1HNZT

Structure of the thermus thermophilus 30s ribosomal subunit in complex with hygromycin b
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
99
structure length
99
Chain Sequence
b'RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAVQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title The structural basis for the action of the antibiotics tetracycline, pactamycin, and hygromycin B on the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 37
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2000-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 1hnzT00
4DV3T 2UXDT 4B3ST 2UXBT 4DV7T 2F4VT 1HNZT 2VQET 1FJGT 4DUZT 1N36T 4DV1T 4DV6T 4JI8T 1N32T 4DR3T 4YHHT 4DR4T 4DR1T 4JV5T 2UUAT 4JI3T 5LMUT 2UUBT 2UXCT 4NXMT 4KHPT 4OX9T 4LFAT 4JI2T 4DV4T 2E5LT 4GKJT 3T1YT 4LF5T 1I94T 4LFBT 4B3TT 4NXNT 4LF7T 4AQYT 4K0KT 4DR6T 4B3MT 4JI4T 4DR7T 4LFCT 2UU9T 4X65T 5LMNT 4DUYT 4DV0T 4LF8T 5IWAT 1HR0T 1IBLT 4GKKT 5BR8T 2VQFT 4LF4T 1N34T 4DR5T 1XMOT 1XNRT 1J5ET 4JI0T 3OTOT 4LF6T 1IBMT 2ZM6T 2HHHT 4YY3T 1N33T 4X64T 4DV2T 4DR2T 1IBKT 4X62T 4JI1T 1HNWT 4B3RT 1XMQT 4LF9T 4X66T 1HNXT 4JI7T 4DV5T 2UUCT 4JYAT 4JI5T 4JI6T 3T1HT 1XNQT
chains in the Genus database with same CATH superfamily
4HFBA 4DV3T 2X0LB 4CI2B 3RYFE 3Q2MA 4ILBA 5JVDE 2FJDA 3H37A 4WBNE 4UF0A 2BBHA 3PUAA 5LGNB 4HFVA 4L5GA 5DQWA 4L9IA 2W00A 5JR9B 3VKGA 3NKZA 2H88A 4IE5A 3AA0B 3RX6A 4EGWA 2E9XC 2X0YA 4EYYR 4U2ZA 4LF7T 2K3WA 4OHFA 4ISTA 5L3EB 2LM2A 3L09A 2DHRA 4F8HA 1U4QA 3ONLC 5C8YE 2H3RA 3KVBA 4AXPA 3OYZA 2WCAA 3RHWA 4GK5E 2MAWA 5CA1E 2LT3A 4JEUB 2RA1A 4UF0B 3FZHB 4QKNA 4TNWA 5FVLA 1HX8A 2LSJA 3NBXX 3K3NA 4DVDA 2RP4A 5AQQB 4IREA 3EUHA 5HYAA 5HEOA 5AQPB 1YKEB 1D1AA 4B3RT 1FEWA 3HKBE 1DU2A 3PUZF 2KXPB 2DCFA 5HEHA 1OEDB 2IC6A 1N32T 1HF8A 3ZMSB 1KNPA 4PK4A 2MYSA 2CLYC 1CUNA 2DWKA 1UURA 3N2GE 5HAXA 3VRBA 2V7MA 3IA3A 1I94T 3AA6B 4B3TT 2I6HA 4U72A 4DR6T 1ZEEA 2C5JA 3B13A 3NWIA 1WRDA 4DR7T 2JPFA 2C5KT 1US7B 1Y64B 3CX6B 2VURA 4B6XA 2H89A 1YXRA 5LA6E 3RIFA 5L4EA 2KWHA 5AQLB 1W9RA 5A1LA 1HX1B 2WDQA 5FKYA 3BK9A 4Z8XA 2K5BB 2NW9A 2PJQA 3ZMVB 2N1GA 2LHRA 4TV9E 2ZM6T 3EDUA 5L3BB 2JQHA 3P50A 4IDQA 2YOEA 2D5UA 3AE3A 2DWGA 3UUMA 3VR9A 1YW0A 1ZV4X 4ISSA 4YTMA 3PUWF 5JDFA 1UK5A 2A3DA 2UXDT 4B3ST 4UIGA 1BR4A 4U33A 1N36T 2CHOA 4JI8T 3MA9A 4QXBB 4WYVA 4TV8E 2VASA 1SHZC 1WR0A 4DBQA 3N9QA 3H3AA 3UFEA 4ZI7E 2YINA 5AQFB 5JR9C 1W0AA 3VU7H 3I0QA 2J1DG 2BS3A 4HWHA 1QUUA 2AE9A 1WYBA 4OK0A 4GYSA 2XASB 1BR1A 5GONE 2OLTA 5AQJB 3UFGA 4LFCT 2D0TA 3FXEB 2KSRA 5LHGB 1NENA 1OWAA 4ILUA 3ZYMA 2Y48B 2W0GA 3CX7B 4PJJA 4HN9A 4Q25A 5HXSA 2ZM2A 1XMOT 1XNRT 5FL0A 3AEBA 2IHR1 3V5SA 3RH3A 5CA0E 3AE4A 3ZN0B 2VKJA 3N5LA 2JQQA 3UU8A 3DTOA 4PFPA 4O8SA 4EEDA 3A8YC 4EZ4A 3B5MA 3C64A 4YLHA 2A2FX 4Z91A 2MOZA 1J1JA 5EK2A 3W15B 3RYHE 3RPUA 4Z90A 4PJMA 4X5TA 4COFA 4CZZB 2CBJA 3MXZA 5JREA 2CBIA 4DR1T 1ZP0A 2K9AA 3ZC1A 3E22E 5ABHA 4UEMA 3UQ4A 2MPKA 2BKPA 2V7JA 5H6RB 5FNVE 3ZT5A 2FUPA 4O4JE 1M62A 1V9DA 4TUYE 3AE7A 4EXTA 4YJ3E 2XAGB 1W09A 2WU2A 3RKGA 4EZHA 4LF8T 4HKAA 4I0UA 2WDVA 5LG4A 3K1SA 5DQVA 4X1IE 4DIDB 1H7CA 4EAHA 2LJLA 3Q5XA 4LF6T 4IDPA 5HXHA 4YTNA 5F8PA 2I59A 1MMDA 1YQ4A 1JNRA 3KBUA 5HWXA 1VRBA 3RIUA 4XZCA 4H9SE 2HPJA 3MK7C 3R6NA 1X9BA 3TKLB 3ZLIA 4QH4A 5KMGP 5LB7B 4O4LE 4MBQA 2XQ5A 3MJXA 5BMVE 3IF8B 4ADZA 1L0VA 5CB4E 2DNXA 2ZLYA 2W67A 4H63V 3U3IA 2CRBA 2QA7A 2V7IA 2CM0A 4EV6A 4LFAT 4QX8B 1HTJF 4KI0F 3ONJA 3UUNA 1SA0E 4H63H 3T1YT 3BQIA 3ZMZB 2XUEA 4B3MT 2LOSA 3HL6A 4AISA 1WLXA 3UT5E 1E2AA 4ZOLE 2XQAA 3VRAA 5IWAT 3CPZA 4TNVA 3ZN1B 3P4PA 1J5WA 2H7VC 1W0BA 3AEGA 3PUGA 2V8SV 3LFMA 3UU4A 4QHOA 1G8XA 3P7IA 4YY3T 1D0ZA 2XPKA 2VL8A 2JQKA 4ZXLA 2EHOC 5CGMA 4DO0A 2FBWA 4LF9T 3N9PA 5C2TA 5JDMA 4JI6T 4CXWA 2X9HA 3NRYA 2JRKA 1O3XA 3PU3A 2XAFB 5FYMA 2WQYA 3FBLA 4IE4A 4DV6T 3EHZA 3KBTA 4IE7A 4PJNA 2XM1A 3EABA 2NP9A 4JI3T 5LMUT 2UXCT 4KHPT 2X9XA 4CI1B 3CMLA 3A7MA 3B57A 1R8IA 5L3CB 2IUBA 2JIWA 2E5VA 3KDSE 2D0UA 2MTQA 4AI6A 2JMHA 3RI5A 1E1HB 2WY2A 2KZ7B 4HFCA 4X1YE 4JEHB 4GK0E 3OPCA 2BG9A 2V6YA 2VL0A 4V1Av 5LG3A 1XDOA 1SE7A 4DV0T 3AA7B 3PUSA 3ZT7A 2EHOD 4O2AE 2VWAA 2KMFA 4MHCA 4HFHA 5ABEA 2N2NA 4PJLA 3TLTA 4A56A 2Y8DA 3OTOT 5AQGB 1T7SA 5M4YA 3LSVA 3BQKA 1OEDA 4CN6A 2HHHT 4ZZBA 4WBOA 2CXLA 4YTPA 2WMOA 4O4IE 3ETVA 4KUMB 2Q9QA 1HNWT 4CQIA 4N78D 4DV5T 3JADA 3TLUA 1ZHCA 4IL9A 1Z0PA 3CVRA 5LBQB 2BG9B 3H3MA 4DV7T 3LK42 1UUSA 2V6YB 2DL1A 3UU3A 4PFOA 4PK5A 4TN7B 2BVLA 4F6RC 3UU6A 1ZOYA 3EAMA 4KBMB 4YSZA 5FY0A 2R6GF 4IDOA 5HXEA 2FJEA 3ZMUB 2VVSA 4QXCB 3UQ7A 2BS2A 4U2YA 3P4SA 1WFDA 2VKOA 3VHLA 3HR0A 4U3CA 3T8OA 4CXYA 4LMLA 2LE8A 3RIUC 2Q9QB 2M6BA 2WB5A 3UTKA 4JI4T 4NUVA 2UU9T 4IHJE 3OVUA 3GN5A 5IHYA 3M3ZB 2VKHA 3C4WA 3ESLA 1N34T 2KINB 2BZBA 2ZM0A 4ILAA 4YXDA 1D1BA 4AQGA 1MIVA 2BBJA 1LVFA 3OKQA 4PNIA 1QSDA 4BJNA 4I50E 2YDQA 2JQ9A 2WAUA 4QWNB 3F2EA 3PJAA 2D2SA 2QYWA 4IE6A 5LXTE 1D0YA 2QRXA 4NIQA 2VB6A 2W61A 2IAKA 3MACA 4G2AA 1MIYA 2UXBT 3A5XA 2J4GA 3GN5B 2V7LA 2XZEA 4KP3C 3K3OA 3C51A 3EI0A 4HWCA 4YHHT 1S35A 3O1HA 3RYIE 2XAHB 4DR4T 3N2OA 4IE0A 4P1NA 4NUUA 2PFVA 1LKXA 2UUBT 2RPAA 2CXFA 2HPLA 4PK6A 4X20E 3ZYKA 2X51A 3UULA 3DJBA 1HFAA 3SOLA 4O2BE 4MLKA 2VVNA 4QH5A 3F31A 2CXDA 1KFYA 4WZXA 3Q5DA 2W62A 1U5PA 5HXCA 1KK7A 3NVOA 4EEBA 2PBIA 2X68A 4PW8A 4C91A 1IBLT 3R84B 3V5UA 3O1IA 2WBLA 5LYJE 2CHNA 3ZCJA 3RQWA 4HFIA 2OA5A 2ZMAA 1YD8G 3EVYA 2SPCA 3JCFA 4BAYB 2K24A 4TWFA 1VOMA 5AQSB 3HI2A 5FXZA 4AQFA 5C3JA 1UX4A 5H6QB 3CWZB 4X62T 3AAIA 4E7SA 1AJ3A 4H9QC 3AEAA 4P0AA 5DJQC 3I9YA 2VQET 4IDNA 4OFZA 4DV1T 2KWIB 3GMIA 1IAPA 3FZFB 4H9NC 5LHIB 2V1DB 5LBMA 5JDGA 3TLWA 4ILCA 1FMWA 2BKNA 3ONXA 4UV8B 4L0RA 3N9OA 2CMRA 1OEDC 4ZI3D 4CXXA 2WZIA 4DV4T 2IMLA 2YU1A 4CN1A 1MMGA 4GOUA 1VCTA 2YDRA 2DI4A 4ERRA 4GIWA 2YKSA 2NWBA 1IJ5A 2WZHA 1S94A 5LMNT 2E9XA 2CWOA 5JRCA 1HR0T 4UV9B 3CKDA 2H7OA 5EK4A 2CCQA 2ODVA 1WR6A 3QK6A 4X64T 3CQGB 3HKDE 4PAGA 3P4RA 3OYXA 4DMVA 5AQVB 4ASKA 3UU5A 5AQHB 2XHEB 4I43B 2E8IA 2UXNB 3RLFF 3C98B 3UUXB 1OXZA 2YN6A 1HNZT 3LK2B 1NAFA 3EDVA 2E9XB 1M7KA 2JMKA 5JRCB 2V5CA 5LGUB 1GQEA 2FJAA 2WMNA 1WYCA 3AVSA 3WAJA 3LBXA 5HCMA 1KNRA 4HE8A 3CQXC 4LFBT 3AEEA 3I1AA 5EK3A 3LG7A 3RC8A 5CJ5A 4ZS3A 5HEJA 3AE2A 2W63A 4LMKA 3HKCE 4JUYA 1EZ3A 4YJ2E 3C4ZA 4DUYT 3U78A 5TAOA 2IW5B 3RRWA 2XSBA 3K3QC 4LF4T 3FHNA 2NR4A 3LBXB 5FXVA 4O4HE 2NW8A 2YU2A 4OYJA 5LJNA 1IBMT 2HN2A 2MBGA 3SFDA 4DV2T 4DR2T 3RRCA 1XDPA 3ABVA 2CPTA 2CLYB 5L3DB 2XAJB 2V7KA 4M1PA 2K48A 1D0XA 1ZKEA 2HN1A 5DABA 1HG2A 1T98A 2B76A 5ABFA 4H9OC 2L3LA 5FY1A 4JV5T 4UVAB 4E7ZA 3NZPA 3WAKA 2YEVC 5AFUL 3LDQB 3NRXA 5F5WA 1NEKA 3KV6A 5HXRA 4CI3B 2E5LT 3PJAJ 1YKHB 1HS7A 3PTRB 1I6ZA 3MKDA 4P09A 2J62A 5KXJA 5JDLA 4H9RC 1MMNA 2LRKA 3Q5EA 4ANJA 5ABFB 3SWHA 3D0TA 3Q9DA 4BJMA 5HEGA 3HA4A 2XJ7A 2WU5A 3AE8A 2ACZA 1B7TA 1XWMA 2NW7A 3RQUA 3SFEA 3RYCE 3ZYLA 5J2UE 1SUMB 4HGAA 1LRZA 4QXHB 5LP6E 3PV0F 4AIUA 4YT0A 5FVKA 2LRLA 5AQIB 5ADXL 3AE6A 3KV4A 1KNZA 4JYAT 3ZSSA 3FXDB 3K8PC 1XNQT 1NWMX 4A5XA 4J2CA 4TZ4C 2YK0A 1E7PA 1X79A 3OJAA 4TWHA 3IHRA 3AA1B 1KEYA 5FY7A 2C0SA 4OX9T 5LOVE 4WW0A 5JDNA 5HCJA 5FXXA 2KNDA 3FBZA 1FMVA 3ZKRA 3RF1A 4XBFB 3KV9A 4AQYT 3LK3B 3LJCA 5AQKB 5J2TE 1JNZA 3E0ZA 3KVAA 4ZHQE 5ABGA 5JTGA 3O9XA 4UVBB 4AKGA 3PUQA 2A72A 2L9QA 5JH7E 1Z8UA 3RKOA 5LGTB 1HG5A 3AAAB 4YSXA 1XZYA 4YFSA 4FI5A 1J5ET 2YDSA 2E9XD 4KX6A 5HEUA 2LKGA 2LOPA 2E2AA 3AAEB 2CE7A 4C90A 3P4WA 4MALA 4JI7T 3HKEE 4JI5T 3T1HT 4U7YA 5FMNA 4UELA 5L3GB 2XTLA 5J1GA 2UXXB 2Z6EA 4U7IA 2C5IT 1HCIA 3FZMB 4NPPA 4UVCB 3J9X1 2CWYA 2BVMA 2IDOB 3AECA 4EYUA 3FZLB 5FP3A 3E08A 3S4UA 2W4XA 2W2UA 3ZJ1A 3JC6C 2PG8A 3PDYA 4JI2T 5AQRB 2XQ8A 4EB6E 5LHHB 3QB5A 2XQ6A 4BA9A 2VK9A 4QH1A 2FJBA 5AQNB 3WI3A 3AB3B 3TLVA 4KMCA 2M6IA 2XM2A 1VCSA 5KX5E 5AQUB 3SRZA 4XAXB 4I55E 2VQFT 2I0MA 4U74A 1FIOA 3PE0A 2B1EA 3KFWX 5FXWA 1G73A 3QNUA 5L2LA 3PUXF 4CN4A 5L47A 2LHNA 4TWDA 2XQYA 4ZI3C 3ZT6A 2IIUA 3L8RA 3ZEFB 4FJOA 2X9YA 4UXNB 1XMQT 2LM9A 3ZJ2A 5KDMC 1HNXT 2UUCT 3G06A 3JC6D 1MNDA 3P4QA 3TLSA 3PUVF 4AKHA 5IYZE 4DMWA 2F4VT 1D1CA 4U31A 2LLYA 1FJGT 4GYRA 3ZC0A 2GK9A 1UCUA 2XAQB 2EHOA 5L3FB 3AEFA 2OV9A 4ZI2C 2WM9A 1QLBA 1IZNB 2BG9C 3CQCB 1MMAA 2L8KA 3QC9A 5CFBA 4EOZB 3KINB 4A98A 1Y01A 2WP9A 1MNEA 1LVKA 3ZCIA 2BKOA 3PUYF 3L39A 5AQTB 3AVRA 4IGUA 3NZQA 3QOFA 3I0OA 2PTFA 4HFDA 2EHOB 4DNDA 2NTYA 2Q9QC 2N9DA 2M67A 3JAEA 1T8BA 3C50A 3RIAA 2CEAA 1T72A 4JI0T 5AQMB 3AEDA 4EIWA 3O4XE 2XQ7A 1YQ3A 2XQ9A 5FL1A 5ETWA 2NTXA 1IBKT 5LNKA 4ZI2D 3F57A 3C4XA 4X66T 1IJ6A 5AQOB 4DUZT 3IBPA 2X66A 2QVAA 2DLRA 3AE1A 3ZPOA 2QGSA 5EZYE 4DR3T 3OBVE 3QUJA 4H9PC 2UUAT 2X0HA 4HWDA 2KT9A 4NXMT 2WS3A 4JLEA 3J7Yq 5JDQA 4GKJT 4I4TE 4LF5T 4NXNT 2Q9QD 3JAFA 4QX7B 4K0KT 3RGLA 3RC3A 2J47A 3N2KE 4AKIA 4WNKA 3L3PA 4HTEA 3CIRA 4G63A 3FB2A 3AXJA 4KHZF 2XY8B 3ZSTA 2G0UA 4GKKT 5BR8T 2A9UA 3VR8A 2BDEA 3ANWA 4DR5T 2ODUA 5LJMA 2X67A 5JDHA 5L4HA 5IUXA 2XSAA 3AE9A 3CK6A 2ACXA 5HWYA 2BG9E 2Y6XA 3N9MA 2V6XA 2LSIA 4IL4A 5JQGE 4JI1T 4DBRA 3IEEA 4A97A 2NOXA 4HFEA 3GA8A 1BR2A 3M65A 3AE5A 4UR9A 2WWVA 3UUBA 1UGOA 2XQ3A 4IT4A 2CA5A 2P9BA 3AXJB 1OEDE 3PU8A 2LSYA 3PURA 2XQ4A 2ES0A 4ZZCA 5LCYA 3Q5WA 4YSYA 2W66A 4HEAA 3ANWB 2VKDA 4K0UA 3I9WA 1CHUA 1WCRA 4JBWF 2BS4A 3GWHA 2WWUA 4AKRB 4IDZA 3CX8B 3DP7A 2V26A 3O1JA 4AKLA 5J0ZA 2KLQA 2LKHA 2LEHA 2X9WA 1UX5A 4ZEYA 2ZM8A 4X65T 4ZS2A 2D9DA 2IC9A 3SS1A 1MIWA 2WSSV 3MZKB 3ZMTB 1KF6A 4P0BA 2AXDS 3KV5A 4OYKA 2JJ9A 3FZKB 3ETUA 5F3JA 4TX5A 4AQFC 3P8CD 5E0OA 4IIJE 4HWIB 5JR9A 4X1KE 2HH7A 2LSGA 1BR0A 3X1DA 4MFRA 1N33T 3N9NA 2WDRA 3VKHA 2V5DA 3N9LA 4LMJA 4YHJA 2LSKA 3QB5K 4HWFA 3BQLA
chains in the Genus database with same CATH topology
4DV3T 2UXDT 4B3ST 2UXBT 4DV7T 2F4VT 1HNZT 2VQET 1FJGT 4DUZT 1N36T 4DV1T 4DV6T 4JI8T 1N32T 4DR3T 4YHHT 4DR4T 4DR1T 4JV5T 2UUAT 4JI3T 5LMUT 2UUBT 2UXCT 4NXMT 4KHPT 4OX9T 4LFAT 4JI2T 4DV4T 2E5LT 4GKJT 3T1YT 4LF5T 1I94T 4LFBT 4B3TT 4NXNT 4LF7T 4AQYT 4K0KT 4DR6T 4B3MT 4JI4T 4DR7T 4LFCT 2UU9T 4X65T 5LMNT 4DUYT 4DV0T 4LF8T 5IWAT 1HR0T 1IBLT 4GKKT 5BR8T 2VQFT 4LF4T 1N34T 4DR5T 1XMOT 1XNRT 1J5ET 4JI0T 3OTOT 4LF6T 1IBMT 2ZM6T 2HHHT 4YY3T 1N33T 4X64T 4DV2T 4DR2T 1IBKT 4X62T 4JI1T 1HNWT 4B3RT 1XMQT 4LF9T 4X66T 1HNXT 4JI7T 4DV5T 2UUCT 4JYAT 4JI5T 4JI6T 3T1HT 1XNQT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV3 T;  2UXD T;  4B3S T;  2UXB T;  4DV7 T;  2F4V T;  1HNZ T;  2VQE T;  1FJG T;  4DUZ T;  1N36 T;  4DV1 T;  4DV6 T;  4JI8 T;  1N32 T;  4DR3 T;  4YHH T;  4DR4 T;  4DR1 T;  4JV5 T;  2UUA T;  4JI3 T;  5LMU T;  2UUB T;  2UXC T;  4NXM T;  4KHP T;  4OX9 T;  4LFA T;  4JI2 T;  4DV4 T;  2E5L T;  4GKJ T;  3T1Y T;  4LF5 T;  1I94 T;  4LFB T;  4B3T T;  4NXN T;  4LF7 T;  4AQY T;  4K0K T;  4DR6 T;  4B3M T;  4JI4 T;  4DR7 T;  4LFC T;  2UU9 T;  4X65 T;  5LMN T;  4DUY T;  4DV0 T;  4LF8 T;  5IWA T;  1HR0 T;  1IBL T;  4GKK T;  5BR8 T;  2VQF T;  4LF4 T;  1N34 T;  4DR5 T;  1XMO T;  1XNR T;  1J5E T;  4JI0 T;  3OTO T;  4LF6 T;  1IBM T;  2ZM6 T;  2HHH T;  4YY3 T;  1N33 T;  4X64 T;  4DV2 T;  4DR2 T;  1IBK T;  4X62 T;  4JI1 T;  1HNW T;  4B3R T;  1XMQ T;  4LF9 T;  4X66 T;  1HNX T;  4JI7 T;  4DV5 T;  2UUC T;  4JYA T;  4JI5 T;  4JI6 T;  3T1H T;  1XNQ T; 
#chains in the Genus database with same CATH topology
 4HFB A;  4DV3 T;  2X0L B;  4CI2 B;  3RYF E;  3Q2M A;  4ILB A;  5JVD E;  2FJD A;  3H37 A;  4WBN E;  4UF0 A;  2BBH A;  3PUA A;  5LGN B;  4HFV A;  4L5G A;  5DQW A;  4L9I A;  2W00 A;  5JR9 B;  3VKG A;  3NKZ A;  2H88 A;  4IE5 A;  3AA0 B;  3RX6 A;  4EGW A;  2E9X C;  2X0Y A;  4EYY R;  4U2Z A;  4LF7 T;  2K3W A;  4OHF A;  4IST A;  5L3E B;  2LM2 A;  3L09 A;  2DHR A;  4F8H A;  1U4Q A;  3ONL C;  5C8Y E;  2H3R A;  3KVB A;  4AXP A;  3OYZ A;  2WCA A;  3RHW A;  4GK5 E;  2MAW A;  5CA1 E;  2LT3 A;  4JEU B;  2RA1 A;  4UF0 B;  3FZH B;  4QKN A;  4TNW A;  5FVL A;  1HX8 A;  2LSJ A;  3NBX X;  3K3N A;  4DVD A;  2RP4 A;  5AQQ B;  4IRE A;  3EUH A;  5HYA A;  5HEO A;  5AQP B;  1YKE B;  1D1A A;  4B3R T;  1FEW A;  3HKB E;  1DU2 A;  3PUZ F;  2KXP B;  2DCF A;  5HEH A;  1OED B;  2IC6 A;  1N32 T;  1HF8 A;  3ZMS B;  1KNP A;  4PK4 A;  2MYS A;  2CLY C;  1CUN A;  2DWK A;  1UUR A;  3N2G E;  5HAX A;  3VRB A;  2V7M A;  3IA3 A;  1I94 T;  3AA6 B;  4B3T T;  2I6H A;  4U72 A;  4DR6 T;  1ZEE A;  2C5J A;  3B13 A;  3NWI A;  1WRD A;  4DR7 T;  2JPF A;  2C5K T;  1US7 B;  1Y64 B;  3CX6 B;  2VUR A;  4B6X A;  2H89 A;  1YXR A;  5LA6 E;  3RIF A;  5L4E A;  2KWH A;  5AQL B;  1W9R A;  5A1L A;  1HX1 B;  2WDQ A;  5FKY A;  3BK9 A;  4Z8X A;  2K5B B;  2NW9 A;  2PJQ A;  3ZMV B;  2N1G A;  2LHR A;  4TV9 E;  2ZM6 T;  3EDU A;  5L3B B;  2JQH A;  3P50 A;  4IDQ A;  2YOE A;  2D5U A;  3AE3 A;  2DWG A;  3UUM A;  3VR9 A;  1YW0 A;  1ZV4 X;  4ISS A;  4YTM A;  3PUW F;  5JDF A;  1UK5 A;  2A3D A;  2UXD T;  4B3S T;  4UIG A;  1BR4 A;  4U33 A;  1N36 T;  2CHO A;  4JI8 T;  3MA9 A;  4QXB B;  4WYV A;  4TV8 E;  2VAS A;  1SHZ C;  1WR0 A;  4DBQ A;  3N9Q A;  3H3A A;  3UFE A;  4ZI7 E;  2YIN A;  5AQF B;  5JR9 C;  1W0A A;  3VU7 H;  3I0Q A;  2J1D G;  2BS3 A;  4HWH A;  1QUU A;  2AE9 A;  1WYB A;  4OK0 A;  4GYS A;  2XAS B;  1BR1 A;  5GON E;  2OLT A;  5AQJ B;  3UFG A;  4LFC T;  2D0T A;  3FXE B;  2KSR A;  5LHG B;  1NEN A;  1OWA A;  4ILU A;  3ZYM A;  2Y48 B;  2W0G A;  3CX7 B;  4PJJ A;  4HN9 A;  4Q25 A;  5HXS A;  2ZM2 A;  1XMO T;  1XNR T;  5FL0 A;  3AEB A;  2IHR 1;  3V5S A;  3RH3 A;  5CA0 E;  3AE4 A;  3ZN0 B;  2VKJ A;  3N5L A;  2JQQ A;  3UU8 A;  3DTO A;  4PFP A;  4O8S A;  4EED A;  3A8Y C;  4EZ4 A;  3B5M A;  3C64 A;  4YLH A;  2A2F X;  4Z91 A;  2MOZ A;  1J1J A;  5EK2 A;  3W15 B;  3RYH E;  3RPU A;  4Z90 A;  4PJM A;  4X5T A;  4COF A;  4CZZ B;  2CBJ A;  3MXZ A;  5JRE A;  2CBI A;  4DR1 T;  1ZP0 A;  2K9A A;  3ZC1 A;  3E22 E;  5ABH A;  4UEM A;  3UQ4 A;  2MPK A;  2BKP A;  2V7J A;  5H6R B;  5FNV E;  3ZT5 A;  2FUP A;  4O4J E;  1M62 A;  1V9D A;  4TUY E;  3AE7 A;  4EXT A;  4YJ3 E;  2XAG B;  1W09 A;  2WU2 A;  3RKG A;  4EZH A;  4LF8 T;  4HKA A;  4I0U A;  2WDV A;  5LG4 A;  3K1S A;  5DQV A;  4X1I E;  4DID B;  1H7C A;  4EAH A;  2LJL A;  3Q5X A;  4LF6 T;  4IDP A;  5HXH A;  4YTN A;  5F8P A;  2I59 A;  1MMD A;  1YQ4 A;  1JNR A;  3KBU A;  5HWX A;  1VRB A;  3RIU A;  4XZC A;  4H9S E;  2HPJ A;  3MK7 C;  3R6N A;  1X9B A;  3TKL B;  3ZLI A;  4QH4 A;  5KMG P;  5LB7 B;  4O4L E;  4MBQ A;  2XQ5 A;  3MJX A;  5BMV E;  3IF8 B;  4ADZ A;  1L0V A;  5CB4 E;  2DNX A;  2ZLY A;  2W67 A;  4H63 V;  3U3I A;  2CRB A;  2QA7 A;  2V7I A;  2CM0 A;  4EV6 A;  4LFA T;  4QX8 B;  1HTJ F;  4KI0 F;  3ONJ A;  3UUN A;  1SA0 E;  4H63 H;  3T1Y T;  3BQI A;  3ZMZ B;  2XUE A;  4B3M T;  2LOS A;  3HL6 A;  4AIS A;  1WLX A;  3UT5 E;  1E2A A;  4ZOL E;  2XQA A;  3VRA A;  5IWA T;  3CPZ A;  4TNV A;  3ZN1 B;  3P4P A;  1J5W A;  2H7V C;  1W0B A;  3AEG A;  3PUG A;  2V8S V;  3LFM A;  3UU4 A;  4QHO A;  1G8X A;  3P7I A;  4YY3 T;  1D0Z A;  2XPK A;  2VL8 A;  2JQK A;  4ZXL A;  2EHO C;  5CGM A;  4DO0 A;  2FBW A;  4LF9 T;  3N9P A;  5C2T A;  5JDM A;  4JI6 T;  4CXW A;  2X9H A;  3NRY A;  2JRK A;  1O3X A;  3PU3 A;  2XAF B;  5FYM A;  2WQY A;  3FBL A;  4IE4 A;  4DV6 T;  3EHZ A;  3KBT A;  4IE7 A;  4PJN A;  2XM1 A;  3EAB A;  2NP9 A;  4JI3 T;  5LMU T;  2UXC T;  4KHP T;  2X9X A;  4CI1 B;  3CML A;  3A7M A;  3B57 A;  1R8I A;  5L3C B;  2IUB A;  2JIW A;  2E5V A;  3KDS E;  2D0U A;  2MTQ A;  4AI6 A;  2JMH A;  3RI5 A;  1E1H B;  2WY2 A;  2KZ7 B;  4HFC A;  4X1Y E;  4JEH B;  4GK0 E;  3OPC A;  2BG9 A;  2V6Y A;  2VL0 A;  4V1A v;  5LG3 A;  1XDO A;  1SE7 A;  4DV0 T;  3AA7 B;  3PUS A;  3ZT7 A;  2EHO D;  4O2A E;  2VWA A;  2KMF A;  4MHC A;  4HFH A;  5ABE A;  2N2N A;  4PJL A;  3TLT A;  4A56 A;  2Y8D A;  3OTO T;  5AQG B;  1T7S A;  5M4Y A;  3LSV A;  3BQK A;  1OED A;  4CN6 A;  2HHH T;  4ZZB A;  4WBO A;  2CXL A;  4YTP A;  2WMO A;  4O4I E;  3ETV A;  4KUM B;  2Q9Q A;  1HNW T;  4CQI A;  4N78 D;  4DV5 T;  3JAD A;  3TLU A;  1ZHC A;  4IL9 A;  1Z0P A;  3CVR A;  5LBQ B;  2BG9 B;  3H3M A;  4DV7 T;  3LK4 2;  1UUS A;  2V6Y B;  2DL1 A;  3UU3 A;  4PFO A;  4PK5 A;  4TN7 B;  2BVL A;  4F6R C;  3UU6 A;  1ZOY A;  3EAM A;  4KBM B;  4YSZ A;  5FY0 A;  2R6G F;  4IDO A;  5HXE A;  2FJE A;  3ZMU B;  2VVS A;  4QXC B;  3UQ7 A;  2BS2 A;  4U2Y A;  3P4S A;  1WFD A;  2VKO A;  3VHL A;  3HR0 A;  4U3C A;  3T8O A;  4CXY A;  4LML A;  2LE8 A;  3RIU C;  2Q9Q B;  2M6B A;  2WB5 A;  3UTK A;  4JI4 T;  4NUV A;  2UU9 T;  4IHJ E;  3OVU A;  3GN5 A;  5IHY A;  3M3Z B;  2VKH A;  3C4W A;  3ESL A;  1N34 T;  2KIN B;  2BZB A;  2ZM0 A;  4ILA A;  4YXD A;  1D1B A;  4AQG A;  1MIV A;  2BBJ A;  1LVF A;  3OKQ A;  4PNI A;  1QSD A;  4BJN A;  4I50 E;  2YDQ A;  2JQ9 A;  2WAU A;  4QWN B;  3F2E A;  3PJA A;  2D2S A;  2QYW A;  4IE6 A;  5LXT E;  1D0Y A;  2QRX A;  4NIQ A;  2VB6 A;  2W61 A;  2IAK A;  3MAC A;  4G2A A;  1MIY A;  2UXB T;  3A5X A;  2J4G A;  3GN5 B;  2V7L A;  2XZE A;  4KP3 C;  3K3O A;  3C51 A;  3EI0 A;  4HWC A;  4YHH T;  1S35 A;  3O1H A;  3RYI E;  2XAH B;  4DR4 T;  3N2O A;  4IE0 A;  4P1N A;  4NUU A;  2PFV A;  1LKX A;  2UUB T;  2RPA A;  2CXF A;  2HPL A;  4PK6 A;  4X20 E;  3ZYK A;  2X51 A;  3UUL A;  3DJB A;  1HFA A;  3SOL A;  4O2B E;  4MLK A;  2VVN A;  4QH5 A;  3F31 A;  2CXD A;  1KFY A;  4WZX A;  3Q5D A;  2W62 A;  1U5P A;  5HXC A;  1KK7 A;  3NVO A;  4EEB A;  2PBI A;  2X68 A;  4PW8 A;  4C91 A;  1IBL T;  3R84 B;  3V5U A;  3O1I A;  2WBL A;  5LYJ E;  2CHN A;  3ZCJ A;  3RQW A;  4HFI A;  2OA5 A;  2ZMA A;  1YD8 G;  3EVY A;  2SPC A;  3JCF A;  4BAY B;  2K24 A;  4TWF A;  1VOM A;  5AQS B;  3HI2 A;  5FXZ A;  4AQF A;  5C3J A;  1UX4 A;  5H6Q B;  3CWZ B;  4X62 T;  3AAI A;  4E7S A;  1AJ3 A;  4H9Q C;  3AEA A;  4P0A A;  5DJQ C;  3I9Y A;  2VQE T;  4IDN A;  4OFZ A;  4DV1 T;  2KWI B;  3GMI A;  1IAP A;  3FZF B;  4H9N C;  5LHI B;  2V1D B;  5LBM A;  5JDG A;  3TLW A;  4ILC A;  1FMW A;  2BKN A;  3ONX A;  4UV8 B;  4L0R A;  3N9O A;  2CMR A;  1OED C;  4ZI3 D;  4CXX A;  2WZI A;  4DV4 T;  2IML A;  2YU1 A;  4CN1 A;  1MMG A;  4GOU A;  1VCT A;  2YDR A;  2DI4 A;  4ERR A;  4GIW A;  2YKS A;  2NWB A;  1IJ5 A;  2WZH A;  1S94 A;  5LMN T;  2E9X A;  2CWO A;  5JRC A;  1HR0 T;  4UV9 B;  3CKD A;  2H7O A;  5EK4 A;  2CCQ A;  2ODV A;  1WR6 A;  3QK6 A;  4X64 T;  3CQG B;  3HKD E;  4PAG A;  3P4R A;  3OYX A;  4DMV A;  5AQV B;  4ASK A;  3UU5 A;  5AQH B;  2XHE B;  4I43 B;  2E8I A;  2UXN B;  3RLF F;  3C98 B;  3UUX B;  1OXZ A;  2YN6 A;  1HNZ T;  3LK2 B;  1NAF A;  3EDV A;  2E9X B;  1M7K A;  2JMK A;  5JRC B;  2V5C A;  5LGU B;  1GQE A;  2FJA A;  2WMN A;  1WYC A;  3AVS A;  3WAJ A;  3LBX A;  5HCM A;  1KNR A;  4HE8 A;  3CQX C;  4LFB T;  3AEE A;  3I1A A;  5EK3 A;  3LG7 A;  3RC8 A;  5CJ5 A;  4ZS3 A;  5HEJ A;  3AE2 A;  2W63 A;  4LMK A;  3HKC E;  4JUY A;  1EZ3 A;  4YJ2 E;  3C4Z A;  4DUY T;  3U78 A;  5TAO A;  2IW5 B;  3RRW A;  2XSB A;  3K3Q C;  4LF4 T;  3FHN A;  2NR4 A;  3LBX B;  5FXV A;  4O4H E;  2NW8 A;  2YU2 A;  4OYJ A;  5LJN A;  1IBM T;  2HN2 A;  2MBG A;  3SFD A;  4DV2 T;  4DR2 T;  3RRC A;  1XDP A;  3ABV A;  2CPT A;  2CLY B;  5L3D B;  2XAJ B;  2V7K A;  4M1P A;  2K48 A;  1D0X A;  1ZKE A;  2HN1 A;  5DAB A;  1HG2 A;  1T98 A;  2B76 A;  5ABF A;  4H9O C;  2L3L A;  5FY1 A;  4JV5 T;  4UVA B;  4E7Z A;  3NZP A;  3WAK A;  2YEV C;  5AFU L;  3LDQ B;  3NRX A;  5F5W A;  1NEK A;  3KV6 A;  5HXR A;  4CI3 B;  2E5L T;  3PJA J;  1YKH B;  1HS7 A;  3PTR B;  1I6Z A;  3MKD A;  4P09 A;  2J62 A;  5KXJ A;  5JDL A;  4H9R C;  1MMN A;  2LRK A;  3Q5E A;  4ANJ A;  5ABF B;  3SWH A;  3D0T A;  3Q9D A;  4BJM A;  5HEG A;  3HA4 A;  2XJ7 A;  2WU5 A;  3AE8 A;  2ACZ A;  1B7T A;  1XWM A;  2NW7 A;  3RQU A;  3SFE A;  3RYC E;  3ZYL A;  5J2U E;  1SUM B;  4HGA A;  1LRZ A;  4QXH B;  5LP6 E;  3PV0 F;  4AIU A;  4YT0 A;  5FVK A;  2LRL A;  5AQI B;  5ADX L;  3AE6 A;  3KV4 A;  1KNZ A;  4JYA T;  3ZSS A;  3FXD B;  3K8P C;  1XNQ T;  1NWM X;  4A5X A;  4J2C A;  4TZ4 C;  2YK0 A;  1E7P A;  1X79 A;  3OJA A;  4TWH A;  3IHR A;  3AA1 B;  1KEY A;  5FY7 A;  2C0S A;  4OX9 T;  5LOV E;  4WW0 A;  5JDN A;  5HCJ A;  5FXX A;  2KND A;  3FBZ A;  1FMV A;  3ZKR A;  3RF1 A;  4XBF B;  3KV9 A;  4AQY T;  3LK3 B;  3LJC A;  5AQK B;  5J2T E;  1JNZ A;  3E0Z A;  3KVA A;  4ZHQ E;  5ABG A;  5JTG A;  3O9X A;  4UVB B;  4AKG A;  3PUQ A;  2A72 A;  2L9Q A;  5JH7 E;  1Z8U A;  3RKO A;  5LGT B;  1HG5 A;  3AAA B;  4YSX A;  1XZY A;  4YFS A;  4FI5 A;  1J5E T;  2YDS A;  2E9X D;  4KX6 A;  5HEU A;  2LKG A;  2LOP A;  2E2A A;  3AAE B;  2CE7 A;  4C90 A;  3P4W A;  4MAL A;  4JI7 T;  3HKE E;  4JI5 T;  3T1H T;  4U7Y A;  5FMN A;  4UEL A;  5L3G B;  2XTL A;  5J1G A;  2UXX B;  2Z6E A;  4U7I A;  2C5I T;  1HCI A;  3FZM B;  4NPP A;  4UVC B;  3J9X 1;  2CWY A;  2BVM A;  2IDO B;  3AEC A;  4EYU A;  3FZL B;  5FP3 A;  3E08 A;  3S4U A;  2W4X A;  2W2U A;  3ZJ1 A;  3JC6 C;  2PG8 A;  3PDY A;  4JI2 T;  5AQR B;  2XQ8 A;  4EB6 E;  5LHH B;  3QB5 A;  2XQ6 A;  4BA9 A;  2VK9 A;  4QH1 A;  2FJB A;  5AQN B;  3WI3 A;  3AB3 B;  3TLV A;  4KMC A;  2M6I A;  2XM2 A;  1VCS A;  5KX5 E;  5AQU B;  3SRZ A;  4XAX B;  4I55 E;  2VQF T;  2I0M A;  4U74 A;  1FIO A;  3PE0 A;  2B1E A;  3KFW X;  5FXW A;  1G73 A;  3QNU A;  5L2L A;  3PUX F;  4CN4 A;  5L47 A;  2LHN A;  4TWD A;  2XQY A;  4ZI3 C;  3ZT6 A;  2IIU A;  3L8R A;  3ZEF B;  4FJO A;  2X9Y A;  4UXN B;  1XMQ T;  2LM9 A;  3ZJ2 A;  5KDM C;  1HNX T;  2UUC T;  3G06 A;  3JC6 D;  1MND A;  3P4Q A;  3TLS A;  3PUV F;  4AKH A;  5IYZ E;  4DMW A;  2F4V T;  1D1C A;  4U31 A;  2LLY A;  1FJG T;  4GYR A;  3ZC0 A;  2GK9 A;  1UCU A;  2XAQ B;  2EHO A;  5L3F B;  3AEF A;  2OV9 A;  4ZI2 C;  2WM9 A;  1QLB A;  1IZN B;  2BG9 C;  3CQC B;  1MMA A;  2L8K A;  3QC9 A;  5CFB A;  4EOZ B;  3KIN B;  4A98 A;  1Y01 A;  2WP9 A;  1MNE A;  1LVK A;  3ZCI A;  2BKO A;  3PUY F;  3L39 A;  5AQT B;  3AVR A;  4IGU A;  3NZQ A;  3QOF A;  3I0O A;  2PTF A;  4HFD A;  2EHO B;  4DND A;  2NTY A;  2Q9Q C;  2N9D A;  2M67 A;  3JAE A;  1T8B A;  3C50 A;  3RIA A;  2CEA A;  1T72 A;  4JI0 T;  5AQM B;  3AED A;  4EIW A;  3O4X E;  2XQ7 A;  1YQ3 A;  2XQ9 A;  5FL1 A;  5ETW A;  2NTX A;  1IBK T;  5LNK A;  4ZI2 D;  3F57 A;  3C4X A;  4X66 T;  1IJ6 A;  5AQO B;  4DUZ T;  3IBP A;  2X66 A;  2QVA A;  2DLR A;  3AE1 A;  3ZPO A;  2QGS A;  5EZY E;  4DR3 T;  3OBV E;  3QUJ A;  4H9P C;  2UUA T;  2X0H A;  4HWD A;  2KT9 A;  4NXM T;  2WS3 A;  4JLE A;  3J7Y q;  5JDQ A;  4GKJ T;  4I4T E;  4LF5 T;  4NXN T;  2Q9Q D;  3JAF A;  4QX7 B;  4K0K T;  3RGL A;  3RC3 A;  2J47 A;  3N2K E;  4AKI A;  4WNK A;  3L3P A;  4HTE A;  3CIR A;  4G63 A;  3FB2 A;  3AXJ A;  4KHZ F;  2XY8 B;  3ZST A;  2G0U A;  4GKK T;  5BR8 T;  2A9U A;  3VR8 A;  2BDE A;  3ANW A;  4DR5 T;  2ODU A;  5LJM A;  2X67 A;  5JDH A;  5L4H A;  5IUX A;  2XSA A;  3AE9 A;  3CK6 A;  2ACX A;  5HWY A;  2BG9 E;  2Y6X A;  3N9M A;  2V6X A;  2LSI A;  4IL4 A;  5JQG E;  4JI1 T;  4DBR A;  3IEE A;  4A97 A;  2NOX A;  4HFE A;  3GA8 A;  1BR2 A;  3M65 A;  3AE5 A;  4UR9 A;  2WWV A;  3UUB A;  1UGO A;  2XQ3 A;  4IT4 A;  2CA5 A;  2P9B A;  3AXJ B;  1OED E;  3PU8 A;  2LSY A;  3PUR A;  2XQ4 A;  2ES0 A;  4ZZC A;  5LCY A;  3Q5W A;  4YSY A;  2W66 A;  4HEA A;  3ANW B;  2VKD A;  4K0U A;  3I9W A;  1CHU A;  1WCR A;  4JBW F;  2BS4 A;  3GWH A;  2WWU A;  4AKR B;  4IDZ A;  3CX8 B;  3DP7 A;  2V26 A;  3O1J A;  4AKL A;  5J0Z A;  2KLQ A;  2LKH A;  2LEH A;  2X9W A;  1UX5 A;  4ZEY A;  2ZM8 A;  4X65 T;  4ZS2 A;  2D9D A;  2IC9 A;  3SS1 A;  1MIW A;  2WSS V;  3MZK B;  3ZMT B;  1KF6 A;  4P0B A;  2AXD S;  3KV5 A;  4OYK A;  2JJ9 A;  3FZK B;  3ETU A;  5F3J A;  4TX5 A;  4AQF C;  3P8C D;  5E0O A;  4IIJ E;  4HWI B;  5JR9 A;  4X1K E;  2HH7 A;  2LSG A;  1BR0 A;  3X1D A;  4MFR A;  1N33 T;  3N9N A;  2WDR A;  3VKH A;  2V5D A;  3N9L A;  4LMJ A;  4YHJ A;  2LSK A;  3QB5 K;  4HWF A;  3BQL A; 
#chains in the Genus database with same CATH homology
 4DV3 T;  2UXD T;  4B3S T;  2UXB T;  4DV7 T;  2F4V T;  1HNZ T;  2VQE T;  1FJG T;  4DUZ T;  1N36 T;  4DV1 T;  4DV6 T;  4JI8 T;  1N32 T;  4DR3 T;  4YHH T;  4DR4 T;  4DR1 T;  4JV5 T;  2UUA T;  4JI3 T;  5LMU T;  2UUB T;  2UXC T;  4NXM T;  4KHP T;  4OX9 T;  4LFA T;  4JI2 T;  4DV4 T;  2E5L T;  4GKJ T;  3T1Y T;  4LF5 T;  1I94 T;  4LFB T;  4B3T T;  4NXN T;  4LF7 T;  4AQY T;  4K0K T;  4DR6 T;  4B3M T;  4JI4 T;  4DR7 T;  4LFC T;  2UU9 T;  4X65 T;  5LMN T;  4DUY T;  4DV0 T;  4LF8 T;  5IWA T;  1HR0 T;  1IBL T;  4GKK T;  5BR8 T;  2VQF T;  4LF4 T;  1N34 T;  4DR5 T;  1XMO T;  1XNR T;  1J5E T;  4JI0 T;  3OTO T;  4LF6 T;  1IBM T;  2ZM6 T;  2HHH T;  4YY3 T;  1N33 T;  4X64 T;  4DV2 T;  4DR2 T;  1IBK T;  4X62 T;  4JI1 T;  1HNW T;  4B3R T;  1XMQ T;  4LF9 T;  4X66 T;  1HNX T;  4JI7 T;  4DV5 T;  2UUC T;  4JYA T;  4JI5 T;  4JI6 T;  3T1H T;  1XNQ T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...