T;  4ZI3 D;  3RKO A;  2A72 A;  4BAY B;  3QC9 A;  3PUX F;  4ZS2 A;  2LE8 A;  2XM1 A;  4UVA B;  2BVL A;  4XAX B;  3VHL A;  2BS4 A;  3L09 A;  4EXT A;  5JDL A;  1G73 A;  2YDR A;  3HKE E;  3K3Q C;  2NTX A;  2X51 A;  5L4H A;  4BJN A;  3GN5 A;  4B3T T;  3AVR A;  4AKL A;  3LSV A;  2Q9Q B;  3H3M A;  2EHO B;  3O1I A;  4PJM A;  5FVK A;  3KDS E;  5JR9 C;  2LM2 A;  4HFE A;  4QH5 A;  1I94 T;  4LF7 T;  2KLQ A;  4OYK A;  4TV8 E;  4EIW A;  4TUY E;  4J2C A;  1I6Z A;  5ETW A;  2PFV A;  2XUE A;  3C64 A;  3Q9D A;  4PJL A;  4UXN B;  3RF1 A;  4O4L E;  2PG8 A;  4QX7 B;  3K3N A;  3I0O A;  4YSZ A;  3ANW B;  5F8P A;  5JQG E;  5JDG A;  3GA8 A;  2OLT A;  2NWB A;  2YIN A;  4JI7 T;  3EHZ A;  4PK4 A;  4ZZC A;  5ABF B;  5L3D B;  2J62 A;  1NEK A;  2KMF A;  3FZM B;  3MK7 C;  3N2K E;  4U3C A;  4JI2 T;  3DP7 A;  4JI8 T;  4GYS A;  5M4Y A;  4ISS A;  2KWI B;  3UU6 A;  4DMW A;  4GK5 E;  5L47 A;  1X9B A;  3UUL A;  2UXC T;  2WU2 A;  3KBU A;  2YK0 A;  3CQX C;  3PUQ A;  4IHJ E;  4EV6 A;  1BR0 A;  4ERR A;  2JPF A;  4IL9 A;  3AB3 B;  3EVY A;  4GK0 E;  2E9X D;  3P4W A;  4HFC A;  1HCI A;  2FBW A;  2WY2 A;  1WR6 A;  2GK9 A;  2NP9 A;  4ASK A;  1IAP A;  3HKC E;  4DID B;  4B3R T;  2J1D G;  2BBJ A;  3FHN A;  3MAC A;  5CB4 E;  3I1A A;  4QKN A;  2QVA A;  1MMA A;  4DUY T;  2V5C A;  4O4H E;  3AAI A;  4CN6 A;  5IUX A;  5HEH A;  5LMU T;  1UGO A;  4O2A E;  4NXM T;  3AA7 B;  4HN9 A;  3GN5 B;  3WI3 A;  4HWC A;  5FYM A;  3OPC A;  1KK7 A;  4Z91 A;  1XZY A;  3Q5X A;  1W0A A;  3AAA B;  3EDV A;  4AIS A;  2VQF T;  1UUR A;  2E2A A;  3RQU A;  1LKX A;  3ANW A;  1LRZ A;  1XDO A;  3UU4 A;  3T1Y T;  3SRZ A;  3E22 E;  3IBP A;  4NUV A;  4O4I E;  2MBG A;  3KV5 A;  5CFB A;  2DL1 A;  4HFI A;  3EUH A;  2A3D A;  1YQ3 A;  4UV8 B;  4CI1 B;  5J2U E;  3C51 A;  4FJO A;  3SWH A;  3K1S A;  2V5D A;  2PTF A;  4WYV A;  2V26 A;  2WS3 A;  1HFA A;  3F2E A;  5HCJ A;  1OED B;  5LP6 E;  1D0X A;  5EK2 A;  4AKR B;  2LSG A;  2XQA A;  5J2T E;  4HEA A;  4ZI2 C;  3PUG A;  2X67 A;  1B7T A;  1WLX A;  2BG9 E;  5ABE A;  2IC9 A;  3UUM A;  3ZT5 A;  5DQV A;  3KVB A;  3TKL B;  1IJ6 A;  2LSI A;  3PUW F;  5FMN A;  4HWI B;  4PW8 A;  1J5W A;  3FB2 A;  3RRC A;  4JUY A;  2CXF A;  5LCY A;  2H88 A;  1S35 A;  2MAW A;  3RRW A;  5FKY A;  5F3J A;  4IE0 A;  2JQK A;  2XQY A;  3UUX B;  3V5U A;  3UUN A;  4HE8 A;  1VCS A;  1WYB A;  2XAG B;  2KZ7 B;  2YKS A;  3CML A;  4QXH B;  4HFB A;  4YFS A;  1SUM B;  1Z0P A;  2W61 A;  5EZY E;  2VKD A;  3TLV A;  2CE7 A;  5LGU B;  1Y64 B;  5LG3 A;  3AA0 B;  2WAU A;  4PJJ A;  3ZST A;  5ABF A;  2DWG A;  5LYJ E;  2XQ9 A;  3WAK A;  1YKE B;  1XWM A;  2AE9 A;  3BQI A;  3L39 A;  2KXP B;  2BKP A;  2JJ9 A;  4EB6 E;  3AE5 A;  5FL0 A;  2NOX A;  1UCU A;  2X9H A;  3EDU A;  3ZMU B;  2H7V C;  2XTL A;  3UQ7 A;  3RYH E;  1VRB A;  4ZXL A;  3WAJ A;  4LFB T;  1ZKE A;  2XQ8 A;  4OHF A;  3E0Z A;  3LFM A;  4G63 A;  2JQ9 A;  5AQN B;  2M6I A;  4KMC A;  3G06 A;  3TLT A;  4COF A;  3ZEF B;  2Y6X A;  3OBV E;  2IW5 B;  3P4P A;  4PFO A;  2D5U A;  4EED A;  3SOL A;  4IST A;  5FY1 A;  2XAH B;  5C8Y E;  2KIN B;  3QOF A;  4M1P A;  4A56 A;  4K0K T;  2UUC T;  2PJQ A;  3AE1 A;  3X1D A;  1HS7 A;  3W15 B;  5FY7 A;  2Q9Q C;  2D9D A;  4DR3 T;  2FJB A;  4JI1 T;  2KND A;  2KWH A;  4NIQ A;  5AQO B;  4YT0 A;  1MIY A;  2IHR 1;  3R84 B;  4ILU A;  4LF8 T;  5LHI B;  5LNK A;  3RC8 A;  3H3A A;  5DAB A;  3AA1 B;  4B3S T;  1UX5 A;  3C4X A;  3LK3 B;  2V7K A;  2XAQ B;  2NTY A;  4UR9 A;  1Y01 A;  4MFR A;  4DV3 T;  1D1B A;  1ZV4 X;  4OFZ A;  5HEU A;  3QB5 A;  1E1H B;  2CA5 A;  2VL8 A;  4WZX A;  2XHE B;  4L0R A;  3ETU A;  2CPT A;  3NWI A;  4L5G A;  4X1I E;  3RGL A;  5FXX A;  3SS1 A;  2YU1 A;  2WWV A;  3RIU C;  3ZC0 A;  3PU3 A;  4ILC A;  4KX6 A;  4TNW A;  1NEN A;  2CRB A;  3AVS A;  3K3O A;  5FL1 A;  1HG2 A;  4LF9 T;  2ODV A;  4DND A;  2XAS B;  2WZH A;  4YLH A;  1US7 B;  2C5K T;  4P0B A;  3FBZ A;  5F5W A;  5JVD E;  2BDE A;  2X0L B;  3KV9 A;  4YSY A;  4YTP A;  5LXT E;  3J7Y q;  3RYI E;  3ZJ1 A;  1XDP A;  4AQY T;  3PU8 A;  2BZB A;  1IJ5 A;  1LVK A;  2LSJ A;  2P9B A;  5AQG B;  3TLW A;  1J5E T;  5GON E;  1BR2 A;  4DMV A;  3ZKR A;  1ZOY A;  3O1J A;  4PFP A;  1IBL T;  4IL4 A;  3VRA A;  3NZQ A;  2E5L T;  1ZHC A;  4TX5 A;  4U74 A;  2J47 A;  5IWA T;  4GKK T;  2Q9Q A;  2KSR A;  1KEY A;  2BKN A;  3OJA A;  4H9S E;  5AQL B;  3S4U A;  3ZYM A;  4P09 A;  3SFE A;  3HI2 A;  1XNQ T;  3OYZ A;  5AQH B;  2LSY A;  4DV6 T;  4X1Y E;  2HN1 A;  5HEG A;  4NUU A;  2EHO D;  5JTG A;  2NR4 A;  4H9P C;  4IDN A;  1LVF A;  2FUP A;  1M62 A;  2RPA A;  3GWH A;  1WRD A;  2H89 A;  2SPC A;  4IRE A;  3AEE A;  2R6G F;  4CI2 B;  4AKH A;  1FMW A;  3RLF F;  1YD8 G;  5J0Z A;  4QHO A;  2IML A;  2DHR A;  4OX9 T;  2ACX A;  2NW8 A;  2BVM A;  2OV9 A;  4JEH B;  2W67 A;  4TWH A;  4ZHQ E;  4DR5 T;  3P8C D;  2HPJ A;  1W09 A;  2WB5 A;  5CA1 E;  3PJA J;  3LDQ B;  4E7Z A;  3Q5E A;  3UQ4 A;  3PUY F;  1BR4 A;  4EGW A;  5AQU B;  2CHO A;  2LM9 A;  2VVS A;  3KV4 A;  4H9O C;  4AI6 A;  5HXE A;  3FBL A;  3H37 A;  2WU5 A;  4QX8 B;  4BA9 A;  4WBN E;  2V7M A;  4B3M T;  4KHZ F;  1N32 T;  2XQ3 A;  3F31 A;  2IDO B;  3PUR A;  4WBO A;  3UT5 E;  1ZP0 A;  1KF6 A;  3RI5 A;  1Z8U A;  4QXB B;  4UVC B;  4L9I A;  4EOZ B;  4JEU B;  5ABH A;  2KT9 A;  5LA6 E;  2K5B B;  3V5S A;  3HR0 A;  2HH7 A;  2WZI A;  4DUZ T;  2VKJ A;  1H7C A;  5AQJ B;  5LHG B;  2UXD T;  2WQY A;  5L3F B;  3KIN B;  4DO0 A;  2WBL A;  1EZ3 A;  1R8I A;  3VR8 A;  2WDR A;  4DV7 T;  2LRK A;  2Q9Q D;  3JCF A;  4ANJ A;  4F6R C;  4YSX A;  3HKD E;  3AEC A;  3AE8 A;  2HN2 A;  3ZJ2 A;  5HEJ A;  3IF8 B;  2CXD A;  2AXD S;  2L3L A;  2ZM0 A;  3AE3 A;  4LMJ A;  1YXR A;  4AXP A;  4LF6 T;  4AKI A;  2LRL A;  2W2U A;  3VKG A;  1MNE A;  2V7J A;  5JDN A;  1MIV A;  2LEH A;  2X9W A;  1HNZ T;  2VKO A;  2XSB A;  1MMG A;  5CGM A;  3B13 A;  5AQK B;  1WYC A;  1X79 A;  4IDZ A;  5AQP B;  3RX6 A;  4A97 A;  5KX5 E;  2UUB T;  3P4R A;  4PAG A;  2VK9 A;  1IBM T;  4YJ2 E;  3RYF E;  2VAS A;  2JIW A;  3UFG A;  1FJG T;  3IEE A;  5LG4 A;  3N5L A;  4O2B E;  4F8H A;  4DV0 T;  3L8R A;  3M65 A;  2IIU A;  5J1G A;  3BQK A;  2JMK A;  5AQR B;  3NKZ A;  2K24 A;  1DU2 A;  1T7S A;  3CVR A;  4YHJ A;  3HKB E;  4ZI7 E;  5H6Q B;  3OTO T;  4EZH A;  3O4X E;  2ODU A;  2VVN A;  3LJC A;  4LMK A;  4MLK A;  2J4G A;  3ONJ A;  4C90 A;  4ZI2 D;  4CZZ B;  4X62 T;  2WP9 A;  4HGA A;  2CXL A;  1U4Q A;  2C5I T;  2IAK A;  4AQF A;  5L3B B;  2DLR A;  1T72 A;  3AEA A;  3JAD A;  3RIU A;  2YEV C;  5CJ5 A;  3RPU A;  4K0U A;  3O1H A;  5L3E B;  4JI0 T;  3NBX X;  2ACZ A;  4DV5 T;  1D0Z A;  4I0U A;  4Q25 A;  3IA3 A;  4KHP T;  3R6N A;  4Z90 A;  3RH3 A;  1XMO T;  4JI3 T;  4TNV A;  3O9X A;  2I59 A;  4O8S A;  5DJQ C;  4ZEY A;  4ILB A;  2LKG A;  2CHN A;  3AEG A;  3MXZ A;  2N2N A;  4JLE A;  1YKH B;  4UEL A;  1ZEE A;  3EI0 A;  3IHR A;  4XBF B;  4AKG A;  3ZMV B;  2BG9 C;  2XPK A;  4QWN B;  3MJX A;  3RHW A;  3UTK A;  2FJE A;  2YN6 A;  3L3P A;  1IZN B;  1VCT A;  3LK4 2;  5H6R B;  1N34 T;  1FEW A;  1HX1 B;  1KFY A;  2XJ7 A;  3LK2 B;  5JR9 A;  3ZYK A;  4YHH T;  1IBK T;  2XY8 B;  3FZF B;  1V9D A;  3JC6 D;  3N9M A;  3P4Q A;  5JDF A;  4TZ4 C;  2D0U A;  3JAF A;  3CK6 A;  3FXD B;  5DQW A;  4KP3 C;  3CPZ A;  3UU3 A;  5AQF B;  4IGU A;  3CKD A;  4MHC A;  5FXW A;  2CWY A;  2CBI A;  3CX6 B;  4EYU A;  4G2A A;  5C2T A;  4AQF C;  1OWA A;  3AEB A;  3HA4 A;  4PJN A;  4YTM A;  4OYJ A;  5AQS B;  5JRC A;  2DNX A;  2QYW A;  3BQL A;  2H3R A;  2W62 A;  2LKH A;  2LSK A;  4YJ3 E;  4UEM A;  4X5T A;  4AQG A;  3KBT A;  4I50 E;  1HNW T;  4U72 A;  4CXY A;  3ETV A;  3AA6 B;  3A5X A;  5JDM A;  1JNR A;  2EHO A;  2MPK A;  3PV0 F;  2VKH A;  3AE7 A;  4EEB A;  4LF5 T;  5JDQ A;  1UX4 A;  2IC6 A;  3AAE B;  2M6B A;  1FMV A;  1MMN A;  4YTN A;  1D1C A;  2G0U A;  5ADX L;  3RYC E;  2F4V T;  2L9Q A;  3NRX A;  4GIW A;  2MTQ A;  2PBI A;  3RQW A;  1D0Y A;  4JI6 T;  1BR1 A;  2XQ5 A;  4UVB B;  4H63 H;  2WDQ A;  5AQM B;  4X20 E;  4U7I A;  2BG9 B;  4UF0 A;  5LJM A;  3CX7 B;  4JI5 T;  4DV1 T;  3FZK B;  5ABG A;  4TWF A;  3K8P C;  1MND A;  1YW0 A;  4U33 A;  5AQI B;  2C5J A;  3ABV A;  3N2G E;  4IE5 A;  2CLY B;  3RKG A;  3B57 A;  4X64 T;  4HKA A;  4U31 A;  3VR9 A;  5HAX A;  4IDP A;  5C3J A;  2E9X A;  3QUJ A;  2ZMA A;  3D0T A;  5AFU L;  3NZP A;  3ONL C;  1MMD A;  2N1G A;  4P1N A;  3AE6 A;  3PUA A;  5IYZ E;  5L2L A;  2A9U A;  1HF8 A;  2UXX B;  3I9Y A;  2LOP A;  3N2O A;  4QXC B;  3LBX B;  2X9X A;  4CXW A;  4EYY R;  2DCF A;  2L8K A;  4YY3 T;  4PK5 A;  1XNR T;  2JMH A;  3N9P A;  3ZLI A;  1GQE A;  1WFD A;  2W63 A;  3MA9 A;  1UUS A;  3FZL B;  4MBQ A;  1OED E;  5HXC A;  5TAO A;  3VRB A;  2V7L A;  4FI5 A;  3ZSS A;  4CN4 A;  4C91 A;  5HXH A;  2EHO C;  1WCR A;  4DVD A;  1XMQ T;  3PUS A;  3T1H T;  1AJ3 A;  3TLU A;  2WMO A;  2BBH A;  2E5V A;  2XSA A;  3FXE B;  3RIF A;  4DR4 T;  4HWD A;  5LB7 B;  4UIG A;  4V1A v;  4WW0 A;  4I4T E;  5LOV E;  2BG9 A;  4IT4 A;  4IDO A;  4X65 T;  5HEO A;  2VUR A;  5FVL A;  1NWM X;  3KFW X;  5FY0 A;  4YXD A;  2CMR A;  1VOM A;  5LBQ B;  4P0A A;  1QUU A;  2BS3 A;  3Q5D A;  3ZMS B;  2E8I A;  2W4X A;  3PE0 A;  2V7I A;  2XZE A;  3EAM A;  2YDS A;  3PDY A;  3PTR B;  3AE2 A;  5HXR A;  3OYX A;  2UXN B;  3CX8 B;  4HFV A;  5JDH A;  2DI4 A;  1KNP A;  4DBR A;  4A98 A;  2VL0 A;  4HFD A;  3J9X 1;  1JNZ A;  1G8X A;  2UXB T;  5JRC B;  4U2Z A;  2V8S V;  4A5X A;  2YDQ A;  3CWZ B;  5AQT B;  2WDV A;  2WM9 A;  2NW9 A;  5LGT B;  5L3C B;  2WSS V;  2LJL A;  2B1E A;  2E9X B;  5AQQ B;  3QK6 A;  3DTO A;  2ZLY A;  1SA0 E;  4UF0 B;  2LHN A;  2MOZ A;  4WNK A;  3RIA A;  2YU2 A;  2X0H A;  3CQG B;  3UU8 A;  3DJB A;  1CUN A;  4MAL A;  5KXJ A;  4O4J E;  4BJM A;  4LFC T;  3UUB A;  2I6H A;  2CEA A;  2X68 A;  1OXZ A;  3AXJ A;  3ZPO A;  4IIJ E;  2LOS A;  5A1L A;  3ZT7 A;  4IDQ A;  3A8Y C;  4CQI A;  5JR9 B;  5FNV E;  2K48 A;  3AEF A;  3C50 A;  3HL6 A;  2K9A A;  4QH1 A;  3SFD A;  2FJD A;  1WR0 A;  1D1A A;  2LHR A;  2XQ6 A;  2XQ4 A;  2XAF B;  3N9L A;  2D0T A;  5LGN B;  2E9X C;  4U7Y A;  4JV5 T;  3E08 A;  2FJA A;  2YOE A;  2M67 A;  3ONX A;  4U2Y A;  4ZI3 C;  4ZS3 A;  2V6Y A;  5FP3 A;  4X1K E;  4TV9 E;  4EAH A;  3BK9 A;  4AIU A;  5BR8 T;  4HWH A;  4JBW F;  4JI4 T;  4GOU A;  2JQH A;  3P4S A;  1UK5 A; 
#chains in the Genus database with same CATH homology
 1HNX T;  1XNQ T;  4LFA T;  4B3R T;  5LMU T;  4DR7 T;  2HHH T;  1HNW T;  4DUY T;  2VQE T;  4NXM T;  4LF5 T;  2F4V T;  4DR5 T;  2VQF T;  2UU9 T;  4JI6 T;  1N36 T;  4DV2 T;  3T1Y T;  4JI5 T;  4DV1 T;  5LMN T;  4X64 T;  1N32 T;  4B3M T;  4DR6 T;  4DR2 T;  4JI3 T;  4DUZ T;  1N33 T;  4YY3 T;  1XNR T;  4NXN T;  2UXD T;  4X66 T;  4DV6 T;  4LF4 T;  4DV7 T;  1XMQ T;  3T1H T;  2ZM6 T;  4OX9 T;  4DR4 T;  4X65 T;  4LF6 T;  4DV4 T;  1HNZ T;  1HR0 T;  5IWA T;  2UUB T;  4LFB T;  1IBM T;  1FJG T;  4DV0 T;  2UUA T;  4JYA T;  2UXB T;  4GKJ T;  4K0K T;  2UUC T;  3OTO T;  4DR3 T;  4X62 T;  4JI1 T;  4LF8 T;  4B3S T;  4B3T T;  4DR1 T;  1I94 T;  4JI0 T;  4LF7 T;  4DV5 T;  4DV3 T;  4LFC T;  4KHP T;  4GKK T;  1XMO T;  2UXC T;  4LF9 T;  4JI7 T;  4JV5 T;  4AQY T;  4JI2 T;  1N34 T;  4YHH T;  1J5E T;  1IBK T;  4JI8 T;  5BR8 T;  1IBL T;  4JI4 T;  2E5L T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...