1HOCA

The three-dimensional structure of h-2db at 2.4 angstroms resolution: implications for antigen-determinant selection
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
272
structure length
272
Chain Sequence
b'GPHSMRYFETAVSRPGLEEPRYISVGYVDNKEFVRFDSDAENPRYEPRAPWMEQEGPEYWERETQKAKGQEQWFRVSLRNLLGYYNQSAGGSHTLQQMSGCDLGSDWRLLRGYLQFAYEGRDYIALNEDLKTWTAADMAAQITRRKWEQSGAAEHYKAYLEGECVEWLHRYLKNGNATLLRTDSPKAHVTHHPRSKGEVTLRCWALGFYPADITLTWQLNGEELTQDMELVETRPAGDGTFQKWASVVVPLGKEQNYTCRVYHEGLPEPLTL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CLASS I HISTOCOMPATIBILITY ANTIGEN (H2-DB) (ALPHA CHAIN)
molecule tags Histocompatibility antigen
source organism Mus musculus
publication title The three-dimensional structure of H-2Db at 2.4 A resolution: implications for antigen-determinant selection
pubmed doi rcsb
total genus 56
structure length 272
sequence length 272
ec nomenclature
pdb deposition date 1994-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1hocA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 1hocA01
3KYOB 4XPBL 1KXVC 3U6RB 1ITBB 1A4KB 3JWOC 5CLWA 4ZTPH 3FT3A 3TO2A 2RBLA 4I9WE 4P23A 2YPKB 3L7FA 4U1IB 3NZHL 1P7HL 2G9HA 4M3JA 1I7ZA 1OP3H 1ZT7A 1OL0A 1XR9A 3GJFK 4LGPB 1ZA3B 2NY2C 3LZFL 5DMJB 1WSST 4U3HA 2AJUH 1J12A 1NUGA 5K9KB 3DTXA 3OXSB 5TE4L 1F8TL 3WIIH 3DVGA 5JORB 5EG6C 3ABZA 2DTMH 3QRGH 1NGWB 3TYGH 4HV8A 3PGCB 1N4XH 4PJGA 1J0YA 1HH6A 2YPVH 1J5OL 3DSFL 5CSBA 1H8NA 4G8FB 4NN6C 4GAGL 3VG0L 1Q1JL 5IK3B 3QUXD 2IMMA 2VLJA 4XNUL 2CIKA 1T1WA 3O8XB 5DZLA 2HKFH 5EC1B 3FN0L 3MLZL 4GMSL 2ZUQC 4XHQA 4MJ4A 5EB9A 3U1SL 1OVZA 1JWMA 3QFJA 1Q72H 3F6LA 2FHFA 3K8KA 5JUEL 1OTSD 3HC4H 3PE9A 2KUTA 2R0ZL 4XCNA 1OY3B 3KJ4C 1A8JH 3B9KC 3MRJA 5E95B 4Z7WE 3QPXL 5F6HJ 3K1DA 3M8OH 4E5XA 3NCJL 5JQHC 1FIGL 4WW2A 1LHZA 3GSNL 4Q2ZA 4UDTB 4J4PA 4ZFGL 3AREC 1NLDL 1QFWL 1FZJA 1CFNB 3D69B 1ZV5A 3NIGF 5HGAA 1T1ZA 2CDFA 5DT1L 2IAND 5FOJA 1AXSA 3QNXA 3HAEA 5AG9A 4F80A 5GSRA 1HXYB 4HWZA 1QRNA 1NCWL 5J3HD 3TNNA 5KS9A 5C0BD 1AHWC 1FVDB 2Z31B 5CKGA 3WD5L 4OFYD 4R8WH 3MRMB 3FO0H 4LGSB 5T3XD 5IB3B 2W59A 2BZDA 2Y5EA 5EUKB 3IXAB 3VDCA 3MLSL 1Z6JT 3MOQA 4LVNC 4JKPL 2HRPH 4Q6IA 5F7FA 5BQ7B 5IESH 1I8LA 1UM4L 3HZMB 3LRSA 2IAMC 3SQBA 4M8QB 3QUML 4JRYA 3DPBA 3SJVD 1DL7H 3TBTA 5CJOL 4BK5A 4PJCE 4QTIH 4CMHB 2O5YL 4Z0BH 3TBVB 3FCTB 4D0CB 3MRNB 1N8ZB 2CDEA 4GKSA 3PHOA 1WFUA 3ULSB 3WFZA 4KROB 4WWID 3FFCA 2DS4A 4PJFF 4ELKB 4DUWA 5EC2A 1W8NA 1NCDH 1Y6NR 2HWZH 5AD0A 1UJ3B 4WVRA 2BOBA 4ZFFA 3EOBA 3FRUA 3D87B 4PJBE 3WXWL 4QNPF 1ZLWH 3EDKA 2JJWA 1FC1A 1CLYH 1HCVA 4N0YH 1L0XA 5ANME 5HI3D 1EGJA 3LD8B 1OF2B 4EBQL 3ARDB 1DQLH 1ADQA 3VXSD 3SGEH 2EYSA 3DX7A 5ICZB 2E27L 1PG7L 1U8HB 3L3HA 1CDBA 5D7IB 4C4KT 1A6ZA 4AL8L 3DECA 2J8UE 4JM2D 1U8IA 3X14B 1DN0A 4URTB 3X13A 4EUPH 1CD1A 5IJKC 1X4XA 1VESA 2VE6B 5D7JB 2BMKA 2VKXA 3CX2A 15C8H 3C6LD 5FDWB 5ADPL 5IOPA 1BM3L 2QQKH 4NQDB 2GHWB 5HDBF 1QQDA 1S3KL 2FD6H 3DXAE 5HI5D 3RBGA 1ZHLA 5ICZA 1JZ6A 3QEUA 3RTQB 2FATH 3KLAB 3RAJH 2PXYA 1TNMA 3O3AA 2V7HB 1S7SB 5KSAB 3CVHB 3QPQC 1MELA 3QUZA 4EQ3A 4HJGA 3QRGL 1DANT 1OGAB 3PWUB 4RIRB 4LSQL 4DKFH 4ETQA 5GGSY 2E7CA 3EO1A 1R3KB 5DRXA 2ENYA 2APVA 3NACH 1I9IL 3LKPA 1MY7A 4M5ZH 5IMMB 4Q6YA 1MFEH 1MFBH 4P9ML 4P5KA 4U05A 4WHTA 3QWRA 2X5PA 4P5TC 1PKOA 3D2UA 4J12A 3IRPX 4ZTPL 4KY1H 3VXNA 2Y36H 4HXBH 3DV6A 1F3RB 1YN7A 2C3WA 5GRUL 3IYLW 4GG6B 1PKQA 3BPOC 4OQ1A 2UVEA 1Q9WB 4V1DB 1L8JA 1EHLH 1D9KD 5D1ZC 3ARPA 1WBZB 3BWUC 3PHQA 3IDUA 5HGBA 1A7OL 3OL2A 3L1OL 43C9B 5ITBL 2ED9A 3OZ9H 5JIKA 3H9SE 3QJFB 3LPGA 5FV2A 4R90H 3ULUF 2EH7H 12E8H 4MHHI 3KDMB 4UT7H 1DEEB 5GRJL 2FIKA 2OZ4L 1MAJA 3EYVB 4FQHA 2ZUQB 1A6WL 3TH2T 4UT7L 4LVEA 3MBXL 5LCVH 4NBZB 1UGNA 4PG2C 4LKXB 2QSQA 3T0XA 4ZAKA 1OT2A 3TA3C 4PG9B 2J4WL 4P2QA 4XHJC 2A6IB 3L6FB 5GIRA 2ZJSL 2PXYD 2XZAL 5GJTL 4GKOA 4TUJA 4LHUA 5FAAA 1RQ5A 3MYJA 3UMTA 5E6IA 32C2B 4GG8A 4KI1A 4HUUA 3C2AH 3MC0A 4NCDA 5IVXB 4KQ3H 3C5ZD 1E28B 1E6JL 3EYSL 5DWUH 1JGEA 2F54D 1MUJB 2VDPL 1OGAD 5J06A 1Q38A 1JFQH 2Y07H 3S34L 1MCFA 3B9EA 4M1CD 2NXYC 2NY0D 2ORBL 4NM4H 4N8CL 3KYNB 1FV1B 1KXTB 4NBYB 1QSFD 1DDHA 3C60D 2BNUB 5HYFA 4GRMA 2G5BA 1M7DA 3P77A 4JZOA 5IWLA 2F8XC 1KGCD 3HMXA 1KF9B 5KSBE 5DJZA 3NGBC 3V6OC 3HCVA 4WWKD 4G42B 1W0YT 4B7IA 4DN3H 2P7TB 2FSEA 3CXDL 1XGYL 3FQWB 3QIUD 4XCCL 3WSQL 1QPPA 2KZ1B 1KJ3H 2BY2A 1IL1A 5BS0B 3F8UB 1P2CA 3H7BB 2ITDA 2VXVL 1WISA 15C8L 5D2LA 3W0WA 2J88H 2HT3C 2ICCA 4FQXA 1BZ7B 1Z2KA 2HTKD 4F8TA 2CPCA 4QWWC 2C7UB 4P4KD 5EO1B 2APXA 4IM8A 1JZ4A 3BP7A 3HI5H 2Y6SD 5CUSH 1GL4B 4HD9A 1S9YA 3MGOB 4Q74A 4R3SA 4IOFD 4HZLB 3GMOB 3FB7B 1VFOA 2BSED 3NZ8A 2XA3A 4MZ2A 5D2NE 2YPKA 3L7FB 5ENWB 2BXYA 3I75A 2JIXD 2NY4B 5E2WH 1MCWW 4LLUA 3CX5J 5DJ8A 5KVGH 1DSFL 1FFPB 3E6HB 4CJ1A 4TVSa 5DWUL 3O11A 4WV1B 3MCG1 3NIFE 1FO0L 1FLRL 3LRSB 2CKBL 3U0WH 3GSVB 3BYTA 2Q87A 1LO0L 3W9EB 1QHPA 1FJ1B 3RZCB 2P8MB 4ODUA 1RHFA 1CGSL 5I1IL 1SYVA 2A83A 2EC8A 4HS3B 3S8WA 3VDAA 3ARVA 5KG9B 2Y72A 5FHBH 1F5WA 3O6FD 4XMLH 4OI7A 1OD9A 4Z0BL 5EU5B 4JPIA 1FZKA 3RNQB 3ARYA 3RIFF 1LE9B 3EOAB 2EH8L 5F21B 4X6CE 2DQJL 4LLWA 3VXUA 1CZ8H 5DHVB 2VDKH 1SJEB 1JUFB 4BQBA 2DLIA 4LLDA 4DGYL 1BOGA 2HFFA 3ESVF 3VXSE 1OP5H 3KPSA 1MCEA 3FAWA 1DUZA 1AIFB 2EDQA 5E8OB 4AEIL 2FHBA 2GJ6E 1IAKB 4FQIL 1AY1H 4NQEE 4YNYB 2XKSA 1L6XA 1AXTH 3I6LE 2OLDA 1JV5A 3X3GL 3AC0A 2X9WA 4JKLA 5EZIH 3QG7H 4FNLL 1A1NB 5GISL 4J3WA 3S98A 4JRWA 3PNWB 4YHYC 1SJXA 4OCYH 1TQCC 3DOSA 3S6CA 1T0MB 3RKPA 3IDYB 2I9TA 3DMMA 2QSCL 2AK4B 3ARQA 1A6VH 4LPWA 3SE8H 4XCEB 4OGAD 3NCBB 1TZIB 4Q7DA 1FIGH 2HN7B 5I9QB 2CKNA 3LVEA 3UTQB 3WEXA 3R06A 3QIWB 1MCPL 5EOTA 5KVDL 3SQOL 3RUGF 4NWUL 4ODVH 3QHFL 3UBXA 2JIXB 1NJ9A 1GIGL 4OUUA 4WY7H 5FFLA 5E6IB 3AVEA 4L4VD 4MQXD 1YNLL 2IG2L 4K3JL 4M1GL 3B9AA 3ETBF 1NEZA 4I0PA 2OYPA 2EE9A 1MIML 2QADD 5I75C 3GKWH 4CDHA 4G6FD 3O6FA 1JZ3A 4GAGH 1XR9B 4C83B 1H3PH 5KZCD 4R96B 3UTQA 4L8DB 1U8MB 4XPTL 3PABB 4ELMB 3FQTB 5D6CB 4KRMB 1BD2B 3MLUH 4JM2F 1W0VB 4V1DE 5DUML 2R0WL 1NFIA 5HSFA 1G7LA 1MF2H 4L8BA 1H0DB 4MXVF 3L3JB 3N0PB 5E5MB 3B6SA 3EDDA 3TT1H 3PL6A 1WEJH 5I6XC 1R3HA 2DYPA 3GSWB 5L0QB 3FN3A 1KENH 5TE7H 4LSSH 3UJTH 3DX7B 4L8DA 3RVTC 1XIWC 1G7HB 3O8XA 4FMKA 3RVXD 2FJGB 3KPLA 3ZDZF 4KRLB 5KS9E 2CK2A 1GHFL 3CFBB 3ILPA 3LN9A 3BEWA 3CU1A 2PCPA 3WFEH 5JHDA 3F6IA 5I1KH 1WC7A 2D7TL 4QHNB 4QCIB 3T0EE 2FEEL 3F12B 2W9EL 2PTTB 5EO0A 3L3IB 3L5HA 2Z0BA 2FO4A 4GFTB 4DAGL 1Q0XH 1A14H 1XGQA 4RA3A 1JE6A 1K8IB 5EBWA 4G3YH 4GRLB 4AYFA 2PXYB 5JW5B 2JCCA 1NBQA 1FNFA 5F88B 4NN5B 2AXGA 3C08L 4NRYB 1SBSH 4PV8B 5KSAA 3SDAD 5KOMC 5JLZA 5A2JH 4MSWA 4UV4H 4WI6A 3WDHA 3LS5L 3RWEA 3OKEB 3GMLA 1IRAY 4BJLA 2X4UB 2H32H 4HBQA 4WWKA 3DYMA 4LKCA 4ALAH 2I5YL 4OF5A 1EGJL 3FRPA 4OM0L 2CR3A 5MERA 3OKKB 2HT4D 3IDMA 4Q6IC 4Y19D 3QI9A 3N06B 4OFPA 3U2SB 5JW4M 3QDGD 2DM2A 2LQRA 3QIBD 4DGIL 4C56E 4NKQB 4K7PH 4HEME 2AP2A 5FYJD 2HG5A 3QIWC 4GBXA 3O3DB 5ERWB 3RTQD 3QEQD 3F7QA 4F7MA 4M5ZL 1YEIH 1BJ1H 4FFYL 3PHQB 4DW2H 5J9PA 5C0BB 2OZ4A 3ROOA 5GS3A 5HI3C 3SJVA 4J8RB 1I8MA 3V6ZB 3VWKD 4Z7VA 3L3KA 5D5MA 1T04B 3OR6A 5DK2A 4PRHA 4I3RL 4I5BB 4UBDC 4NRXA 3HC0A 5DJYA 3NA4A 1T20B 4KHXH 1YMHB 4FZEL 4KWUA 4YC2C 3KPPA 1XGPB 5I2IB 4NDMB 3ULVE 1UJ3A 4YPGA 5CD5C 4OJFL 1U93A 2IBZY 4POYA 1MWAL 4TNWK 5HHQA 3FB8A 4QXUL 4R26H 2GTZB 3SDYL 1KT2A 4CVZB 1J0ZA 5D7IE 1ZTXL 4OAWA 4N0CA 1U8HA 3CDGA 1EJ6A 2J8UF 1MIEL 4GQ9H 2EYSB 5KSVB 2D7OA 4HPYL 5KJRH 1RUKL 4TULH 2YKLH 3A6BH 2PO6D 4YFLI 3VJ6B 4MDIB 2KL6A 5ELIA 4Z7UB 1RIVH 2BOCB 2OMNA 4J2XA 4RRPG 1H3VA 4XB7A 4MHHG 8FABA 4S1DD 2ILLA 5A2KH 3LAFA 2UUDH 1S7QB 5DI8B 4PJ7B 1RZFH 3T0VA 1UB6B 2QQQA 4LGRB 2MCPH 4M7JL 5DQJB 3ZSTA 3ULVF 4X5XA 5EIIA 3F7VB 3PXJA 5FUOH 1FBIH 2V6HA 3DI3B 2JF1A 1LEGB 3O3AB 2C1PB 4PRBB 3P11H 2DMCA 1HKFA 1JP5A 1NCNA 3SCMC 4X8JB 4NOFA 3RY4A 5IMKB 4OCMC 4PY7A 1JWSA 1VGEL 1VSCA 3ARFB 3P9MA 3MLPA 3I3DA 5DUPH 5E8PB 1KCSL 5BOPA 3LHPH 2A1WL 4S11A 5I73B 3X3FH 1EHAA 1U41A 4HWBH 5HHPA 2DIJA 4HJJH 2QHLA 1MCLA 4HMCA 1UACH 2UUDK 1QBBA 3QXAA 4XXCA 4EJ1C 3ZO0A 4WGVB 4U1MA 5K9KA 3DTXB 3OXSA 4KDVA 4LSDA 4ZQKB 4AZ8A 1WV7T 4U1LB 2OQJA 1GXEA 3SDCD 1E4XI 1T0MA 1INEH 1G9MC 3QYCA 4KKAD 5A40E 4F37F 1BJMA 5I1IH 3VFOB 4G6KH 1H15A 1DQQB 2D7TH 2FWOB 3BH8B 3VW3L 1K4DA 3RGVC 1S7UA 1GC1H 4N0RA 1FYTA 1CDYA 3BD3A 2ZCLH 5LWYL 3B3IB 4KPHH 3TJEL 1HH9A 1X7QB 2B4CC 2X4SB 1QFWH 5ILTL 2J2ZA 2O61A 4JZJC 5E00A 4NPYA 5JTWA 2E7LE 4XXCC 1CGXA 4KK6D 3ZDXF 4YDKH 5AUMB 1RI8A 4XBEH 1YMMA 4PY8J 4HW6A 4O9HH 3SDAA 1IEHA 3P4NA 2IANB 3AMKA 5I76A 5FA3A 5L9DL 5GGSA 3VXRD 4KUZH 5AWNL 1IGML 4HX1B 3BWAB 1BD2E 4YXKL 1J0IA 5C0AD 2YC1A 4MNGA 1T7VA 2GK2A 5JPMB 5L2KB 3EJYC 1M1SA 1U0QA 5I18H 1BVKA 3PWPB 5DQ9A 5B4MC 4JFHD 1JPFB 4QXGH 3U7AA 1QFOA 1OM3H 1HSBB 5SX4I 1FDLL 1YEEH 5F9WC 5DEGB 1MJUL 1MJUH 2HJKB 4D0BA 1T3FB 5GSRB 5FA3B 3TIDA 4RAUA 5BVPH 1IAIM 2VDQH 3BPCA 1WZMA 1EEYA 1Z9MA 4I3RH 2XXMB 2DDQH 1KNOB 1U8JA 1AH1A 4OF0A 1JHLH 1IM9B 2QEJA 3GSXA 3UJIL 4LP5A 1BLNA 2NTSP 4JEGB 4PJBB 3BH9B 2O5ZL 2APWA 3GSOA 4IOSD 1A64A 2SEBA 3D9AH 4MB5A 4WUUD 2VLMD 3MRLB 4QHNA 4YDKL 4RMWA 5DR5L 4HQQH 5L2KD 1MREH 5SWZA 2EYTB 1A1MA 4EN3B 1NMAH 1TQBC 3CC5A 4MDJB 3PHOB 3CLEL 1LEKB 5IB4B 3QT2A 2OM5A 4JO3H 3UTOA 4H0GA 1KTKE 2R2HA 4Z7WB 2F8VA 4MDIA 4LBEB 3HNTH 4LASL 1J8HD 4X83A 1TDQA 4PGCB 2OL3L 5KSUB 4MD0B 4MSWB 4MLSA 2C4FT 5DLMH 4HUMB 2CUIA 4P5TB 4XX1G 5I16B 4I77H 5DMIL 1WF5A 2IADB 1HHKA 3PUCA 1SBSL 3PGCA 4PJGB 4ZUUB 1KSRA 5FYJH 4DTGH 1KB5H 3B5GA 2VISB 4LOUC 4DVBA 4OBSA 5CJOH 5I15L 4XNZC 5HHME 4NQXB 3FOMA 3O0RH 1CK0L 3KPSE 2JB5H 4PLJD 5D6CA 3ZHKA 1KJ2A 2Z4QB 3C9NB 2XQYK 2ZSWA 2VLJD 4HS8H 2GTWA 4ZFOA 3LQAL 1EMTL 3NPSB 3HMWH 3CMGA 3Q48A 3RWJB 4QF1B 4L9DA 4GRWH 1VKXA 1QLRB 1BEYL 4HH9B 1A3LH 4LDLB 4E41A 3OKYA 2NW3A 3BN9C 4YHPB 5DHYB 4QRPD 1UT9A 4NBXB 2IQAA 3FHAA 4MD5B 4XX1E 1UVQA 2X41A 4QRUB 2X4QB 4JAMB 2P48B 5C1MB 1ONQB 2FX9L 2H41A 3KLDA 5GS2D 4OLYH 4RFEA 3TV3H 4HZAA 2NY3C 3NBNA 3LEXB 2I25N 5TGBB 2GAZA 2CR6A 2MHAB 2AV1A 1AKJA 3M17A 3VXRE 2H2SD 1BIIB 4WHTB 5IHZB 3NN8A 1UVQB 4QRUA 3MNWA 3DI2B 1H3PL 4MJIE 2FATL 4X6EA 3MRHB 1DBKH 2H3NB 3P4OA 4XNYL 1JNLL 5HHXL 4L4TD 1A6UL 2I60H 1YEJL 1I3RB 2PETA 2YD6A 4U1GC 5D4QA 3QFJD 1Q9LA 4ZDHB 1VPOL 5C0EA 5CZKA 1A47A 1PFCA 1I7ZB 3MRQB 3GHBL 1A7NL 4OFDA 2G2RB 1I7UA 3QDAA 5D7LB 4LRIC 5HI4C 3RPIB 2DKUA 5TQ0L 1UA6H 1X6NA 2BVOA 4NHCL 4I18C 4Q9QL 5GGTA 1N2RA 3P73B 5F44A 3S3JA 4PJHB 3U30B 4CDGC 2L7JA 2ICWJ 4UINH 1NC4B 3SE8L 4APQA 3WIHA 4X80H 3V6BR 1QLFB 3TA3D 3FTGB 4XTRD 2GJZA 2RQ8A 5H37H 5HBBA 4WHDA 4XP4H 5IV2A 4PJDE 4EOWH 2WM0A 3ZDZE 5LGKA 2VLJB 4PBXA 4R96A 3L3KB 5D5MB 2HWZL 1B4RA 3MLWL 4O5LH 1QSFB 1A6PA 3VFTB 4I18B 1MCKA 1PY4A 4FXGA 1SJHB 1QPXA 4PJ8A 4PJIE 5EU7C 4N8PA 4Z7WF 1OTUC 3QXUA 4Z0XB 2VQTA 2L4OA 2XKNB 3L5XL 4U4BA 1XCTB 4YBQD 5CILH 5EU7E 2GY5A 2IBBA 4NO5A 5CSGA 1P6AB 3MV8B 4ZMAT 5MEQB 1R3HB 2DYPB 5HVHB 2Y5TB 1UYWH 2YR3A 5IESL 1G0YR 3B3IA 1AC0A 1WUNT 1KB5L 4YH6A 6FABL 3WJLA 2DQTL 5D1ZB 4TQEH 2NMSA 4UV7H 4IRJC 4OFVA 4Z7UA 4FXGB 4PJ8B 5DMIH 4MA3A 3IGAA 3GNML 2CLVB 2R4RH 4EVNA 2WNGA 4HT1L 1CU4H 3REWA 2HTLC 2ZSVB 2ITCB 1LO0H 3DV4B 2BSSB 1QVOA 4O4YH 3EFDL 1KTLB 2ZUUA 3QQ4B 3ZE2F 4OZIE 4YE4L 1JTPA 1MHCA 3BVNB 2B4CH 3QZWA 5HYQA 3D39A 3QDJE 1C1EL 2HFEA 4PGEB 4I0KA 5T1LB 4LHQB 3OB0K 5FGCB 5J1AA 1HZHH 5FO9B 4P46A 1MH5B 2FYYB 5CJBA 2RJMA 1AE6H 1MREL 1OAQH 3PP4H 4OZIF 3D9AL 3RPKA 4JJ5A 3PF2A 3VRLE 5KSAD 2XZQH 5F7MC 5FYLL 3WKMH 4K9EH 1NUNB 4ONGL 3LKQA 4H0IA 3SE9H 1ZHBB 2DQUH 4HWEH 4NZTH 3GMRA 1ZT1B 4F9PA 1JMZA 3O9WB 3RGVA 1K9TA 1UKTA 2DQEH 4AJ0A 5L2JB 1QSED 4NZDA 1SEBB 3QG6A 1OSPH 4PS4L 5DD0L 1YJDL 1FPTL 1TETH 1AR1C 1B0RA 3EJZD 4GUPB 5BMFL 2BNQB 5GRWA 1MFNA 3SO5A 3QDMB 1ZANL 1LILA 4OIAA 1NBZA 4OLZL 4X7SH 3ZTNL 1DR9A 3ZYOA 2J88L 1MH5A 1X3DA 4X5WB 3VI3E 4AEEA 4XNUH 1FORL 4U1MB 4I9WD 1FFOA 1PZ5A 1NBYB 1SMAA 4RAVA 3HI1B 2VYRE 1QSEE 3H6JA 2CDFB 5I1JH 3VXRB 2XWTB 5H8DA 2VDOL 2F54B 3ECBA 4LNRB 3TBYA 5KVFH 3MPCA 2VAAB 2WUBL 2GAZB 3QRFM 4K3EH 4MAUL 4LLMA 1KCLA 3EYOB 5IB4A 1LEKA 4YHLL 2X6MA 4NWUH 4P2OA 4F2MA 3THML 2V9TA 3CUPB 4WI9A 2HLFC 1MCRA 3QQ9C 1R0AH 3MRDB 1NGXB 5EUKA 4H8WC 4BZYA 4O9HL 4MCZB 5ANMB 5FO8A 1IC4H 3BAEL 1DN0B 3X13B 5H94B 1T03H 4JPKL 3Q2CA 1GAFH 1XR8B 2ESVA 4XZUB 1NSNL 2XG4A 3HNSL 3DO7B 4JO2H 1KIQB 1HZHL 4QOKE 1AIFA 5F9JB 1RK1A 2VITA 2FX7H 4UIMB 4FNLH 2VJXA 3MV9D 1WT5C 3BZDA 2DQIL 3C5ZC 2AK1L 5D7LA 3C09B 4P2OB 1HOCB 4W68A 1K3ZA 3V0WL 4JE4B 3WFBL 2AK4D 4F57L 3W2DH 1RJLA 3MLRH 3MRCB 2WWMD 3MV11 3NCFB 3W11C 3G08B 5DRWB 4QRRA 2YD8A 2R4SH 3KR3L 3IKKA 2OMBA 1PYWB 3DMMB 3ZTJH 1UM5L 4I2XA 1NFDB 2DBLH 3BT2H 1EZVY 4YHPA 2P8PA 3NAAH 4TSCH 3MJ9A 3UTSD 1JTOA 3KPNB 5TE6H 2D7MA 3SKJL 4OZHF 1AJ7H 4I4WB 2VLKD 3VGDA 1EBAA 5FKAA 1UXSA 3VFTA 3LD8C 1C5CL 5CZXC 1BHGA 3K46A 4NOBA 3WO4B 4LPYA 2FB4L 1IARB 1KCRH 4QRPE 1C12B 5HPOA 4R4BB 4DFHA 2CKBH 4BM7A 4BSVA 1HH6B 4F7EA 1OPGL 5E8PA 2NXYD 5SWZB 5DT1H 2AGJH 1FBIL 4OT1L 3UZVB 5JOFB 4PB9H 4PJ9B 5EA0L 2D31B 3HZVA 3KNBA 1G9NL 3PQYB 1BQSA 4X80L 4PJ5A 1DLFH 1TVDA 3LQZA 2R2HB 3HPLA 1QBMH 2H3NA 1I1AC 1RPQA 2OR9H 2DL9A 3KHQA 2RHEA 4I3SH 3QHTC 3MRGB 4FQPA 1U8KA 2ZSVA 1MWAA 4ZAKB 4ZDHA 5C0EB 1RD6A 1JNNH 1ACZA 5C0DA 1OP9A 5TDNB 5C9JB 1M05B 3F7PC 3VXPB 3DX9B 3I2CL 1FVEB 3FO9B 2OP4L 1T0NA 2GSIA 1EFXD 5ADPH 5H37G 5MEOB 4XXDA 1OOAA 1AGFA 1S9XB 4OM1H 4Z6AT 3C8DA 2VSDA 1R5WA 3MACH 2IC2A 1YN7B 4DKEH 2HKHL 2VSCA 4ZUSB 1P6FA 5CHNA 3FKUS 4Q97A 1RVFL 1WBZA 3BWAA 5DHYA 4RBPK 2XZZA 4KVNL 5C09D 4I48A 2P46B 5CJ5A 2PR4H 5F9AC 1UCBL 4HC1L 2OK0L 5DJ0A 1DQLL 3S36X 1F00I 4ZS7L 1JIBA 3FT4B 2C1OA 1IGTB 2HKHH 2X9YA 3O41A 4K7FB 4ZXBB 5HJ3A 4D8PB 3RWDB 4PB9L 5EA0H 4RGOH 4G42A 1TTGA 3VFPA 5C8JA 4ZNEA 4QHMB 1UH4A 5L88L 4PRHE 1MFDL 3FCTA 4GKZA 1ZMYA 4LU5L 5C0AB 2BSRB 1KNOA 1U8JB 3GBNL 4B50A 5CBEB 1BIIA 1GGBL 1JNNL 4DFIA 4FTVE 4JN1H 5BOZG 3FQRB 3MODH 1UC6A 2JB6B 4MA3B 4S1RL 1E6OH 4M48L 5ISZB 4LSUL 1S78C 3EOBB 3T3PE 1HKLH 5DJAB 4JFPB 5IG7A 3R0NA 3OG4B 3GSOB 3GMPB 1A6WH 4HZLA 4MGXA 4XNXL 5I8OL 2HRPL 4G3YL 3RY6A 1NGPL 4ESKA 1JYVA 5I8CA 4WO4A 4UIMA 5JOPD 4PRIA 4ODXB 2MQ0A 3QI9C 4DZBB 4WEUD 2WK2A 1I4FA 5DD1H 5EOCJ 2AGJL 3OR6B 5DK2B 1AQDA 4HKBB 1F13A 4P3CL 1JRHH 4MWFB 2Y23A 5E8EA 4QHLB 1T21B 4PTUA 3BYYA 1X5JA 1CI5A 2XWBA 3NCYS 3OG6B 4KJPC 3QHZH 2AS5M 3TFKC 4ELMF 4O2EA 3MCLH 5MENE 4OD1H 1J10A 4WUUE 5J13C 2WBJD 1HHJA 1WITA 2ENSA 4NNXB 4JKKA 3VWKC 2W60A 5D7JA 2DI8A 3GSQB 3AS0A 1QOKA 2AEQH 3TBWA 1X5GA 1DBML 1L9NA 1P4BH 4ZNCD 1ZSDB 5C6WH 1IC4L 5E1HB 3DUSB 2VLKA 5C0NC 1RV6X 2W0LA 4U1HA 4PJDB 4PRPA 4ZS6C 4G9DA 1X5KA 4PV9B 2XICA 4CVXB 2NY1B 4Z0XA 5D5ME 3O6ML 1TJIH 4AEHL 4TPRL 1TJGH 5EN2B 4QF1A 2FO1A 4P2RD 2VAAA 3GBML 1IEBB 5J0BA 3WFBH 5ITFA 4X6DA 2XY2A 2DB8A 1I9RH 1JZ7A 1FE8H 2GQHA 1B4JL 1D9KC 2LFGA 4AQOA 4P5KB 4JFZH 4OLXH 4JFZL 4NYLB 4C4KO 5T33L 2AKRA 5D7JC 2M2DA 3V0VB 5D9SB 2QR0B 2QQKL 3FB6A 1ONQA 3O81A 1EO8H 4QOKB 4ODSH 3IDJB 3OJMB 2IG2H 4J3SA 4NO3B 2AEIT 4XZUA 1INQA 3DGGB 1MRCL 2PO6B 4CNIB 1HI6A 4N8VB 2AV1B 3GK8H 5TE4H 1HWGB 3NPSC 4MJIB 3PV6A 5A16B 3BVNA 3BGMA 1CR9H 5E9DD 4Z76A 2CMRH 4AIOA 3MJ9L 2PYEA 4L1DA 4WW1B 3RJDA 3G5YB 4WUKL 5IMOA 3SDDA 3NZHH 2VZOA 1NAKL 3I9GH 3VGAB 3MZGB 1H9VA 4OCXL 3OSKA 3U46A 3QI9B 4JFEB 3K8MA 1GGIH 3OR7B 1QFHA 3BO8B 5AAMA 3FAXA 3WXWH 3ZYIA 2B4CL 4I0PC 4OZFG 4XRCA 4WI2A 4F7MB 4K94C 1QRNB 3BRDA 5LAXB 4MMXC 2AI0H 4PP8C 3GBMH 1LO4L 4JRXD 3DETC 5JR1L 1YUHA 1OWRM 1H3GA 2XIDA 5IM7A 2XG5A 3FO1B 2J1KA 3TPUB 3BUYB 2DLFL 4HWEL 1HQ4A 2ZCHH 2B0SL 4PTTB 2HJFA 3MLXL 2YHGA 1DLHA 1P9MC 4ODBD 3L95B 3MXWL 1MFAL 1UWGH 3AU1A 4HPOH 2A1WH 1ZA3A 1NGYB 3OAZK 4JZJA 1KELL 1TXKA 4P48A 3KJ4B 3ULSA 5L6YH 2G9HB 2VXUH 5J13B 5DJ2A 1XF4B 4YR6A 5GRVL 3RU8L 5JW3L 4RFNC 2DQHH 1IM3A 1ADQH 3HA0A 1SJHA 1FYTE 3MLYH 1MFCL 2HTKC 4HIXH 4HT1H 4X7CC 3SGDH 2F15A 4LPTA 4JFDA 1F4YL 3GMNB 3B9DA 4H5SB 4HHAB 4KDWA 5EORL 4PLJC 4WI7A 1ZHNA 1XR8A 2ESVB 3B43A 5DD1L 2EKJA 3MRPB 2CLRB 3L95A 5I66A 2NY3D 5I1HH 5D1XD 2Z31D 5DFVD 4HGMA 1OCWL 5DVLA 4F3FB 1F4HA 4LCYA 3KYKH 3GSNH 2QHRH 4PJAE 1TJHH 4YHYB 3NCJH 4OLWL 4ZUWB 3BHBB 1I1YA 3R0MA 3BDYL 4L8CB 2ITCA 3ORJA 5ACMA 3IFNH 1D6VH 1EAPA 3WJLC 4X6FA 4ZAKC 1OAZL 2ATKA 3ARTA 3IDIB 4WEMB 3RBSA 4Z5RA 3GBNH 4IDJL 1KV3A 3B5HA 4L3CB 3VCLB 4CL7A 4CGTA 1NUDA 4XT1C 1BVLA 1T66C 3RWFB 5B38G 1XGYH 4EOWL 1MHEB 3OPZH 4OJFH 2C1OB 4ZYKA 2VH5L 2P43B 1R3JA 3EDFA 1MVUA 1NCBH 5FOBA 3SY0B 3HB3C 4HJGB 4ERSL 3O9WA 3RGVB 9CGTA 1QR4A 1I3VA 1X5YA 2YZ1A 3CPLB 4LEXH 4YAQA 1U92A 2W9LA 1KCVL 3C5ZB 2IAMD 3G6JB 3MCKB 2ZCKH 3SDXB 2R39A 4U6HA 4J6RL 4PJ9A 1P84K 2Z91A 2O26U 3MA7B 2GJJA 4WFED 4WW2F 4XC3H 4CU8A 5I19H 2WY3A 4HAGA 3MR9A 1AO7E 1QHOA 1IC5H 1MCOH 5FF6B 1KPUA 4KXZH 4OGXH 4WGWB 5T3XE 4H8WL 3BZFA 3V6OA 3MUHL 1EV2E 2IBGA 3QUYC 4KTDH 5KSVA 5CP3A 3MJGX 2JJSA 3NABL 4XTRC 3WUWB 2A6DA 5E8EB 4AIXA 1ZLSL 3S96A 3UYRL 3HAEH 1SVZA 1T0NB 1R3IL 3SDDD 5LCVL 1FZOB 5JNYB 4Y2OA 1I1AD 1CT8B 1NMBH 1DE4B 1X4ZA 5IMLB 4PJ7A 3IFLH 1PD6A 1A2YB 1KPUB 2DBLL 3BT2L 5KVMC 1J0KA 1OWWA 5EU3A 4RGMB 1FFRA 2HVJB 2OL3B 3BRGC 4M1DH 4X6CA 1DQJA 3B9KD 4K7PY 5EORH 1J88A 5J6HB 2KPNA 1AHWB 1NAMB 3VRIA 5B39B 1SQ2N 2GYSA 3FT2B 3NOIA 4L5FL 5D7IA 3FO1A 4KRNA 3BZ4A 5JNYA 4Y4KC 1CXHA 3IJYA 4J3VA 4GRWB 3LQAH 1U93B 3G5ZB 3HG1E 3UPRB 5DS8A 2WINA 5C8JB 4KKNA 1MFAH 5IW3A 5CZVL 2EO9A 2DQFB 1KN2L 3HMXH 3O6FB 3JSSA 4KTEH 3QXAB 1MFBL 1MFEL 3PWLA 4A6YH 4NN7C 3U4EA 3EHBC 4YXHL 4KI5D 1N5AB 1HN1A 4NKIL 3ZKND 2HMIC 2IFGA 3OXRB 1Q9OA 4Y4KD 2B1HL 3JXAA 4MAUH 2BOCA 1J1PL 3C6SA 3VFGL 1HYRC 1ZGLB 1JHTB 4WRLA 2AI0L 3STLA 2OXHA 3PDOB 4WJ5B 3QFDA 4R6UA 4G8EB 1EZVX 1T7XA 2NY4D 1R3KA 2DQCL 2GCYB 3VI4F 1S3KH 3T08A 4Y4HC 3PQYA 2Q20A 3U9UA 2IJ0C 4JO2L 4MJID 4DVBB 4DN4H 2J7LA 1K5NA 2XA8L 4OLZH 1BQLH 1U6AH 4JY5H 1YNLH 4K3JH 4L4TB 2IPTL 1U9KA 5DQDH 4WUKH 3PWJB 1IFHL 3UZQA 1BF2A 1UENA 1F2QA 2ZUXA 1A5FL 1G9EA 1MCWM 1JWSB 2R56L 1MJJB 2PCPB 5IR1B 2RGSA 3GIZH 3O45A 3P4MB 3TH4T 3LS4H 2H8PB 1NDMA 1Q9KA 2ICEA 4S1SL 1HYSC 3QJFA 2APTA 2NX5B 1EHNA 5EBMB 5JPNA 3NIFF 4JKMA 4ZO7A 2W0FA 5FUCC 5ILTH 1AGFB 2JCCB 1FVEA 3FO9A 4PJDA 4UB0L 1CFTA 4CBPA 3VD4A 1D5IL 4X7EC 4ZYKB 5HYJA 4KGLA 1K6QL 4EXPX 4L3EB 2HLFD 3WUZA 1GGYA 3HZKB 4Z95L 5D70L 3VFRB 1YA5A 4LSPH 4CADB 2BNQE 2H1PH 1AY1L 4MVBC 4LSVL 1RURL 5J89A 1SYSA 3A0OA 4PS4H 1H5BC 2ICWA 5DD0H 3AY4A 4X4ME 5GS0L 5E8NB 1QFUL 5TFSL 3HS0B 5JPNB 1E4JA 5CIPB 4EZMA 4JRYE 2CH8A 2MOVA 2CRYA 3OJ2C 32C2A 4LAJH 4F58H 2XZCH 3B9VA 1U8LA 2DD8H 5EBLA 5FYLH 3WKML 1JGUL 2QR0A 2XRAH 4A6YL 1CZ8L 1KTRL 5IB1B 2FHCA 2D03L 4PIRF 1PG7W 1YMMB 5IF0B 3VXMD 3L5XH 4QRSB 5FHBL 3D25B 3ZHDA 2W38A 5I66B 3LRHA 3MJ8B 5MI0B 4LPVA 5F8QC 3O4OC 1X4YA 3RIAF 3O3EA 3ZTNH 3MRMA 4WNQB 1CD0A 1A7QL 3KYNA 1FV1A 3WNPA 4WW1A 4FQ1H 5HDQL 5GGVL 4U6YA 2A6KB 2NY7L 3QNZA 3BP5B 3MRFB 3P11L 4P5TD 3RA7H 4NN5C 1JRHL 3NTCL 1EIBA 1NDGB 2Q76B 2P7TA 2J6EA 5I1DA 5L8KB 1U2HA 3X12A 1A2YA 4RGNB 1YQ2A 4GW5B 4JG1H 5ADOH 2HVKA 4WO4D 5K9QG 3MBEC 2X40A 3P2TA 5I8CB 5HTSA 1T0PB 2R15A 4X0KA 4ENED 4C56A 1J8HB 2XTJB 1NUFA 2QV2A 4Z78A 4IRZH 2GK0A 4MXVE 4XVJL 4PTUB 4J3XA 5I71B 3LSOB 3MUZ1 2YN3A 2WANA 3N1GC 4CMMA 1AI1L 4WI8A 5E6ZA 3T1FB 1ZTXH 4MNHB 4LLVB 4Q58C 2OJZL 3TPUE 1YNKL 2VITB 3P30H 4MLIA 1UWXK 4FQQB 4LFHD 5C09B 4HG4K 1CE6B 3BIAX 1RFDL 4O02H 1F02I 1RUQL 4WWKC 3B8YA 4ZD3L 1HDMB 4M8VA 4TOYH 4S2SA 3PP3K 5E8OA 3MFFB 1A6ZB 3G08A 4QRRB 5C0AE 2ED8A 4RQQA 3NH7L 1CBVL 3AB0B 5DF0A 2P8MA 4D9LL 3IVKB 4I8DA 3TT3L 3GMNA 4H5SA 3WCYA 4BKLB 1Q8MA 3RUGE 3STLB 3DROB 5DO2D 4LLQA 1AGEB 1ZVSA 4OZHA 5FKPB 5KJRL 1UCTA 3Q3GA 4JPIB 4KAQL 1NCCH 1FGNL 4U1GB 2D4DA 1XF1A 3SKOB 3LIZL 1U36A 3H3KA 4QOKA 3H2WA 3C2AL 3CK0H 4GRMB 1OAUH 2WBKA 2OTWA 1IQWL 2WUCL 4HJ0D 5I17B 2YMXH 5FK9B 2IFFL 4OFKA 5F8RC 2GITB 3PP3H 1J87A 2OR7A 1W72H 3PQYD 3HRZB 1ETZA 2KKQA 5HGDB 1BQHB 1BWWA 1F6FB 4LAQL 5CD3A 3QUZC 3MZTA 3V52L 3L3DA 1AQKL 3WN5A 3HG1A 2UYLB 3K2UH 3IXAA 1MAML 3MV01 3GKZA 2ID5A 1A7RL 4XAWH 4HXAL 2VABA 1MI5B 3U7WL 4FQJL 5E03A 2P49B 3WYRA 2Y25A 4P5MA 3RA7L 5DLML 1FNSH 3Q6GL 1O0VA 3C5ZA 5DJXA 4LCIL 1ORSB 1YY8A 3RKDC 3ZYJA 2FR4B 4YDIL 5DD6A 3HKFA 1A3LL 5E8NA 4GBXC 3QIWA 3HS0A 2FH6A 3P9LA 1T4KB 1HQ4B 4PTTA 2DIAA 3WLBA 5BZWA 1S7RA 1DFBL 3E6HA 3O4LA 3BIKA 4MAYA 1G0DA 4JHZA 3FRUB 1DN2A 2VLLB 1D9KB 3NA9L 5F7UA 2RB8A 2IMNA 1OP3K 4PGDA 1L0QA 4QRQA 4C83A 1BWMA 4ZUTA 4BK4A 1S8DB 3MRKB 3BN9D 4FRWA 1YN6B 1MRFH 4N0UE 3BGFB 1VDGA 1CICD 4P49A 3M45A 3LB6C 4KK6C 1CGVA 4YUEL 5CINH 2XKUA 4OF7A 1T1YB 3QUMA 5IFAH 3AREB 4OD3L 2XN9A 4YHOH 5HJ3B 5BZWB 4WFFE 1ZHNB 2BSSA 3PJSA 1KCUH 3MRJB 4M7LH 4OIIH 3GKWL 5F88A 4XPAL 3QH3B 3QP3A 1R5VA 2DAVA 2EYTA 1MQKL 2NXZD 4OCXH 3O6LH 5EUOF 1MCSA 2P47B 4UT9L 5IGXH 4M6MH 1CG9A 4MJ5A 2UZXB 3ZE2E 4DEPB 1OLZA 1CR9L 4F33A 4OZIB 1A0QH 3RP1A 1AXSB 2AQ3A 4NSKB 5BV7L 2HRLA 2YWYA 3CFBA 3ILPB 4P2YA 4LSTL 2XKNA 4M02A 5DA4A 4NQVB 1QR1B 1CBVH 4RMQA 1PG7H 3FQWA 2HT3D 3VI3F 3EFFA 4UIKH 2N1KA 4X6DF 5IBUB 4TOYL 1N6VA 4P3DB 4JLRB 2WV3A 2VN4A 4DZ8B 4FFEX 3A67H 4RAHA 3BJLA 4XBPA 5J8OA 3ARGD 4MXWH 1KCUL 4BFIA 1D3CA 3LV3A 4M7ZB 5IQ9A 3U83A 5EO9B 3QIBB 5HYIA 4HIJA 4BZ1L 5HHMB 4OUOA 3MRNA 3KPPB 3KPMB 1A21A 4GH7B 1WAAF 4UTAH 5AZEH 1U92B 1N5YH 1RZIA 4FZ8L 5FKPA 43CAB 2KDGA 3VXUE 4M43L 4RWHA 5AYQA 4BH8B 3RWGA 1JMXA 2VDML 1VHPA 4OCNC 5F3BB 3KLHD 2VN7A 1YECH 2Y6SC 4P2RB 3T0AA 5EIQA 4K9EC 4JJ5B 1FFQA 3MLSH 2W1NA 1P69B 4H26A 4Y7MA 4GMTL 4FMFA 1W72A 1KCSH 4OCYL 3UTTD 3EOYG 3SHSA 4PUBH 5C92A 3VRJA 5CJXC 3SJVB 1FO0B 1KJ2L 2V7HA 1JGLL 2Z9TA 1K4CA 4P9HH 5FECB 3FONB 2DYPD 3KHOA 5IHZA 1OB1A 2HLAA 3TIEA 3UTZA 5HD8D 3D3VD 2A2QT 3U7WH 4GSDH 2WBJB 3F5WA 5KVGL 4OGYL 3T77B 2ADFH 1U58A 3T0EA 2YZ8A 2EXWC 3U4BL 1XIWA 1JZ8A 2HFFB 1ZLVK 1IEAA 2OL3A 3IRZA 5FDWA 3MROB 4NUGL 1FSKB 5SV4A 1HKLL 4LAQH 2N7BA 2UWEE 4HKZA 3VDBA 4Y1AE 2AXFB 3IU3A 1MPAH 2NNAA 2VTFA 3G5YA 3UTSA 1OB1B 2HLAB 3TIEB 2V2TB 1NQBA 2Q3ZA 3G9VA 3QUZB 2BVOB 2H1PL 2DMKA 8CGTA 4DUXA 1ED3A 1NC4D 4PBVC 4M62H 5JW5A 4MCZA 1ULVA 5ANMA 3RDTB 2FL5A 2G75B 3MLZH 4GMSH 5L88H 4BKLA 1HHIB 2XNAA 3PXHA 4XP6L 5GSVB 1AP2B 5FM4A 5DSCB 4QY8A 3MBEA 1DEEA 2FSEB 1AFVL 4DQOL 5F9JA 1ES0B 1GZPB 1J5OH 1CD9B 1N3NA 1TPXC 2Q7NA 4LHJB 1N5AA 2F53A 2XFXB 3I85A 4J4PC 4GKSB 5IKCA 4ZO6A 3O4LD 1F3DJ 1U3YA 1ODAA 1LO2H 3WIIL 3H7LA 1T80A 1LDPH 2OTWB 1N7ML 4DW2L 3R4DA 3EYFB 2VUYA 5CBAB 2RFXA 2PF6A 1A7NH 1A5FH 4N8CH 3A6BL 3LZFH 4I2XB 2QADB 4D9RE 3H3PH 1YQVL 1QZ1A 5FV1L 4X7DC 3VG9B 2PYFB 5E1AB 1F58L 5JHLL 3C2SA 4QHKI 1I85A 1KACB 1JNHB 2NX5D 5E7BA 5DHXB 3CFDA 5JHDD 4XPBH 5TJWK 4W4OA 3P4NB 1V3LA 4HUNB 4MB3A 4TVPH 1J8HA 2YSSA 1U95B 3LKNB 4PLOB 3EJJX 1P4LA 3U48A 5DD3H 4NQED 1KB5A 1KIRB 4DN3L 4PJFA 1F11A 2HH0H 4BELD 5F6IC 4YHKH 4XBGB 1RIHL 5EZOL 5SX4H 1KBGH 1DBJH 4XVJH 3K0WA 3AXLA 3QXDB 5C0ND 2A6IA 3WXVH 5IVZB 2I07A 4BUGA 2XPGA 2NX5A 3OKNA 2VL5A 3V4VL 1ZVHA 1TFHA 3VH8A 4MD4B 1EO7A 2EEDA 2BNRD 4WW2B 3E3QC 4YHNB 1OTUD 4G80A 3IKCB 5D1QD 4LEOA 1G6VK 4NUJA 3C5JA 3BKML 3HUJF 5E00B 4LF3B 2Q8AL 5GS0C 5CZVH 3FB6B 1F11B 5IW6A 4R97B 3HFML 3S4SB 1DFBH 1X5ZA 3NFNA 3EBAA 4X9FA 2YUWA 1WCQA 5IIEA 8FABB 1HE7A 5GGVH 3GRWA 1F4WL 1FFNA 5I73C 3W5MA 4P9HL 4OM0H 1PY9A 3HAEG 1OT1A 3I6LD 2R2EA 1YPZE 5DRXB 4IRJB 2XZAH 5E6YA 1KC5H 4AIZA 3EGSB 3JV4A 4PJHE 1C16B 4KY1L 4XVUD 5E99H 3EYQC 1IKNA 3VFNA 1A1MB 4EN3A 5MEOA 4HXAH 2VZVA 1A7RH 5D2NC 4P2QE 1HSBA 2M8XA 1CN4A 3IFLL 5DYOA 2HJKA 2ZCHL 2IPUK 1N5YL 2Q3AA 1IL1B 3GMLB 4NC0B 1VB9A 3KR3H 3P9MB 4S0UC 4PRID 4J3OC 4LSQH 4DKFL 4PY8I 3ZT6A 1LO4H 3L1OH 3UYOD 4MB4A 4YFLF 5EOTB 1BFVL 1F6AB 1RIHH 5EZOH 2EIZA 1EJOL 1LWRA 5AYUL 2IFFH 2CDGB 4OZIA 2B7DT 4OTXL 3MUGA 4JO1L 4X7TB 4PJAB 3GRWH 2GSGA 2Y36L 4IJ3B 3EKCA 4MA8L 5I1GH 1IBGH 2OS7A 3ARDA 2J8HA 1KENL 1NAKH 3I9GL 4NFBA 4L3ED 4Y5XA 4P4KB 4F15C 2GK0B 1Z5LB 4EQ2A 1GOGA 3K1KC 1HH9B 1OLLA 4WTZA 4LEXL 3M07A 4LBEA 5J12C 3SDAC 5B3JF 4TTDC 3NH7H 1W8OA 1VA9A 5C71A 2GT9A 5KVFL 4ZPTB 3DIFA 3ARDC 1KJMA 5AUMA 1E28A 4MQ7B 4UQ3A 5DMGC 1FZMB 2IGFH 2F9BT 3TO2B 3J8F7 1A7BA 1RY7B 5LGHL 2VRAA 2B1AL 3MRRA 4NC1C 3ULUH 1AHWA 5B39A 3QEUB 1MIMH 4F3FA 3N50A 4NQXA 1CYGA 5JA9A 1FC2D 3LKSA 3F7RA 3HRPA 1E27A 4M9PA 3RL1B 5F9OL 3DRTB 4GOSA 3SN6N 1U3JA 1OAZH 1J1PH 2W0PA 4PRAB 1J8KA 5DI8A 5DS8B 1EAPB 3DIFB 3ET9F 4NZTL 4DGYH 2F53E 3RWIA 5I1CL 3PV6B 1WWBX 2NY1C 3N85L 1K4CB 4MD5A 5T1KB 4Z5RB 1U3HC 1JF1B 2Z35B 4NZRL 4WV1C 3Q6FA 2DMBA 2VDLL 5IK3A 3PP4L 3TPKA 1EEYB 4BYHA 3WNOA 1Z3GH 2C1PA 1F97A 1X44A 3OKOA 4NWTH 2FECL 4NQCA 3SKMB 2A9NH 5T3ZL 4JPWL 3VXSA 3PNWA 4PJBF 1G84A 4JCLA 4LHUG 4GSDL 2JTDA 4PRPB 5SWZE 5GISH 3IXTA 1QUNA 3DRTA 4PJXE 4YE4H 2VDRL 1XGTB 2R8SL 2LVEA 4KFZC 4BQ8A 1VADB 4QTHA 5FYLD 4O4YL 2NY7H 1CFQA 2J5LB 3EHBD 1CU4L 3RWEB 2DQHL 1FNHA 1S5HB 1BQHA 5B22A 1FNSL 3Q6GH 1M71B 1KJ2H 3TVMD 1U2CA 3FQXB 4TSBL 2YD1A 3VRLF 5ISZD 1IAII 3G5XB 3PWVB 3IAQA 2VLME 1L7TH 3NN8B 4QRPA 4Z7VF 3V0AC 5E2WL 3V5DB 4ZFGH 3FT3B 3PDDA 1ROWA 2NX5E 3DHJA 3HN3A 5MENB 5I30H 2M1KA 4MA1C 2OQJB 3U2SA 1Q0YH 1NMBL 2FZ3A 3VWJD 4YJZL 2GJ6A 4O2CB 1TQBB 4S1RH 4FZ8H 4KGJA 1XZ0A 1S7UB 3GB7A 4H1LA 3NABH 1ES0A 5BRZB 3RVVD 3ARGB 1KBGL 1G9MH 3AROA 1SYVB 1GGBH 3NIGE 1EPFA 4JVUA 3P9LB 1I8MB 4NZJA 3RWGB 3BQUC 1KB9K 5GS1C 3SDDB 1D5MB 3QEHA 4NHUA 4Z95H 2FX8L 3DVNA 3VMPA 3FN0H 2XQYG 1D5XB 5C08D 5F1IA 4M5YH 1A1OB 1T1WB 1IVLA 4X98B 1AD0B 4RRPA 2BRQA 5GXBB 4R4FL 2AXHA 3DGCR 4FG6D 3VA2C 1P4IL 4HFWB 3IGAB 4J6RH 4P46C 4D94A 1RJZB 2F19L 4I1NB 2D7PA 4OKVA 3ARGA 1JPSL 3TC9A 4ONHB 2MNUA 1IAOA 4KZDH 4IOIB 5FUZH 1XMWA 4BH7A 2BJMH 2XN9B 4K3DL 5C08A 1RVFH 3INUL 5EOQL 2MFNA 4U6XA 1T1YA 1P7QA 5D1QA 2ARWA 4TVPD 2YA2A 3C6LB 2ATKB 4F8QA 2WWMC 4ZTOL 3MMEB 3UPRA 5I9QC 4WI4A 2I9TB 4H1LG 4RAUB 5BW7C 3BPCB 3B2VL 5D7LD 5TGBA 3UXFA 5GZOC 5IBLD 4XNYH 3NIDE 3L5WB 4LVNB 3ARDD 2FLRT 3ROLA 1AQDB 1RU9H 5TPWL 4O58L 1CGYA 2G60H 3UBXB 3AS3A 5DEFA 1WAAE 2F74B 1JI1A 3S4SA 3GEWB 2W92A 2EDKA 4RBPH 5KSAC 4TPRH 3QDGB 1T1XB 1QA9A 2MTPA 4NRXB 1RUAL 5GSVA 2H26B 3ZDYE 1JCKA 3GSRB 1NGQH 1G9NH 2QSVA 4R90L 2NY6C 4IMKC 3JV4B 1XT5A 2J3SA 2HJLA 4OLEA 2XFXA 2IAMA 1KTDA 5FGCE 1CDUA 3RUGA 3RI5K 2VDNH 1CIDA 3ZKMC 3KLSA 1BF8A 4BFIB 4HIXL 1E27B 3RL1A 5K93A 4Z7UF 3JV6B 2Y7QB 1JK8A 5D1XB 3BZFB 5DYOB 1FJ1A 4KQ4H 3JTSB 5C0JA 5E4EC 3T65B 5AD0B 4HULB 1WZLA 4HXBL 4KDTA 1QEWB 2J4WH 5HPMA 2NY6B 2ZPKL 1RZGB 4OGZA 4XGZB 4RFNB 2ZOLB 4YIQB 3BP4A 4JFXA 3P0YL 1PZ5B 3W5NA 1F42A 3C60C 3HPLB 2DD8L 5J7CC 2OZ4H 3S4SG 3MYZA 1CFTB 1BZ9A 1IJ9A 2BSTA 4YHIA 2NLJB 3FB8B 3OHXA 5CLTA 1AGDA 2W65A 4BUHA 2PUQT 1FO0A 4Y4FD 3GBLA 1KCGC 2W9EH 4XP9L 1FVCA 4LLQB 5FA4A 4FS0A 4JHWL 4QCIA 3F12A 4YHKL 3QCUL 2DQIH 3ARFA 5L2KA 3VXPA 3B8SA 5F3HB 1RIUH 3E6FA 3HLAA 4X7FC 2HT2D 5C07D 5IFHH 3BP4B 3KPQA 4ODTL 4MZ3A 4K3GA 1LO3L 4OZGA 3VWKA 3A67L 2IANE 2H2PC 5A43C 5H35A 2WIMA 1UXSB 3RY5A 2ZZUT 4YFDB 4XC3L 2WLYA 1QRND 4U31A 5CHNB 2W9DH 1JPTL 3CVHL 1UZ6F 4KHTL 3T2QA 1K8DB 1GCFA 2EKSB 4A2LA 3FZUD 2Z8WC 1R0AL 4ZOAA 2AXFA 5BV7H 3I50L 3GIZL 5F1OB 5CWSB 3P40A 2R56H 3L3GB 3ZDXE 1JHLL 4GRWE 4XNMA 3HG1B 4WUUB 2DF3A 5AZ2H 5GGUA 4AM0A 2F5BH 3BUYA 5GS0D 1V3JA 2C3GA 3LB6D 1IGFH 4MX7A 4N0YL 4Y19E 5I8KL 5DZNA 1CTNA 1BZQK 2PO6C 1T5XB 4X4XB 4LFHG 1RZJC 4J23A 2ZOKA 1OM3L 3R8BB 4D3CH 2NY4C 3KPNA 4RMVA 5C0AA 1G7MB 2ZKHL 5FHAH 4U7SA 4Z8FH 4JFYA 2AXJA 3DUUA 4UI2A 3VFGH 1F90L 3DNKA 4PP1D 3HPJB 5JMOC 1G9ML 3GSNA 3UTPE 1MRFL 2PNDA 4MNQA 4R0LB 2G5RA 1OTTC 3MUJA 4E0RB 1NCUA 3TESA 4MA1B 5CEZD 3RKDD 1D5ZA 4F7CA 4LCWB 5DMKA 5IB2B 1NEUA 3H0TB 1UM4H 3CFKA 1P4BL 4WFGD 3TVMC 3W81A 1WVZA 4JO4H 2DJSA 1RSFA 2IH3B 2ERJC 1CLYL 3GI9L 1BZ7A 3O2DH 1LQSR 4HKBA 3VXOA 3HZVB 3FOMB 3LPWA 3ROLB 2ESVE 2OSLA 1U91A 1ZLUH 3B9KA 3QG7L 2COQA 4OD1L 3MOBH 3WS3A 4XBGA 3QQ9D 4LQ1A 2E6QA 1KB5B 4LHUB 3PQYE 4MNQB 1YPZF 4GW4A 2A73A 3OKDB 5T1DL 1WJ3A 4M93B 1B3JA 3RWJA 5GGQH 2P5WE 2VDRH 4WDIB 3GNMH 2DJ4A 1KEML 4TQEL 4PGBA 1IAIH 1R5VB 3CFKB 3O2DL 3BKCL 1NLDH 4Y16B 2CJUL 5C0DB 5EUOA 4XMKH 3DXAB 4C54A 2E7LA 4CMHC 4JPVL 4E41D 1E4WH 5DD5L 1S7XB 4G80B 5TE6L 5TF1H 1WIOA 4XI5D 5IVXE 1JRHI 1QTYT 3X3FL 2B0SH 3E2HB 1XCQB 1KIPA 2LTQB 3K3QA 1U8IB 3MODL 3FO0L 3X14A 5E94B 1XF5B 4YBLB 3WD5H 1MHCB 5FM8A 4LSVH 1NDMB 3OX8B 3T2PA 4LPXA 3LN5B 4LU5H 1JF1A 2Z35A 4HFUH 3T3PF 2ATPA 2KH2B 1I1RA 4QRRD 4J1UB 1NAMH 1T5WA 2Y1VA 4ZO8A 3TLRA 1S7XA 3VG0H 4LLWB 1FZJB 4K8RH 5BV7B 3ALPA 4H88H 1VFMA 1Y6MR 2SEBB 4LLDB 4OB5H 3RVUD 2AJXH 2UY7A 7FABL 5JOPE 1EXUA 3QR2A 3TYGL 4OCRL 5ALCH 3EAKA 4WFHE 1GOFA 3U0PB 4RCAA 4FTVA 3RHWK 4Y8DC 3QPXH 3WV0A 3LS4L 3H3BC 1N64H 4UNUA 2A0LD 3CSBA 2H6PA 3IFPA 3I50H 4L4VB 4ERSH 3VD3A 2X4RA 3DX6A 3DYPA 2FJFB 5LQBH 1MRCH 2Q8BL 5ISZA 2EO1A 4M6ML 4PGCA 5ID0B 1A3QA 2I24N 2JB6A 4OFYA 2YRLA 3U46B 4BFGA 1Q72L 1MCBA 3G04A 4DN4L 1DQDH 1KLFA 3SDYH 1FAKT 5D71H 1N6QL 2EDNA 5B4MD 3MRGA 5L2KE 4Y4KB 3I6KA 2VLRD 1CWVA 3MA9L 3UTTA 4YX2H 5JDSB 2YPVL 3A6OA 4IMLB 4UOW0 4JFFD 3MX0A 2I27N 5EC2B 4FG6C 1EFXB 4XP9H 5BXFB 3UPAA 3BOVA 3OBAA 4KK5D 4HUKB 4MJ6A 4PYGA 1G7PB 5FM5M 5ICYA 2N56A 4XXDB 1E4KC 1Z9OA 4HH8A 3MNWB 1XCTA 1G6RL 1KN4L 1KJMB 1SHMA 5I1HL 1GGTA 3BPOB 4X4XA 4KTEL 5F72S 5JXAL 5DGQA 4NNPH 5F97E 5CCKH 4WHYH 3M1BA 1FG9C 1QSFE 4M7LT 3WNNA 4LMQI 1KIUA 3TIDB 3SPVA 4KQ3L 1DUZB 4C56B 3VGHA 3PABA 5JQ6H 2LAAA 1YY9C 5E2JA 4LSRL 2DTSA 2IPKA 2VZ3A 1FAIL 1FAIH 1DTUA 2BSTB 3EFDH 4LSRH 4Y5YA 4R97C 2VXUL 4XCNB 2ARJQ 3AY4C 4HPOL 2QQLL 4PJ5E 4UV7L 4ISVA 3R1GL 6FABH 3M1BB 2EDBA 2EDTA 1E4XH 4WU7A 4JRXA 2I26N 1A22B 2ARJA 4WIQA 4PFEA 3KPQB 4QRTA 4DTGL 5CIPH 4E41E 2FJGA 4JQVC 1R3IH 1MCDA 4MYWB 4UNTA 5E8DL 2VAJA 4LCCA 3C5SA 1E6OL 4M48H 4Y1AA 3HCVB 3BKJH 7CGTA 4Z76B 3U7YL 1SEBA 3QG6B 1AGEA 3EDEA 4PJXF 3KPRE 1BGXH 4NO0A 3K74B 3MV8D 5DVNA 3HR6A 1NMAL 5E0QA 3SE4A 5I8EA 3LKOB 4YO0B 1AGCA 5J1SC 3GO1L 4KAQH 2RR3A 4P9MH 3WIHH 5CGYC 4ELMA 3KPRA 4M8QA 5CGMA 5EUOE 1MWAB 3UEZA 2Y4SA 2GITA 3OTTA 4AQ1B 4X8XA 4KKCD 5HGBB 3EYUL 1S8DA 4WWKB 2DI9A 2Z8VC 3U9PH 2EXYD 4M7KL 1T2QH 1RULL 3RIAK 4NQCD 4LPUA 1JPSH 3DV4A 2MQ3A 3DX9A 1CQKA 1JPGB 2IPTH 3DUUB 3L9RA 4WI5A 1OGAE 1UH3A 5CIPA 5D72H 3TCLA 1JF5A 4HF5H 4LEOB 4LMQE 4XPTH 5EU6B 2DQDL 4NQSA 3E2HC 4C59B 5D96C 4ZD3H 1CXLA 2XN9D 5GGVY 3DVNB 2DICA 5GRXG 4FQCL 2HFGL 3U0TA 4IRSA 1FN4B 3TZVC 4X4MA 4ZS6D 4OCLC 4DJMA 3Q1SH 1QBLH 4N5EC 3T2OA 4X9IA 4TUKH 1B6DA 2E9JA 1GGCH 3AU1B 5DJXB 1MY5A 5HDLA 4UOJA 1TJGL 4JDVA 1SVCP 4J7RA 4PR5A 1GIGH 1CD8A 4WO4C 3IU3B 2OTUB 2R9HD 5KSBB 1R3LA 3KS0J 1NKOA 1HNGA 4R2GB 2YD7A 1ED3B 4FQXC 1AGBB 2R1WB 1UM6H 3F7YB 4UQ2A 4JG1L 1NC2D 1NFDA 3FQNA 1Y0LA 3OKMB 2VC2H 2BNRE 1V3KA 2BFVH 2IBZX 3MMEA 3DARA 3KJ6L 5D1ZD 1P7KA 2OJEA 5C0RL 3ZKSD 5EO1A 4Y16A 3GUTA 4OT1H 4R7NB 2XTJD 1X9QA 2VLRA 3UYPA 1T2JA 4CW1A 1QQDB 2ZG3A 4KPHL 2XWTA 1OPGH 3TJEH 4PREA 4QHUA 2QKIB 4XNMB 2XXCB 1KOAA 1KCRL 3O3BA 3MOBL 1G7PA 1BEYH 2HMID 1X6LA 3G5ZA 4ETQB 1HHKB 4HUWA 5D2NB 5M95B 3L7EB 4GUPA 5HHVL 1BQHG 5HHOD 2ZUYA 3EZ8A 1QRKA 3BGAA 1ZK9A 1LO5A 3DLQR 4XHJD 4RWYH 3GSRA 1G7MA 3O2VL 4C56D 4RWYL 1FCGA 4QHLA 4KRPB 1CG9B 1I8IA 2APBA 2X44D 5CILL 2H9GA 1UM5H 4U49A 3RI5F 5TFSH 3VXNB 2YD4A 2JJSC 4JHAL 4EI5C 5JR1H 2I9LA 3JTSA 1RZ8B 3QDJA 5C0JB 2BCKB 1GGCL 5ETUA 1D6EB 5INDA 3W2DL 2EDJA 1NCWH 1D7FA 1H8OA 3SDXA 4GW1A 2EDHA 2GCYA 2HYMA 1G1CA 3RGVD 1FL5B 3FQUA 3D85A 5C6PB 1ZGLM 1KPVB 4JFXB 4ETYA 2EDDA 4HF5L 3SDXE 3RZWA 5JW4N 3VFVA 3ALWA 5EO9A 2OK0H 3KPOA 4YPJA 4M6AA 3OB8A 2X1OA 1UA6L 4S1SH 1KPRA 4GRWF 3EYUH 1D6EA 5INDB 1IKFH 1QACA 3MREB 3MRBB 3QNYB 4XWOC 1RZKC 1FYTB 2CLRA 5DJ6A 1IFHH 1URLA 4P23C 1UB6A 1L0YA 3SDCC 2ZUVA 2W0FB 3O6LL 4P46B 3MO1B 4WFFD 4G6JL 4WU5B 3WFCH 4XWGL 4OZGB 3VWKB 1OQXA 5E9DB 4M61A 1ZT7B 3CDCA 2R9HC 1INQB 3DGGA 3VFPB 3FMGL 1IGFL 3QCUH 3U36B 3MRIB 4PJHF 4NKOB 1GZPA 2C9AA 1CLOH 3HUJE 3BQUB 4YHML 2QLVB 5HYSA 1UEMA 4ZPVB 1GPOL 1NGWA 1WFNA 5GGUB 4HJ0C 3TN0A 4FFYH 2QHRL 4NGHH 2ORBH 3QB7C 3VI4E 3JWDL 5GZNC 3UDWC 3BSZL 2WINB 1YNTB 3ZKMD 1CL7I 4N1CA 5IVNA 1T7YA 4G9FD 5HD8C 1S9XA 5LAXA 4ODHH 3JVGA 3GMQB 2CDEB 5KN5B 3CFJB 2EICA 5HVGB 5TH2B 2IPUG 3CXHJ 3WS6A 1KJVA 4L5FH 2FB4H 1FNLA 5GJSH 4PRDB 3TN0B 4ZOBA 4MS8C 1DVFD 4YQXH 3DSNA 4ODWA 5F1NB 3BW9B 3IDGA 4KJPD 2XNAB 2FIRT 1DVFB 5JXAH 1D5ZB 2OI9A 5A3IC 3OKNB 2VL5B 3KPLB 5D7KD 3MLVH 5DFTA 4HK0A 1RK1B 1BQUA 4JDZB 1HHGA 1ZS8B 5F7WC 2CIKB 3IAPA 3QUYD 5I76B 1MQ8A 1OAKL 3HZYA 4NIKB 3WLWC 1KEGL 4YQXL 1S9VA 3OF6D 2VR9A 2BNRA 2F58L 5DUPL 3O3BB 2G60L 4JDTL 3BE1H 5CGTA 4LASH 4HMEA 4L4TE 2VQ1B 4ZXBD 1EHLL 5E7FA 5D6DC 4TVPE 3AS1A 1BBDH 5ITFB 3DXAA 1J1OL 2BERA 5DJDB 3BKYH 4XPGH 1D5BB 4P57B 4PJIA 3V7AG 5KTEL 1C16A 1V8HA 2B2XL 2YD3A 3CXHK 4JGJA 4QYOB 5DUBA 1YDPA 3H3PL 4TSAL 5C0CD 1HHHA 4RMTA 3RL2A 1NGQL 1ZE3C 4HGKC 1WIUA 4TTDD 1I9IH 4IRSB 5I1LA 1CLZH 5HHMD 4EN3C 3WHXB 4G8GD 5F70A 1WTLA 2ZP0T 4DEPC 3QXDA 4KVNH 4F7TB 4QTHB 3MLUL 3L3IA 2KBGA 1B0RB 2Q76A 4ODSL 2DQFA 1AO7A 4F7EB 4TULL 4KRPC 2VDQL 3SEPA 4M6NH 1FG2B 1UB5B 2FNBA 3MFGB 2V7NA 4W70A 3K8LA 3SE3A 2X4NA 5I1JL 1CDHA 1KUMA 1LP9E 1X5XA 2FD6L 4AENB 4ZAKD 5A2LH 4X4YA 3LQZB 3VFVB 3RX8A 3LEVL 4S1QH 1DQDL 5HHNB 4WW2C 4JRYB 5GS2H 3PGDB 4X7SL 1YYMH 2VLRE 2QBWA 4X99B 1IZJA 3VRJB 4WO4B 3EYQD 1HK6A 1UEYA 4QLRA 2CRZA 2LTQC 5BRZA 3MV7A 4JJHA 4APQD 1G7IA 3EW3B 2CUMA 4W6XB 4F2MB 4QHUB 5FUZL 3WJJC 3L3DB 4WEBH 4OCSL 4PJEF 1M05A 3U9UB 4XCYB 5IW1A 1JHKH 2DLTA 1YEDA 2VR4A 3FOLB 3KS0H 1WZ1H 4EBQH 2XACC 1DLFL 2BDNL 4EDWH 5ERWA 5LXGL 2P24B 1T22B 3QBTB 2GTWB 4EIGB 5C0BA 4CKVX 5B3NA 1X5LA 1Q9KB 2ICEB 3VE0B 4HKJA 2VLKB 4FQ1L 5T1MA 3VXME 3QHZL 3AAZA 5GS1B 5F9DC 4V3DB 1S7QA 1ADQL 5BXFA 3PWPE 3GHEL 3QUXA 3UTSB 2ADJB 3QXWA 3TCLB 3QJHA 4P3CH 1MLCB 3CMOL 1T2XA 3Q3GB 3ZL4H 1INEL 3S37X 3TN0D 4KKAC 3WLBB 1G1YA 1EEZA 2ADGA 3HMWL 5ESVA 4PRAA 3REVA 5C07A 2AVGA 3MGTB 3MTRA 3O8XC 4PRIE 3L3JA 3QEGL 5E5MA 3TZVB 4H25A 3BESR 4YDLC 3FFCE 4R4ND 3Q6FB 5ALBH 5IMKA 4P2QD 4HJJL 1J05A 5ACZB 4MVBD 4LVOB 1C5DA 3BKCH 5AZEL 4YBHA 4UTAL 4U2ZA 5JZ7C 5CBEA 2OTUA 2V5TA 2IEPA 4TSBH 3E3QE 4N0CD 5JO5A 2FCBA 2WQRA 4RMRA 3BRFA 5IB5B 5T1DH 3V0WH 4LIQH 3WS6C 4F57H 2X4OB 5KBNC 3BDBA 2JIXA 4OUUB 3U0WL 4D3CL 3OAYK 3MREA 4GKNB 1LMKA 2NY0C 4EI6B 5I1AB 2BVPA 1FNGA 1W0WB 3P9WB 4JFHE 3LQAC 2EZ0D 4JPWH 4JY6A 4R7NA 4WTXA 2VC2L 4NWTL 1Z3GL 1V7MH 3UC0L 5FDYA 3W0WB 4ONFH 5J57B 3S88L 3C60A 2ARJB 5DMGD 4L3EE 3ME0A 5I71C 3T0EC 4WEBL 4F33B 4WFHD 1RIVL 1CIUA 4WFGE 4YK4C 3GK8L 4YR6B 4M1CC 5I1DB 1TNNA 2R0ZH 1T89A 1G7LB 5F9OH 4XP1H 1GYAA 5JA8B 4NQUA 3D39B 3RRQA 4OF8A 5HYSB 3GMOA 3L5JA 1IBGL 3ILQD 5BCAA 3GSQA 3B6SB 3OKKA 2YBRA 3Q1SL 3LKOA 1F6LL 4PGDB 3OKOB 3IKCA 4MA7H 2B1AH 1WQVT 1Q1JH 3KDMA 3HI6L 2VR5A 1LVEA 2E8ZA 3NFPA 4BQ6A 3N1QC 4LLAA 5D7SL 2YA0A 4MMZC 1G7HA 4KI5E 4M1GH 5HHMA 3ESUF 3O3DA 4U2YA 4N0FA 1ZANH 1L7IH 4P5MB 5ECJE 3S35L 4I3SL 3VFUA 1JF6A 2ADIB 1YY8B 2CGRL 4ODVL 1BJ1J 4XMPH 1X7QA 1IC1A 2DQUL 2DQGH 4XAKE 3MYJB 3I3BA 4QEGA 1KFAH 4GAJL 2PTTA 4HBCH 4IRSC 5TDPA 3HB3D 2E7HA 4NDMA 2ZSWB 3E2HA 5D7IF 3NFPB 3JV5A 4L3AA 5INCA 4KMLB 4FTVD 1WLHA 2VO5A 3VWJB 2R23B 4UAOB 3OAZH 4X99A 3D18A 2HT4C 2CLZA 1QBAA 3H9SA 4PV8A 1C7TA 2VQUA 2X4TB 3LN5A 4YDIH 4ZSOA 5AYUH 3RFZC 3JUZA 5IFJB 4U7MA 1P1ZA 3BISA 3FFCB 1GC1L 2BHUA 5DQ9B 5EWIH 2V2WB 4JAMA 4HS8L 1SM3H 4RISL 4PGEA 4NJAL 3FB7A 1TZGL 3NZ8B 3O2DA 4DZ8A 1IQDA 3BZ4B 3NIDF 5F1IB 3S7GA 4HIHB 1A6TB 5T5FL 1J7VR 3TO4A 3I02A 1IEAB 1LNUA 2AJSL 5F96H 1T1ZB 4Z7OE 1RUAH 3R1GH 5TF0A 3LKQB 4P59H 1FL6A 3LPFA 4PREB 2HN7A 3HRZA 3TF7C 4Z7UE 4GBXB 4OZFB 2DIBA 1BIHA 1TITA 5ITBH 5C7XH 1HOCA 1YDPB 3T3MF 4PP2B 1F4AA 1KLUA 4KVCH 3HNTL 2P5WD 1LD9A 3JV6A 3QA3A 3CDYA 4EI5B 2AQ2A 4K2UL 5HI5C 2AJVH 1LE5A 3CLEH 3JWNC 3GI8H 3QQNA 1NLBL 1DLHB 4HUXA 1JJUA 1TPXB 2R2CA 3BI9X 1GAFL 5HPMB 4UDUA 3TYFA 5IJVA 1NCCL 1SEQH 1FL6B 4P3DA 1N3NB 1J05B 5ACZA 1QP1A 5ICXB 2HTLD 3BSZH 2WQ8A 2LU4A 4LNRA 3TBYB 4FABH 2B5IB 1S78D 2ZG1A 4DGVH 1U8MA 3TT1L 1INDL 4P9HC 1FQ9C 3KPTA 1RZFL 1I8KB 3UJIH 3FONA 4G9DB 1GPOH 5SWSD 1PW3A 3PWJA 5ICYB 5GZND 3ZKXB 4EI5A 3V5HA 4QO1A 3UTPD 5DDHB 3C8KB 3T0ED 5C09A 2ERJB 3FMGH 4JM2B 3QIWD 1A3RH 1I7RB 5GGRB 4HK0B 4NKMB 3LRGA 4XCFL 1I75A 2YPLA 1N6QH 3STBA 1MEXL 1BM3H 3JTCA 3AGVA 2CUHA 1VGKB 3WFCL 3QUYA 3VXUB 3UDWA 3CIQA 4D9QE 5KZCB 1FPTH 1TETL 2CKBA 4G5ZL 3W0WD 4ZFOL 3EIFA 3R8QA 2V2TA 3DROA 3HZKA 3AXLB 3IFNL 1EAJA 2RCSL 1HSAA 4G6AD 5MHSE 3SGKA 1CLCA 1LDPL 3P4OB 3VMOA 4K9EL 4ONGH 4BQ9A 3T8XA 3SOBL 1BFOB 4FXKA 3P3YA 2R1XB 4Y2DC 2FEEI 2J5LC 3HE7C 4ELME 4CVWA 1A6VL 1XGQB 4UT6H 3DX8A 4OD2B 5EZJA 5H2BA 5KAQG 5KAQF 1N6UA 4Z77A 1JWMB 1HEZB 3QWQB 5IW6B 3T0EB 1C1EH 2CLVA 2EC9U 2F8OA 4YHIB 1TVHB 2VOTA 3LEXA 5BZDA 5C0IA 1YJDC 2DKSA 4KUCF 3BUTA 4HG4J 4XRCB 4O2FA 2HT2C 4NQVA 1QR1A 3WL9B 3IDYC 4K2UH 3WEXB 2EDXA 3QDME 4JM4L 3VFSA 3SKUD 4EDXA 1AO7B 2NY0B 1GZQA 5EU6E 4W4OC 4PJ7E 1T6WA 3NFSH 3UJJL 1ERNA 2EDOA 1AKJD 2GKIA 1IGTA 3O41B 4K7FA 3MXWH 4PJBA 4X4YB 5EBMA 4OBRA 5CEYA 4JR9L 1KXQE 4K07A 4JRXE 5DMKB 3X12B 5I30L 5FO7B 5HHVH 4O2FB 4P99A 5I1CH 3ARWA 2ADFL 2PTVA 2DLFH 1MRDH 1QG3A 3KPRD 2XYCA 5SV3A 4KRPD 4BQCA 4QXTA 1KG0B 4N8VG 4DVRL 1DZBA 3BIBX 3FQRA 1J9CT 4LSPL 1YC8A 3U79A 4XCYA 2FLBT 5IW1B 4Y19A 4JZOB 1L9MA 1NC2A 1G0XA 4Z9KB 1IQDB 4KKBD 4N9OB 3DMMD 2JKXA 4G43A 1CL7L 1CXKA 5SX5H 1D5IH 1PG7X 5I16A 4MNHA 1T5XA 3QFJB 5ESAA 5HGHB 3D6GA 4D0CA 4FFVC 4JO4L 4L9LA 2AXGB 1V7NL 4LRNH 1GVIA 1EVUA 1S5IL 1JHKL 4TNVF 4XWOD 5F7DA 4HBCL 4I18A 3DJ9A 1WEJL 4IOFC 2FH8A 1JYXA 2R2BB 5DEFB 4ZFOB 2F74A 3QA3B 1OAXH 3QQ3B 3WFHA 1M6OB 3PGFH 1X5HA 2EDRA 4NO5B 4EN3D 4BZ1H 1CF8H 3O3UN 1YEJH 1PX3A 5CEZL 4ORGB 3PHSA 3PWPD 5D7SH 1S7WB 2CRIA 5C08E 4L3CA 3VCLA 1ZVSB 4QXUH 3GRWL 1VFBB 4ENEC 4EKXA 1IAMA 3WSQH 4AH2B 1K3IA 2NY1D 4KJWD 4OLXL 2P5WA 4P2RE 3H9YA 1TLKA 3VXOB 1U8LB 5EBLB 3RL2B 1YMME 2IAMB 3VXTB 3DSFH 2N4IA 2FEDC 5B38A 5IFAL 3QIBC 5INCB 4XNQA 1CXIA 1XF3A 1OSPL 4Z7WA 5IB3A 5C2BL 3RDTD 2DN7A 4AL8H 2L7UA 2VXQH 3T4YB 3SQOH 5KVDH 3GM0A 2JLLA 1T7ZA 1G7QB 2V7NB 3FJTA 5CJXA 1BVZA 2P5EA 1A7PL 2ZWLT 2OBGA 4NQDD 2IADA 3RY6C 3RNQA 3MA7A 1KN2H 3IAGC 5D5MF 1N0LA 4NO2A 5HVWA 2EDFA 2PN5A 4ONFL 2F53B 4GAYA 4NC1E 3QPQD 1QD0A 2Y06L 4FQQA 4RZCA 5HHNA 1KLGA 2NW2B 4JZNA 1TCMA 4ZODA 2P5EE 1XCQA 3DYOA 4JY4B 4JFOB 1WWCA 2E7MA 2E9WA 1WWWX 2KQMA 4CNIA 3V2AR 5JW4R 3QWOB 1CFQB 1WBXA 5GJTH 5I75B 4CN6A 4CU6A 1ORSA 4Z78B 4UV4L 4I5BA 2BP3A 5IMOB 3O4OB 4FQJH 4P59L 4PDCE 5CP7A 3TH3T 1MRDL 2EYRB 2YSSB 5DC0A 3BPNC 5D93C 1FZOA 2YUZA 4LCUB 2Y9RT 1LE5B 3IJHA 12E8L 3VGAC 3P0YH 1QSVA 4XCEA 4HDIA 1PKQB 2W07A 2P24A 3WO4C 4MCYA 4HEPG 4X9HA 2Z8SA 4OAWB 1FRGL 5I1KL 4J3UA 3IB4A 1TMCB 3RTQC 1SYSB 1JZ2A 4NP4L 4OLVH 3IDNB 1MLCA 1GHFH 4PJ5D 5DD3L 4AT6A 4WUUA 1F4WH 4LCIH 3S97C 5BVJB 5I74C 4RGMC 2KZWA 1AD9A 1EEZB 2ADGB 2Y06H 2P8LA 1UWXH 1T83A 4X6EB 3FFCD 3U36A 3G5VB 4HFWA 4Z7VE 4NT6A 4C58B 3WO3B 4EXKA 3JWDH 3CVHA 4IDLA 4UINL 1WZ1L 4UILL 4Y4HD 1P1ZB 1HI6B 3CZJA 1I1CA 2PR4L 4R4BA 25C8H 5DJ2B 5T3XH 4BH7B 4ZNEE 4MJ5B 5DUMH 4NM8L 2YN5A 4HUVB 3JV0A 3H9HB 3IU4L 1YPZB 1P7QB 4R0LA 1DBJL 3UP1A 3NCEB 1AP2A 4DKEL 4ZO9A 1L4IA 3MRPA 1J8HE 3TM6A 2J12B 3QZWB 3EOTH 3C87A 3GMQA 4O2CA 1VENA 3BEVA 3OGCA 3BP6A 4GG6A 2UYLA 4XCCH 1WFOA 3CZFA 4PYHA 4XBPB 4YO0A 4GJTB 3PGFL 3EO0A 3ISWA 4FQLH 4PP2A 4QNPE 3TBVA 1F6AA 4U1LA 5FYKL 5HGAB 4HWBA 5KW9H 5CBAA 1TCRB 1J0JA 1LEIA 4YGAB 4PJ9D 2X9XA 2V2XA 3HE6B 1MJJA 1VADA 5E2TL 5D7JD 1Y18B 1DVFA 2JJTA 4OLWH 1PJ9A 1MOEA 1S7TA 5KS9B 2V17L 3FL7A 4A2MA 3S88H 7FABH 4DGVL 2YBRB 1XH3B 1O7VA 1MHHA 3I6GA 3ZE1E 5MENA 4IIQC 1MHPL 1R5IA 1HIML 1P9MA 4P2QB 4KDTC 4WTZG 3AB0C 4TYUA 1FN4A 3X3GH 1BBDL 3D0LB 3SE3C 3SDAB 1TCRA 5J12B 1N0XH 3TBTB 2HP4A 5BJTA 1IT9L 4FHBD 1G9NC 1FLTX 1XF5A 3QO0A 5C70A 1FYHB 1QNZL 3QEQB 3ZE0F 4YXLL 5C2UB 4G8GE 3HTLX 4GMTH 4K8RC 1MUJA 4Z7QE 3LY6A 1CD1B 4QTIL 1DL7L 1PBYA 1YEFL 3PIQA 1JN6A 1G7JB 4Y19B 3SCMA 2HFEB 1BREA 4X98A 5IEHB 3T0WA 5EULV 1KLGB 2NW2A 3WHXA 5T5FH 2JELL 2R0KH 3D18B 2DRUA 4DOHB 1EXUB 3LH2H 4HCRA 5EFIB 5EN2A 1ZLUK 5GS0H 3Q0HA 1MCNA 4L8CA 1YEGL 5ABDE 3SGEI 4PGJA 4J8RA 2R2EB 1S7SA 3DVIA 4JM4H 3SO3B 2DWDB 5T1KA 3RWCB 2CK0H 2MHAA 1BFOA 3MV9A 5HDQH 2AJ3B 1FHGA 4G7VL 5I74B 5GRVK 4U6YB 5CP7B 1OGTB 4NYLA 2AEWA 4KV5E 5DQJA 5TDOA 5EZLB 4LVOC 5IROC 3IXTB 2DJUA 4MNQD 4P2RA 5JMRA 3TF7A 1IGJA 1A6AA 3LKRB 4NZRH 4UMGA 3T1WA 2O5ZH 2VZ1A 3S5LG 4M43H 1M71A 4KJWC 1B9ZA 1PDKA 2DWDA 2BY0A 3Q5OA 3OKEA 3RTQA 3O4LE 2EDWA 4YAQB 5IEKA 1EFXA 1RZJH 4N5ED 3CFEA 4KK9D 3GJEA 3KXFA 1NKRA 3QDGA 5HHPB 3TBSB 5EU6D 3QDJB 4TUKL 3IDMB 1YEKL 4YGVA 3QDMD 2X4QA 4JVPA 1MEXH 1EEQA 4NFDA 4JGUA 5LGJB 1MWAH 4WV1A 2HFGH 1IM9D 5IROA 3GUTB 4HKJB 1S9WA 3SPVB 1XGUA 1KCKA 5DTFA 4PRBA 3RUGB 1WTGT 4N9GB 3BH8A 4L8SC 2Z93B 1YUHB 1TJIL 3O6MH 1OAXL 4AEHH 4Z18A 3NPZB 2YRPA 1I9JL 5AWNH 1FZKB 2YD5A 1YEIL 4HMDA 3ARGC 4QHKJ 1WT5A 5L9DH 3WLWD 5BS0E 2VXSH 3TBWB 3C8KA 2O61B 1QO3B 1SEQL 4KJYB 4KMTL 1U6AL 1RJYB 4G8FA 4P46D 3MNZA 1BOGB 5DSCA 3VGGA 1NLBH 3T77A 3SKNB 2NTFB 5J11C 4LCWE 4W81A 3CDGB 4ORZC 1CL7H 5A16A 3LQMA 1P84J 4M61B 3MCLL 3VWJC 3SDDC 1P5UA 2ZJSH 2XTJE 4NRZA 2EIBA 3S37H 1J11A 2NXZC 1TENA 3GSWA 5J6GA 3T8XB 4GS7C 4N5EA 4OZGE 4FXKB 4X6CF 2VNCA 1VACA 1BFTA 4HLZH 4LCYB 3WN5B 4AT6B 1MAMH 3ZT5A 4Q0XL 2BVQB 4D0BB 5ALBL 5IMMA 2QSTA 4KK8C 1A14L 3FFDB 3U4EB 2FJHA 3VXMB 1YEFH 3PL6C 2EE2A 5MHSD 4OZFH 1BAFL 3OAUL 2QQLH 1JGEB 4HCRL 1NCAH 2CXKA 4NT6B 3GMRB 1I3GL 4CJ0A 4EUPB 3F62A 5DFVC 1ZGLA 2YXMA 4GKZB 2QJDA 3L3GA 3NMEA 3G6JE 1CGSH 3FQXA 5DJ6B 5HYEA 2AJZB 2YMXL 5FCSH 5GGTL 4TNVK 5J11B 4IS6B 4GAYB 1JN6B 4HWUA 4G8GA 1S7RB 3RWHA 1EEUA 3OR7A 1ITCA 1I3UA 3BW9A 3IDGB 3QISA 3SY0A 3MJ7B 5FOBB 4RNRB 2BDNH 1A7PH 3FTGA 4AEFA 4GAJH 2VKWA 3ARRA 4GG6E 1XZ0B 4LF3A 1CGTA 5L7XL 4HC1H 4AG4L 1KCVH 1HHGB 1ZS8A 1OARH 3M8OL 4JQVA 5TQ0H 5C2BH 5DGRA 3BXNB 4G9FB 3TA3A 5MEPA 4ZUSA 3IDXH 3C09C 3MV9B 1FFNB 2RCSH 1LDSA 4KU1A 2FJFA