1HOCA

The three-dimensional structure of h-2db at 2.4 angstroms resolution: implications for antigen-determinant selection
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
272
structure length
272
Chain Sequence
b'GPHSMRYFETAVSRPGLEEPRYISVGYVDNKEFVRFDSDAENPRYEPRAPWMEQEGPEYWERETQKAKGQEQWFRVSLRNLLGYYNQSAGGSHTLQQMSGCDLGSDWRLLRGYLQFAYEGRDYIALNEDLKTWTAADMAAQITRRKWEQSGAAEHYKAYLEGECVEWLHRYLKNGNATLLRTDSPKAHVTHHPRSKGEVTLRCWALGFYPADITLTWQLNGEELTQDMELVETRPAGDGTFQKWASVVVPLGKEQNYTCRVYHEGLPEPLTL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The three-dimensional structure of H-2Db at 2.4 A resolution: implications for antigen-determinant selection
pubmed doi rcsb
molecule keywords CLASS I HISTOCOMPATIBILITY ANTIGEN (H2-DB) (ALPHA CHAIN)
source organism Mus musculus
molecule tags Histocompatibility antigen
total genus 56
structure length 272
sequence length 272
ec nomenclature
pdb deposition date 1994-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1hocA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 1hocA01
3OL2A 2D7OA 3HS0B 4JR9L 5DHYA 4AQOA 4I3GA 2XACC 4XNMB 1V3LA 3LN9A 1CGYA 1L7TL 5JXEA 3BN9C 1TTFA 4JJ5B 4WFEE 1KT2B 1YYLL 3OJDB 3OKOB 1R0AH 2YD8A 5I1AA 4P2RD 5HTSA 1OB1A 4DZ8A 3BN3B 1AFVL 3NA9H 4PJIF 1A5FH 2Z91B 3TIEB 3D85B 2D7QA 4IJ3B 4P57A 1NGWA 3WUWB 1RVFL 2XKSA 3K2UH 1FFRA 4BKLA 1MFAH 3I85A 3LKOA 5F44A 4PBVC 2ZKHL 1B0WA 4Q0XL 5HDBE 4MQXD 1EZVY 3WL9A 2QADD 5CD3B 2V17L 2ATKB 1DQMH 5IM7B 4G5ZL 1HHGA 1T7WA 3V7AG 3PQYD 4Y19B 2X4RB 3FAWA 4TVSa 5I9QB 1M7DA 2OJZL 2OMNA 5SWQA 5DFVC 5HYJE 3MRDB 2GAZB 1GGCH 1AKJA 2VC2H 3L3IA 5DVLA 1JFQL 1VB9A 4NO0B 4XI5C 3MLSL 2QJDA 5D2LB 3FFDB 3IDJA 4DVRL 1QFOA 3X3GH 2HG5A 4XPTH 2VERN 3WEXB 4X80H 3VD7A 5MP6L 2X10A 5DA4A 1TNNA 4JO4H 4X7EC 4TSAH 1H5BB 1PDKA 4HWZA 5LWYL 1CBVL 4I77H 4NZTL 5HGHA 5A1AA 4CN4A 3WD5L 3FMGL 2R1WA 5E8DL 1UA6H 5T3XE 5KANI 5GS0H 4JM2C 4PJBF 3FAXA 3MLVH 4P4RA 4A6YL 3U7YH 3T8XA 2F8XC 2FX7H 1JV5A 2VISB 3ZT6A 4IDJL 5D7IF 4LRNL 2V5SA 5LAXA 1YEGL 5I75B 4M7LT 4L8SB 1LQSR 3G5VB 5FUOH 1J8HB 1X6LA 5KSVA 4XMPH 4LHUA 3U30C 5F9JB 1P4LA 4DOHB 3Q1SL 5DJ8A 4ONHA 4K3EH 3QPQD 3UBXI 3MACL 2I25N 4PJHB 3C2AH 2FR4B 5DD1H 1KG0A 4XVSH 3M1BA 1N5YL 4DKFH 2XXMB 2DQGL 3ET9F 4TRPH 2IQAA 3BDBA 4G59A 2CR3A 1GC1H 1GZQB 1H3XA 1UT9A 2Q7NA 3NA4A 1KLGB 1XGQB 2P8LA 4MVBD 4WJ5A 3VFPA 1YC8A 2KKQA 2CDEB 5DHVH 4M00A 3EYOB 3QIUB 3BPLB 4H88L 1A6UH 3BZEA 4G8EB 3SDAC 1T2XA 3DV6B 2WV3A 4Y4KD 2Y06L 2CIIB 2P5EA 2PKDA 5IVXB 2CRYA 3IJYA 5DURB 1NANH 4D0DB 4JZOA 1F97A 5F1IA 1QVOA 1U8KA 4OF0A 2NLJB 5DSCA 2AJ3B 4HGWA 5EBWB 1K4CB 4K8RC 1QBLL 4BSVB 3LIZH 4N9GA 3NGBB 1MCOH 2FZ3B 3ARFA 5FKPB 2DRUA 3L3GB 3PNWA 4XCFL 5JXEC 1FNFA 4PJCF 3BPOC 1A1MA 1G0YR 5E5RB 3VFGL 4QY8A 4J8RA 2EYRB 1AH1A 1TZGL 2JJSC 5J3HD 1MJ7L 2Y5TB 1T2JA 5FOBB 3TBTB 3UTZA 5GGRY 4L29A 4C83A 1Y6MR 1PYWB 4HKXA 4AH2A 3Q6GH 4MJ5A 1MCFA 4JO2L 2X7LA 1DTUA 2AJYL 2R9HC 1KPVB 3HS0A 4XHJD 5F3BA 1TVHB 4GAJL 4OB5L 1DQJA 4A2LA 3QEQD 4AM0A 4JFFA 5HGBA 4HHAA 3ARTA 3NIGE 2DQIL 2H1PL 2Z92A 2QKIB 3C6SA 4U49A 2A9MH 1U9KA 4X7TA 1PBYA 3HZYA 1TQBB 2OQJA 4WI8A 5I8OH 1Z5LB 3MLTB 5B3NA 3GMPB 3QP3A 5GRZA 1CGTA 1A6WL 5FYKU 4KPHL 12E8H 5EC2A 3VXSB 5BW7A 5ETUB 1A6VL 4PUBL 4GRWH 4LL9A 1CYGA 1WFTA 4X98A 3DBXA 5FM8A 3I6GB 1QRNA 1FNEB 2AJVL 5CILL 4WDIB 3PWNB 4N0FA 3EO0B 1MAMH 1NCUA 3BGAA 2APBA 1ZLVK 3ZYOA 4L1DA 3I50H 1OAKL 3DX7A 1AP2B 2YMXL 4BA8A 5C6PB 3REVA 4X6FA 3IDIB 3INUL 4N8VB 4LSDA 4N68A 5TDPA 2H2SC 1P69B 3OJVC 4NZUH 5KVDL 2B39A 3NZ8A 3JSSA 1ZHLB 3BH9A 1NKOA 1AGBA 4HG4J 5C0CD 3D9AL 3LKQB 2CLVA 1KBGL 4WV1A 3TNMA 5L2JB 4NNYB 3MFFB 2BNUA 5BS0D 1X5KA 1A7PL 1X4XA 3T0EB 2NY3B 3GDBA 2ICWJ 1FC1A 4E42B 4PV9A 3ULVE 3RKDD 4PJGE 3IRPX 5BVPL 1XGRA 5DK0A 5JR1L 2DL2A 1VESA 3SKMB 3QUZA 4Z8FL 4E0RB 4L9LC 3DXAB 4WUUD 1IGML 5E08H 2E7LA 4ISVA 1HKLH 5JIHA 4TSCL 2AI0L 2WQRA 3IYLW 3NZHH 4U3CA 1XR9A 2E6QA 1OCWH 4U33A 5JNYB 4YE4L 1C5CH 3ARFC 3REWB 4D8PB 4FMKA 3RWCA 5DQJB 1P5VA 2DKMA 4PD4J 4PJEB 4V2BA 4MZ3A 4H1LA 3GSNA 5DR5L 1D9KB 1YMMB 2HWZL 4JPVL 3CZFB 5I71B 1VA9A 1NMBL 4JO1L 1MI5A 1ZVYA 1LK3H 1JZ6A 1BBDH 1A6PA 2NXZB 1LO0H 2EIZA 2MMXA 3CVHB 4JKKA 2FGZA 4X6DF 5I1GL 5DYOA 1OP3K 4Z7UE 1WBZB 3MJ7B 5AYQA 4O2EB 3A0OA 3OKEA 1MWAA 2PTVA 3VGAC 4NO3A 4BZ1H 1BIHA 4AIZA 4KXZH 2W0PA 4S1QH 4P3WA 3OX8B 5JZ7D 4G8GD 3NABL 3MJ9A 1A7NL 1FNHA 1YQVL 4ETQA 1EFXA 4ODHH 2OP4H 5D2NE 1MRDH 3S4SB 5BW7C 1E27A 1KPVA 3P9MA 1GZPB 4Z7QE 4DGIH 1YUHA 1G1YA 2OSLB 1OSZB 4DFHA 1INQB 4HUUA 4GKSB 35C8H 3RWGA 4JZNA 3WNLA 5DO2D 5JLZB 5HVWA 2DQTH 3HI5H 1RJYA 2NW2B 3NPZB 3QHFL 5IB5B 4L8DA 2NX5E 2BSRB 1X7QB 5EN2A 5L0QB 3W9DA 5HHMB 4ESKA 1TJGL 2BZDA 2VJXA 3QQ3B 1H5BC 3GI8H 3V9FA 5AD0B 4HGMA 5BZWA 4NKMB 3OKMB 3A6CH 1T2QH 3HAEH 3ZYZA 1AJ7H 3UO1H 4GH7B 3T08A 2VXVL 4W70A 1A14H 4MWFA 4WV1C 4G7YH 4X6CF 4R4BB 4Y89A 1PVHA 4KTYA 4ZTPH 5I75C 2HFGH 5DD3L 4HPOH 3L7FB 3CCHB 1QFPA 4RFNB 4LSTH 4I3SL 1MHCA 4LKCB 4DVBB 2AV1B 2IANA 3R06A 4YGVB 1VKXB 1P6FA 2QHRL 3CLFH 4M8QB 4PJIA 2E9IA 4ZS7H 1MJJB 1YC7A 3RIFF 3S8WA 3QUZC 3S37L 4Z0BH 5A2KH 2YPLE 3HCVB 1U91B 4BZYA 2PW1A 3P0YL 4OLYH 2E7LC 4XAKE 3G08A 5C0BD 4F2MB 2BSSB 4DTGH 3CJJA 4HX1B 3UX9B 4WTZG 4PLJC 4OTXL 3G04B 5I1DA 1BREA 4PGBB 2CKBH 1G0XA 2QSCL 3V52L 4CDGC 3QDJA 5GJSL 5D7JD 5LGJA 5CJOH 3VA6A 1AHWB 5T1KD 1WFOA 4XXCA 5JHDE 3PWJB 4BUHA 5I18H 4XNZC 2BSTB 4YIQB 1CICA 3V0WL 4R7DA 4U1GC 4PR5B 3SCMA 1N6QH 5GQBA 2JK5A 3RUGE 2OM5A 4TTGA 2FO4B 4KRPD 1YN6B 4KJYA 4J3TA 4X99A 4YDVB 4G43A 5F97E 3SDCA 5GZOC 2EDLA 4YDKH 2W9DL 1U42A 2IH3B 1A1NB 2R23B 1DBML 1KCUH 2FSEA 3KLHC 3Q48A 4PJBA 1FYTE 4OM1L 3UJTL 1UQSB 4MNHA 2LU3A 1VEMA 1TZHA 3NIFF 4JHAL 2EE9A 1WV7T 5D7IA 3O3EB 1QSFA 4IBLT 1Q72L 3M8OL 1UXSB 2OMBA 1SYVA 5I1KH 1HDMB 4QTHA 1D5BA 4PJ7A 4ORGB 4HUXA 1T83A 3SJVE 4CUCA 1A64A 1I9IH 1FO0B 4QEGA 1FFNA 4AIOA 4O2CB 2ARJB 4LF3A 3F7YB 2WUCL 1N4XL 2EEAA 3HE7D 5EBMB 3VFTA 2IPUK 4HIIB 1IGJB 2NZ9C 3PWPA 3DX9B 1C8PA 1EIBA 1FORL 4PJFB 2DYPB 1LO2H 1RZKL 3QZWB 3MV8B 3P73A 4Q6YA 3H3PL 4ERSL 1G7LB 3ROOB 1S9YA 2J8UF 5KTEL 1WWWX 2GSIB 1S9WB 1GZPA 1JPSH 2AJSH 3F5WB 1XF3B 3AAZB 3BHBB 2C4XA 5EZOH 2L4OA 4ZXBA 1NCTA 3D3VB 4ODUB 3FQUA 3VXUE 1FNGA 3MV9E 5DZNA 2I07B 3WDHA 4FQXD 4AEIH 5FHAH 1NBZA 2NW2A 3VFMB 5B39G 4OM0H 3MBXH 4NN5C 1IL1A 1BVLB 1X7QA 4XPAL 2AXHA 4DKDC 2YEZA 5K9QG 4M6ML 3RDTD 5DJDA 5JUEH 2ESVB 4U1SA 1KJ2A 1IQWH 1X5GA 2EYTA 4HT1L 3HB3D 1TZIB 3C9NA 3WFBH 1AGDA 4NZRL 5T1LB 4GW5B 3C87A 3OKDB 3MA7B 3ZTJH 1TJHL 3VXQA 4TUKH 1CCZA 1HZHL 2VLJD 4LNRA 4K55A 3IDUA 2HT4D 5GJTL 4Y5XB 3GSNH 2VZOA 2DLFH 2OL3B 1OAUL 2OZ4L 3FONB 1CFNB 1UM5L 5A16A 4NM8L 3CSYA 1BQSA 1V05A 4FQJL 4OKVA 2Q8BH 3JUYA 3EJYD 3VXRA 4ODVL 2R2EB 2X89A 4LSUL 1VGKB 5EOCL 2NY6D 2FL5B 1FG2B 2X4TA 3STBA 5F9OL 5C6TH 4L5FL 4OCSL 1ONQB 4Y5YB 4V1DA 2EE6A 5AUMA 3WHE1 4LARH 5C0RL 4XVTL 1CICC 4FQHB 4Q9BA 3SCMC 5F1KC 4NC1C 2AKRA 4E9LA 1MWAH 2H32B 4YXKL 4L8CB 5F8QC 3RIAK 1ZT4A 5JQ6H 4WEBL 1J0YA 3SDCC 5EB9A 1BLNA 4CADB 3VW3H 3DHMA 5A2FA 5D1QD 5JW4M 4N1EA 1DZBA 3OGCA 5JO5B 1WZ1H 1I1AD 5DUBB 4PDCE 3UZVB 2GT9A 3HPJB 3MJ9H 3G6DL 2EKSA 4LQFL 3QDGA 4OZFB 5CEZH 4FTVA 3TPUE 5CZXC 3N50A 3VFSA 1CDJA 3G6JE 3WIHA 2IGFL 3QI9A 4ZUWB 2VL5B 5DRZA 4K9EC 2PO6B 4WFGD 5JHLL 2O5YH 2R2BB 4S1DC 5DUML 4YDVA 3FO9A 5I15L 3Q0HA 4ZQKA 2Q6WA 2KZ1B 5KVFH 4QRQA 4Q9RL 4C56A 3P9LB 2OTPA 5DS8B 1H9VA 2DM4A 3WN5A 5EUKB 5DI8B 5GRVL 3QBTB 1T66C 1JF1A 3OSKA 3R1GH 4FFEX 3P0VH 5D4QA 4NN7C 1F58H 4Y1AB 4Y0GA 3DUHA 2WBJA 5KSBE 2DS4A 2JTDA 3NAAL 2IQ9H 3U0PB 2VYRE 4ZXBC 5FKAA 4EOWL 1A3RH 5MEPB 1HQ4B 3QO0B 5F89B 5TE4L 5IIEA 4X6BA 4OZIB 3HKFA 4YEEA 1FFOA 1BJ8A 4UIMB 4WUKL 3B9VA 3MYJA 1LHZA 1CXIA 5TF0A 2ICEB 2AEPL 1JZ5A 5EO1B 5HYSA 1KXTB 3S36L 5ECJE 1JYNA 3BWAA 1FL6A 1FE8H 4LPTA 2GY7B 1FLRH 4PB9H 4CVZB 1K9TA 4WFHE 2EICA 4GRWE 2JB5H 4WNQA 1QYGL 2XTLA 3SGJA 1CXFA 4A6YB 3OAYH 3SDXB 1FRGH 1WTLA 4ZFOA 3KYMB 3GBLA 3HNVH 4JFEE 3KWWA 1I1RA 3Q3GA 4G9FA 3IJHA 5FYJD 5EIQA 4JFDB 4NPYA 4X6DA 1QSEE 3E8UH 4JDZB 5DUPL 3LN5B 1GAFL 1WZMA 4PP2A 2OK0H 3WDIA 4R2GC 4YHLH 5C0NC 3A67L 2D0FA 1ZV5A 4F7TB 3B3IB 2X9YA 2E8ZA 3DVIA 1C5BH 3L95B 5DD6A 4P5TA 3RTQD 3T3PE 5C0JA 1ACYH 1BECA 5I1EH 3AS1A 1MCIA 1MRCH 4OLWL 4EN3B 1PG7L 4P2QA 3D87B 2YWYA 3QH3A 1BZ9B 2EDHA 2B2XL 4MX7B 3GSRA 4DAGH 3V0AC 1EAPA 1OGAB 1NCBL 1CFNA 3PXJA 2QSTA 1A9EB 2FO1A 3OBAA 4D0CB 4H8WC 4HUKB 1FAIH 5FCSH 4KI5F 3QULA 5JA9A 3CVHH 2Z31D 2A9NL 4WO4B 1AHWC 3RVTD 4LU5H 1BGXL 1I8KB 4E5XB 4MAYA 4JY6A 3QQ4A 4K9EH 4XGZB 1JNNH 2O61A 1U8JB 3QI9C 1D5IL 1G7PB 2GTZA 1EXUB 1VPOL 5EWIL 3K0WA 1BD2D 4YK4B 2PF6A 3TVMD 1KJ2L 1SM3L 2VSCA 4MZ2A 5J11C 5IW6B 1GPOH 3L5HA 4U6YB 5ADPH 4D9RD 2LAAA 3F7VA 2UZXB 5JOEA 1U92B 3QAZC 1CS6A 2JIXA 3WN5C 4X5XA 1RULH 5EU6D 1DE4B 2ORBL 4ZUTA 2HH0H 1NFIA 2K1MA 1I8MA 5I16B 2WBJC 5ENWB 2RBLA 1T1ZA 3IAQA 3MJ6A 3O6MH 2NTSP 3VMNA 1U8HB 5H37H 1Z6JT 3BD5A 3F8UB 2QV2A 4Z18A 4JQVA 5B38A 1MQ8A 4UB0H 2XPGA 4PLOB 4GUPA 5IB4B 1CU4H 3BX7C 1P7KB 1CF8L 1AO7E 4FOMA 3KPSD 1QZ1A 4QRPD 3QDMA 5F7EL 3CDYA 4C4KT 5ITBL 3P40A 1G84A 2IAMB 3ULUD 4P5KB 4R7NA 1MIEH 3HNSL 3EZ8A 4JHWL 4WI3A 2J6EA 2K7QA 3ESUF 4NYLB 3UYOD 3PL6D 1OW0A 2P5WD 4WHDA 1WIPA 4E41D 4N0CD 1ORQA 5FF6B 4NQEE 1U3HB 2O5XH 4ETYA 3OZ9H 3RGVB 2F5AL 1T1YA 2DDQL 2JJUA 4R26H 3SGJC 4KVCL 3W0WA 4OZIA 3ARDB 2KQMA 1YPZE 5AAMA 1GGIL 1MCWM 1UWGL 3W81A 1I3GL 1C1EH 2VZ3A 2BERA 3KPPB 4LGPB 3WUZA 1PX4A 4EUPB 3T3MF 1S9XB 3DWTA 1KJMB 3MCLL 1GHFH 1RK0A 4DKAA 3Q5OA 4GBXD 2IALB 3MRPB 5DRNB 1D6EA 5CEXA 1BMGA 3A6BH 5KVGH 4Y4HA 2BCKB 4F7MA 4P5TC 4JGMA 3UBXB 4WI7A 2HT3D 3DURB 3DROA 1IBGH 5IF0B 1ZMYA 1ED3B 5IKCA 3MBEB 5SWZD 3CLEH 4YDIL 4OZ4B 1GOFA 1MCSA 3N9GH 3A6OA 1TMCA 2DQFA 1CK0H 3WLBA 1T6VN 5ALCL 2GK0B 3W11D 4PRPE 4QRTA 3QUYA 1XEDA 2Z0BA 3WIHH 4MAYC 1M7IA 4Y5YC 5B22A 2HRPL 4LSPL 4B53A 4BQBA 5IK3B 5EOQH 5IBUB 2R2HB 1NCAH 2EXWD 3HMWH 2HFEB 4KKBC 1ZLSL 5ISZB 3MRBA 4J4PA 4YAQB 2CJUL 3V6ZB 5CSBA 3FJTA 3S88L 2FX8H 3VFNA 3OWEA 2UVEA 3QXUA 1WEJH 2VLKD 1Q0XH 5E94A 3RZCB 4QTIL 5CAYB 4W4OA 1UYWH 4ZFOL 4I0PA 3X13B 2LABA 2NZIA 1JHKL 4RQQB 4HH9B 1D3CA 3JTTB 3ALWA 4KC3B 5DRWA 3FN9A 1P6AB 2XZQH 1F3JA 1FGVH 1RJLA 3ZZ1A 1NMAH 1FO0H 2J8OA 1U8JA 3X14A 4HQQH 4WWKB 2W0FB 5BO1H 1ZT7B 2YPKB 3AS2A 3AS3A 4JFFE 5IMMA 4JQVC 4RFOH 4HFWA 3T1WA 2W0LA 5EU3B 1IGCL 3O4LD 3O3BA 1BZ7B 1U92A 2FX9H 1WISA 3HUJF 4FFWD 5EZIH 3KR3L 3JVGA 1R3IL 4X9BA 5IG7A 1DE4A 1MLBB 4JRXB 1R5IA 3R0NA 4ONFH 1OW0C 3BYYA 5E7FA 5I8EB 1T0NB 2NR6D 4NCC2 4JLRA 1M05A 4Y19E 3F58H 5GGRB 5SWSD 4JJHA 1M6OB 2JKXA 2ADJA 1E4XI 3WE6A 4HIEA 5FGCB 1UCBL 2RJMA 2K3TA 5D2LE 3I3BA 5CKAA 3B83A 1VFAB 3MLRL 1C16B 3HI6L 1P4IL 5B8CB 1IGYA 1RZIB 1RUKH 4PV8A 4LMQI 2WWMD 3UTSD 4AL8H 5D72H 1I7RA 3L3DB 1A7RL 1O7SA 1UM6H 2A0LD 3GHEL 4K2UL 3MQIA 3MRJA 4XNXH 3O11B 2IBZX 4J3WA 4Y4HC 1Q9KB 1CD1A 3KLAA 3NCYP 3TLRA 4J23A 4Q97A 1B0RA 1I4FA 3L3HB 2OL3H 4UT6H 3RU8L 4CMHB 5C8JA 4LEXL 1J8HE 4XTRD 1IE5A 2EDDA 1IC4L 4DOHE 4O2FB 2VKXA 2XN9D 2VE6B 2F8OA 4PJHE 2GYSA 5DGRA 5TH2A 3E2HA 1JGVH 5ESVA 3QUYC 5IHZA 3T1FB 1YY9D 5F6HJ 5IW1B 2BCKA 2GJ6B 2RIKA 1FNSH 4JY5H 5H8DA 4MS8A 3L6FA 4FZ8H 4QOKA 3BQUD 5CINH 1KIPA 1BX2B 1T03L 2F53B 4XC3L 3OXSB 4BUGA 1XR8A 5CHNA 3TYFB 5FO9B 4ZUVB 4MLIA 2DWEA 4K71B 3IFOA 3RWDB 3IDGA 5EOTA 3LZFL 3K8LA 2ZJSL 4HAGA 4W4OC 2XZCH 5IROA 2ZSWA 1T4KB 1PZUB 4I0PC 3MFGB 4HUNB 4OCYH 5FGRA 4OZFH 4GW4A 2GK0A 3MOAL 1MREL 5IVXE 3QYCA 2BNRB 1FN4A 3EYSH 1A4KA 4K7PY 3TC9A 4LCWD 3T09A 3QUXB 2R2HA 4ZAKB 1XGYH 4YDLB 1YYLH 5ILTL 3QEHA 3MROA 2M8XA 3MNZB 4NRYA 4QYOB 1XF5A 1P4BL 4KMLB 1Q9WA 5C71A 5B4MC 4Q6IA 1JGDA 1RUML 4HKBA 4LCUA 1QFUL 4XX1G 1R6VA 4YBQC 3JVGC 1T22A 4RQQA 4YHKH 4UT7L 4Q0XH 1KNOB 2FGWL 2VDPL 5JOFA 2F58L 5JQHC 3SE8L 2BRRH 1NC2D 4M62L 5CEZE 1YY8B 3DECA 1UB6B 5HVHC 4U0RB 2DQCL 1XFPA 3KHOA 2OJZH 4U1MB 3GSWB 1JFQH 4XBGA 3GMLA 1OTTC 1S8DB 5I8CA 2JELL 1CTNA 4P23B 3V5HA 4JDVA 5IVOA 5TE7H 3PE9A 3QIWA 3BEVB 1NGZA 3P0GB 3QXTA 5IESL 1BZQK 5K9JH 1CFTA 3U1SL 1D5ZB 2GTWB 1KB5A 3RBGA 2DLGA 1NGYA 2X4OA 1PKQA 1CBVH 5BRZA 3KAAA 3VXSE 4HD9A 4LPVA 3ZKMC 5C0AB 1U93B 3U82B 1E4XL 1ORSB 3P9WB 4FG6D 1A2YB 3MV7B 4A6YH 1FDLL 3VWJB 4H0HB 4G8FA 4HEPG 5BQ7A 1FFQA 1WQVT 4CNIB 3M17B 2MFNA 2ERJB 4YH6A 5DJAB 3ZMRA 4M02A 3GMNA 2V9RA 3Q1SH 2VLRD 3C6LB 3H7BB 3BIAX 3TWCH 4JPKL 5IB1B 2IANE 1JNLH 2AVGA 4J6RL 4JQXA 2O26U 1W0VB 3MZTA 2H45A 4LKXA 4XNYL 5IB3B 3PHQA 3E2HC 4LLUB 3PWLB 5EO9B 4JRYB 3UTTA 4MS8C 3T2PA 3FQWA 4U1LB 3RL1A 3CZJA 4TNVF 1MEXH 1BQLL 2Z93B 3T0EE 4M6NL 4H88H 1TJIL 2H26A 2Q86B 1JHTA 3CAFA 2VWEE 3MRKA 2Z35A 3MRIA 2Y06H 5BCAA 2RCSH 4JRWA 43CAB 5KS9B 3H9SD 5IROC 1KPUA 1CVRA 1MF2L 3SGDI 2LTQC 3ZDZF 4BH7A 1Q1JL 3O2WL 4AG4H 4JFQA 3VCLA 4YHZL 1FPTL 1U2CA 2RAMA 5HY9B 1BFOB 4NWUL 4PJXF 4XCFH 5EU5A 4BQ6A 2V5RA 4HJGB 3UAJD 4ELKA 5E5UB 5CMAB 2C1OB 3BP6A 3VFGH 4FFVD 5T33H 4M4PA 3OXSA 3FHAA 4OFKA 4HV8B 1NMCC 1I8IA 1TZGH 4ZUVA 1MJ7H 3LKNB 1ZANL 4P0DA 4BFIB 4PJEE 3RWDA 1DQQA 1HWGB 3LEXA 4Q6IC 2XWJB 1YMME 4QF1A 3BE1L 1T4KA 1JN6A 4Y2DA 4K23L 4BZ2L 5KBNC 4Z78A 1DFBL 3MLUL 5D7LA 5HI3D 4J3SA 3SDDA 1KEML 3ARBD 4IRJA 3MC0A 2A6JB 3IFPA 4OB5H 2GQHA 4ELMA 1MH5A 2BOCB 4LASL 3DIFA 3UEZA 4YO0B 4X9IA 2YRLA 3VRIA 3OHXB 3O6KL 1NCCL 1T80A 2NY4D 1RZFH 2EDJA 4UTBH 3WS3B 2H1PH 1MHPH 3SKOB 3T0WA 4B7LA 4K7PL 2Z9TA 4XCCH 3WBDA 1K4DB 1IARB 3QIWC 1J10A 5K9KB 2IPTH 3P30L 1LE5A 3HZKB 4NP4L 4LLDB 1S7QA 1IC5L 2G9HA 4RBPH 1A6VH 4PUBH 1LEGA 2B4CC 4YR6A 2AJVH 4NSKB 4H26A 3BGFB 4DQOL 3C5ZD 2QLVB 5D1XB 1DQDL 1XH3B 5C07B 4PGCB 5MERB 1HYSD 3GMOB 2X4NB 3QIBB 3QIUD 4JN1L 3U0TB 3D2UA 1NAKH 2P45B 1OAKH 5EUOF 5FM5O 4APQB 2APTA 1G7IB 3TH3T 1RZGA 4M7KL 5BXFB 2H8PB 2YMXH 4HIHB 5F9WB 3INUH 4PJ5A 4WI6A 2G2RA 4GG6B 3BZFB 1AD0A 3S37X 4ZYKA 2X1QA 4EUPH 2XZAL 5TDOA 5KVDH 2CDGA 5HHME 3S97C 2CO6B 2K7PA 2EYSB 2ZG3A 4PY8J 3OG6B 1DUYB 1NL0H 1K5NB 1KLUA 4JQXC 3SE9H 3V6OE 3T65A 1BAFH 1OTUD 1H3GA 3OXRA 3DX6B 4MXVF 2VDKH 5L2KA 4GLRI 2H9GB 3DUSB 1LK2B 3TA3B 5L9DL 3N85L 5F7MC 4DW2L 4TULH 1Q9OB 3RA7L 3QB7C 3NH7H 1V7ML 3P4MA 4XNUL 3CFKB 1JGUH 5EU4B 2XV6B 3MRCB 3C6LA 3WO4C 2P24A 5JR1H 3MLWL 2AQ1A 4FNLH 2ID5A 4M93B 3VXRE 1WWAX 1IGMH 4OZGA 2BNQA 2FWOA 4HBCL 3V4VH 3LRGA 5FA3A 2Y6SD 4RX4A 1EVTC 2AI0H 4V1DE 1CN4A 3GB7B 2XA8H 4CMMB 4QCIB 2A6IB 1YNTB 3EOBB 3EOYG 1YEEH 1N59B 3RVVD 4K94C 5IEKB 4JPWL 3VG9B 4JPVH 3TZVB 3GM8A 1CR9L 2ITDB 5ANMA 1A0QL 1NMBH 4LCCA 4LSSH 4D3CL 4OCMC 1SQ2N 4Y2DC 3BRFA 3EUUA 3FFCA 1S7WB 2RFXA 5D70L 2UZIL 5EU7C 4IHOA 3QDGE 3OR7B 3QFJB 3D39D 4HFUL 3DVGB 4NRXA 5BOZG 4KZDL 3SDDC 4HUVB 4IRJC 3OKKB 4PJCB 2AK4B 4PGEA 1BBJB 1QSVA 5F7DA 4L4VB 2CMRH 3G9AB 3QO1A 4ZFZB 4U1KA 3ZYIA 2XFXA 4KK8C 4PJDB 5HPMB 1J8KA 3OJMB 4NQVA 3MA9L 4OAWB 3NABH 3ZKXB 4ZNEE 1KB5H 1YQVH 3C60A 5CGYD 1MCWW 2PXYB 1KYOJ 4ZPVA 2B4CH 3WFEL 1FAKT 2BOBB 1KCVL 3S5LG 4DUWA 4P2OD 3BKJH 3UTQB 2CGRL 5F96L 3ARQA 3GEWB 4RWYH 1ZSDB 4KU1A 2FJGA 4XPHL 5LGHL 3MRNA 2C7UB 2CLRB 5HI4C 4F7EA 4LLYB 4RMQA 1MFBL 3VI4F 4L3EA 4P2RB 4ZPTB 4LFHD 2XKNB 4N0UA 4MD0A 5BVJA 1U95A 1IGTA 1D5MA 1GGBH 4M48L 5D93C 3NFSL 5I30L 2R4RH 2YC1B 5L8JB 4PJFE 3E0GA 4HUWA 5FYKL 3RL2A 4KTEL 3MJGX 1FV1B 4OD1L 2QADB 3MV8E 4XMLL 3VFRB 2AV7A 4MNQA 5D6CA 3DXAD 5GS1B 4D9QD 4HAFA 3BVNB 5HHQA 5H35B 4PRDB 1KJ3L 3PQYB 5T5FL 1NUDA 1GL4B 1J1XH 5HDBF 3PP4L 4NDMB 2KL6A 5D96C 3D3VE 3RVUD 3RVXD 1HI6A 4JFOB 4P4KB 1GCFA 3DMMD 1F11A 3VWJC 3TO2B 4KZEL 4PJ9A 1CT8A 1R3HB 1SVZA 3PP3H 3U0TA 3IFLH 1KYOK 1XZ0B 2VDLL 3L9RB 3QCVH 4NCC1 5B39B 4APQA 3EYQD 5HHPB 4P2YA 4NT6B 3LKRB 5C08B 4QNPF 5E8OB 3L3OA 5KN5B 4L4TA 3O4OC 2X42A 4OBRA 3S34L 3NCJL 4MQTB 3QNZB 1K6QL 4TSBL 3C6LC 5CUSH 4IIQB 5JPNA 1S7RB 4NNPH 2QHRH 4MNGB 4O9HL 5TQ2H 3C2SA 3TBYB 4NQDB 1A6AB 5DC9B 4M43H 2ESVE 1I3RA 5H94B 3P0YH 2VMFA 1L0XA 1SYSA 3NCMA 3VDAA 2H9GA 3DUSA 1KTLB 3CFEA 2WP3O 3TA3A 5IJVA 2C3HA 1YDPA 3QEUB 4OTXH 3BXNB 1MLCB 3BEWB 1E28B 1WVZA 2DL9A 1TPXB 1LNUB 2YD4A 3V6FA 1UGNA 2VLME 1I9JH 4XPFH 1QD0A 3JXAA 2DN7A 2VAAB 1DQLL 4LCCC 1JZ3A 3ILQD 5I17B 1T1XA 2AXGB 3DLQR 3MRQB 5E2JA 5A3IC 5E5MB 1EV2E 3GSUA 4P9HL 3QUKA 1N64H 4QHKJ 3RPIA 4WTZA 2CK2A 4M7LL 4XH2A 3RWFB 1DBMH 2VABB 2R1YA 5DEFA 4HSQA 3MNWB 4OM1H 3FQRB 3UJTH 1QG3A 4YFDB 4Y4KB 3O6LH 4MB5A 4WTXA 5FYLD 5A43C 5ACMA 4RAUB 3M8OH 3C60C 1OLLA 1RPQA 3C5JB 4HWEH 3BW9A 4GXUN 1AGFA 4OD2B 4JANA 4B5EA 3AU1B 3DUUA 5F9DC 4JQIH 1EAJA 3FT3A 2O5ZH 1S5IH 1P1ZB 2VITA 3VD4A 2IG2H 5E8EA 1N4XH 2LU7A 4LEOA 4U31A 4N8PA 3AREA 2BVQA 1QBMH 3VMOA 1RZJL 3EDDA 1URLA 3S36X 4XZUA 3NCFB 5EC1A 4Z76A 1B0GB 1RZKH 2NPLX 5JIPA 3DVNB 1ZLUH 1WC7B 1OY3B 4MJIA 2HTKC 3QDME 1BFTA 1VFMA 5CEYA 5DFWH 4YXLL 2DLIA 5KTEH 1W0WA 4N0YL 3VGEA 4UNVA 5JW5A 2IADA 3CDGB 4Y1AE 2R69L 3HAEG 3O0RL 1BPVA 1L0YA 1G6RB 5JMRA 3BZ4A 3QEQB 5MEQA 3BGFC 3AY4A 3QG6A 5HGGS 4JKMA 2XG5A 1JPST 2Y9RT 1I7TB 1MCQA 4PRHD 1HHIA 4U1HA 4Z7OE 4YQXH 2XIDA 3GHBL 3QIBC 4CU8A 5I1IL 4OZIE 1JI2A 1KV3A 4APQC 3RWHB 1HNFA 3MRFA 2MQCA 3ULUL 3SPVA 2GFBB 4HMCA 3MCKA 3E6FB 4OFYD 2NY5L 5D5MB 4PRBA 3KPQA 1NFKA 2F19H 4OI9A 2AP2A 1LO5B 1LE9A 4HUMB 5CLTA 3BPNC 3VXTB 4XAWL 1OAQL 4EDWH 5JA8B 2M2DA 4R4ND 4RNRA 3OGOE 1PG7X 1DLHA 3CUPB 1J88A 4OZHF 4NZRH 1I9EA 1RMFL 2B0SL 3OAZH 4X6CB 5D7SL 5B3JE 2NXYC 3SDXE 2R1XB 4I13B 4YBLC 1HZHH 2AABH 3TA3C 2ZCKL 4JFHD 4UQ3A 3T77B 9CGTA 1OTSC 4GQ9L 1IEBB 1UWEH 2DQHL 4JFDE 5B39A 4OQTL 5HHPA 1FVEB 5D71H 1AQDA 2OZ4H 2YHGA 5HDQL 3MREB 3K46A 5DTFB 5E1AB 3VH8B 4FQJH 4MD5A 1FZJB 2JJTC 5J13C 4HIXL 5EOCH 3SN6N 4IOFD 3LH2L 3LB6C 5FB8B 4NJAL 2ZUYA 5C0CB 4UV4H 1NSNL 1SJEA 5DJ2B 1NCNA 1KLFA 3HR5B 1N2RA 4XVTH 1PQZA 2FATH 4YHML 3NPSB 5AG8A 5EZLB 5ERWA 3MJ8A 5BS0B 4YXKH 5C0IA 1KACB 1IZJA 3QEUA 1ZT1A 2HFFB 3KXFA 3WUWG 4RBPK 4Y16A 4M8VA 4J2XA 1A47A 4YDJA 2VZVA 1XGPB 2NY1B 4JN2B 1LEKA 3VD5A 3GMQB 3LEYL 3VG9C 1T1WB 4JPIB 1UZ8A 1OGAE 4Y5VB 4XP5H 3QXVA 5LBSL 1EMTL 2BDNH 3U46A 4LQFH 1I85A 1NKRA 2X44D 4WUUB 3KPNA 5BJTB 3IAGC 3ULVF 2DBLH 3V0VA 2NY0D 4FQCL 4G6AC 3B9KB 5J1SC 3VWKA 2IGFH 3O45A 3V5DA 3TIDB 2YSSA 1I1FB 3FZUD 2DI8A 3BIKA 4U1JB 3X11A 5JHLH 1MNUL 2ZPKL 3MNVB 4GT7A 1NFDA 4MLSA 1CD8A 1RU9H 4I18B 4YHIA 4NQCA 3VFOA 1B6DA 2E9WA 3AREC 5MI0C 5FUZL 5DEGB 5H2BB 5J12B 3MXVL 2VABA 3U0WH 3HA0A 2W60A 4U7KA 2R4SH 4ZFFB 4Y4KA 4H20H 1UJ3B 3O2DL 2J4WL 3U4BH 2OTWA 5BV7C 2LFGA 5TF1L 3QJHA 1U8OA 4XCNA 4FXKA 1ETZB 1QEWA 3HMXL 1IAKA 1JRHL 1TVBA 4NKDA 4NM4L 3BDYH 2EH8L 4Z77A 4TN9A 4EOWH 2GJJA 1CFQA 3AY4C 1LO4L 4WU7B 5TE4H 1AGCA 3QFDB 1E4JA 3ZE0E 5DJ0A 2XQYK 4LOUC 4XVJL 4WWID 2QQLL 2ZCLL 3MR9A 4G8GB 4OD3L 3GNML 1WC7A 3RWEA 4RCAA 5BZDA 5KSAA 2J8UB 2DMKA 4JG1L 1JUFA 1CTOA 2QADC 1UB5B 3IU4H 3LOWA 4F7CA 1G6RA 3C8KA 2FEEI 2XNAA 1FYHB 1MAJA 3VXMD 1FIGL 1IEHA 1KJVB 5INCA 5TGBA 1XCQB 4ZO8A 3MYZA 5FECA 4F37K 4Z7QF 5DC0A 2DJ4A 3VXOB 4N5ED 1J1OH 2X09A 4P2CG 5DUPH 5I1JH 5GSVB 4PRNA 4UV7L 1GAFH 2AEIT 1MFCL 2D3VA 2G5RA 2J88L 4G8IA 5ACZB 3KYKL 3A67H 1ZS8B 1K3ZA 1FG9C 1RI8A 4JFXB 4PREA 5EFIB 3FB5B 4HIJB 1IAII 2X5PA 4XT1C 3RZWA 1M1SA 5F3HB 1PZ5B 1VCAA 3CNKA 1TLKA 3CUPA 2DQDL 3TYGL 2W59A 4ZODA 5DC4B 5I1HL 4I2XA 1UADC 2FJHB 2Q20A 3GO1H 1K85A 1NC4A 4Y16C 4X83A 1FL5A 4YHPA 4OLZL 4P46B 1F8TH 3ILPA 3QCTL 1ZHNA 4UILH 5DRXB 1JPGB 3QPQC 2GJZA 1S7VB 3VI3F 3FO2B 4P48A 5CSZB 2F54B 4FZEL 1F4YL 1KENH 1ADQL 5HHXH 1I85C 1QR1B 1U8MB 2UY7A 5C0CA 2P4AB 3FO1A 2OJEB 3BUYB 2J1KA 5HHOD 5C0BB 2VXSL 3H3BC 2VXQL 3IFNL 3TBSB 3VWKC 1XIWA 4JEGB 1U8NA 4X7CC 2PTTA 4MVBC 5TE6H 5EWIH 2SEBB 5DHXB 1SM3H 4KKCD 1S7TA 4KY1L 4RA0C 2BY3A 4DEPC 5T1MB 5C86A 1KIQA 5ISZE 3H9HB 1CI5A 4RISH 3Q6FB 1ND0B 2MPAL 4HZLA 1CGSH 4XNQB 3GMMB 4RGNC 4N5UA 1BQHB 5D7JB 2ZUTA 1NAML 4X0KB 1N6VA 1KTDA 1QP1A 1IILE 5T1KB 4MA3B 4Y4KC 5GGTL 4HKZA 5GGUB 3KNBA 2ORBH 1T0MB 1ZA3B 5HYJA 3PP3K 3HG1B 3IF1A 2GIYA 4NUJA 1N5AA 4EJ1C 2IH1A 3VRLF 1NCDL 1J05A 2NW3A 1LO3H 3RGHA 4I4WA 2BXYA 1HXYB 4KRPB 1DBAH 4HPYL 4EI5B 2FYYA 3WSQH 4Z0XB 1U8LB 2BJML 2E9JA 4JDTL 1JGEB 3B8YA 5DEGA 5IMKB 5DDHA 1AIFB 5C09D 4N8VG 2YUWA 3RUGF 1CF8H 5F88B 2PYED 3QPXL 2CO7B 5F7EH 1R3JB 4LLQA 1OAZH 1ZA6A 3MGTA 3HNSH 4JHWH 5KSAC 4N90D 2A83A 3KDMA 1H15B 4JAMB 4RGMC 3ZO0A 2YPVL 1FQ9C 1TQCC 3DRTA 4GFTB 4JRXE 2E7BA 3V7AE 5FXCH 1A7OL 4POUB 3HE7B 2AJUL 3PHSA 1TTUA 2H6PB 4WU7A 3F7RA 3SGEI 2LAGB 4QHLB 3VG0L 1JK8B 1K8IB 3O8XA 4MQ7B 1IAIM 4NNXA 1OGAD 1GGIH 4NRZB 3VXPA 3S6CA 1I3GH 3FB7B 2FEEL 5FGCE 2MCPL 3MRHB 4XI5D 4R96A 1KEGL 4OF8A 3TN0A 5IB2A 2D31B 4GKNA 4G9DB 4HWBL 3TCXA 4PRID 4PJ8D 1BEYH 3RPKA 2A6DA 1KB9K 3MRMA 1ES0B 4KRMB 5MEND 3V2AR 4BFEA 3CXDL 4JM2D 2BXZA 4U6TA 5DQ9A 4WTWA 3UTTE 1WBYA 2DIAA 4FXGB 4KFZC 4Z7WB 5HHNA 1BM3H 1VENA 3FCTA 4RZCA 5D1ZA 2MHAA 3FOMB 32C2A 2EC8A 3K8MA 4KJQD 1IM9D 3QWOB 4KGLA 4CN6A 5IVZA 2EXYD 2HKHL 3RDTB 3OAUL 5ESQB 3CFJA 5J1AB 1AXSA 1HWHB 2C3VB 2R56H 5FDYA 3FB5A 5J8OA 5EA0L 5F3HA 4NJ9L 3LS5H 3S35H 1P84K 4U1NB 5DJXB 4GS7B 2PYFB 4JFYA 2VLJB 2GJ6E 1XIWC 2ENYA 4RRPG 4ODWB 1ZLSH 2D9CA 4OUUB 1U58A 2CJUH 2A6KA 4XCEA 4RSVA 2F53E 4QTIH 3HC0B 4GAGL 3RKDC 4QRRB 1NLDL 1S7VA 3L5XL 4GXUM 3QQ9D 3S4SG 5EOCJ 2VDNL 2J12B 1ZEAH 1JHKH 3JV4A 2W65A 3WNKA 3FQTA 5J9PA 2R0KH 4P3DA 1U8MA 2MJWA 3SDAD 1DEEB 3L3JB 4Z7VF 5D9SB 5EU7E 1Z3GL 1WICA 5JIIA 5H37G 2BNRE 4LRIC 2Q7YA 1S5HB 2FECI 3I2CL 3NIDE 5HYQA 4YWGL 1Q94A 1R5VA 4XXDA 3IVKB 5MEOA 2V5TA 3O41A 1UVQA 1S9VA 3MUJA 2X40A 4I18C 4K8RD 2ADGA 1CDIA 2YKLL 1MVFA 3Q6FA 1HILB 5JXED 5B21A 1KN2L 2X4UA 4LIQL 3VFUB 1R3IH 5GSRB 3OAZK 3SQOH 4OCWL 4X4XA 3LDBB 4FFZL 1JWMB 2P49B 1IT9L 1J12A 1G6RH 4G6KL 3ULSB 5KW9L 4G7VH 4YZFE 4X7DC 3H2WA 2X70B 1KCLA 2ZCHL 3FQXA 5C9KA 2OI9A 2HJFB 3NCCB 1DBBH 4Y8AA 3ARGA 5GHWH 2R9HD 2YA0A 3CFCH 1YYMH 5HGDB 2UWEA 1JTPA 3G6JF 1RUQL 3IKCB 3S3JA 2MNUA 2OR8A 3MSPA 1UCBH 3O8XC 4I3RH 1T5XB 1WFUA 5I66B 3QRGH 5JZ7C 1CL7I 4ZFGH 4FQIL 3HI6H 1P4IH 3OKLB 3TN0C 5EIIB 4MJ4A 3CX5J 4LVOC 5C0AE 1A7RH 3C5SA 4OUOA 2P7TB 4LVNB 3EIFA 3JTSA 3GHEH 1IM3B 4HXBL 1KXVC 3PDOB 4K2UH 4L3AA 4R0LA 4ZUSB 3I75B 3SQBA 5KSBF 3ZE2F 3MV7E 3G9VA 2YR3A 5DO2C 2FEDC 3FT4B 4KK9D 4DGYL 4PJGA 1RJZB 3CIQA 1A21A 4G6ML 3GRWL 4ZDHA 2EO9A 5D1ZC 4NZJA 1U6AL 1MCKA 3T4AB 3JWOL 3EYUH 4NFDA 3ETBF 2XWBB 4NO2B 3MRRA 5IMLA 1R5WB 4FABH 4LHUD 1SY6L 2XA3A 5JPMB 2A73A 2C5DC 4WWKD 4G3YH 1RAMA 5T3XL 3RIAF 1DSFL 2J8HA 4FQXA 3QA3A 2KDGA 1EFQA 1UFUA 1CE6B 2P1YA 4GRWF 2FB4H 2ZOKA 3L5JA 4HXAH 2Z4QB 4JM2F 4JRYE 2BY1A 3LD8B 1SEQL 2CRMA 4XC3H 2I5YL 1XGUB 3T0DA 4EZMA 2CUHA 5I76B 3MLXL 4XPBH 1F3DH 3WIIH 4M1GL 3HE6A 3LZFH 4Z7UA 1GXEA 1NH6A 1A9BA 1FZMB 3G5ZB 3CFDB 5ESQA 4KVNL 2E6JA 4MCZA 4M1DL 3GSVA 3LKPB 4F33A 5ICYA 4XHQA 3FFCE 3GKZA 3PGDB 2OS7A 3RTQB 1ZAGA 3CFBA 4H25B 2FJFB 2V2TA 4LLMA 2IFGA 3WFHA 5L6YH 4K7PX 5ILTH 4OUUA 3NFPB 3MTRA 2Y07H 4J1UB 3QZWG 4FHBD 3T3PF 1P4BH 2R0WL 1T5WA 2BVOB 4O5LH 5E2VL 1JWSB 2CK0H 2VNCA 5D2NA 3L3KA 3JWDC 4LLWB 1RUMH 2QSQA 2V5YA 1NDGB 2X1PA 3SKNA 3BZDA 4K3DL 5C0EA 2Z31B 3GJEA 2IPKA 4FQLH 2XTJD 4ZD3L 2FBJH 1H3WM 3ZTNH 2HKFH 4M62H 5A2IH 2DQCH 1MVUB 5E9DB 2OI9C 4F7PA 3T2NL 4G42A 4IEFB 3ARGC 3ORJA 2NX5A 5IV2B 1BD2B 4K3JL 3DSFL 4KRPC 4HC1A 3U36B 5D1QA 5GGSA 2C3XA 3BGMA 3KPMA 4N0UE 1JZ8A 3T2OA 3HUJB 1I1AA 5L88L 5IR1B 3UJIL 4WCYL 4F58L 5IESH 1RK1B 4LLVB 5JXAL 4KDTA 1L8JA 1CIDA 3U1SH 5EBLB 5EU6B 1YEIH 1IGIL 4PB0H 2DKUA 7FABL 2DJUA 5TPWL 3IAPA 3MGAA 4I1NB 3G5XA 1E4XH 1MCHA 4CKVX 4UAOB 5IBTL 3PIQA 1DN0B 4U6VH 4UDTB 1WSST 5C07E 2AJXH 2IC2A 1HH6A 1QRND 3UCRA 4LPYA 3IKCA 4CDHA 1W72A 5AG9A 3GSXA 4X5LA 4O58L 3N1MC 4QRPB 2VSDA 3MUGA 1MCEA 3RWJA 2VDOL 2DTML 3EGSB 2APXA 2YPLA 3ZHKA 1OGTA 1G9MC 4GG6E 1HSAA 3PL6B 3QJFB 4J6RH 2P8MB 2P5WB 5E70A 4E41B 4P59L 4GKOA 4XP4L 4DN4H 2VZUA 1TETL 2P7TA 4XNYH 3IXTB 1AE6L 2VB5A 4GQPH 4TOYH 3WKMH 4BSJA 4YHNA 4FQXC 3GK8H 3PXHA 3MODL 1J86A 1R3KB 4TNVK 3WFDL 3ARRA 3NACH 1TJIH 4XBPA 2GEEA 5JHDA 1YPZF 4OZFG 5D8JH 3F62A 3HE6C 1TITA 4ODTH 1N0LA 3EHBD 1QNZL 3RUGA 3HB3C 4GBXB 5ELIA 4F57L 3LRSA 4MXQD 4OFDA 1JYVA 4GAYA 3TM6A 4XMKL 3LQAL 2V7HA 4F15B 3GJFA 3QUZD 3D18B 1FYTA 1J0JA 4AMKH 3QCUL 1XCTB 3HRZB 2ADIA 3O3AB 1ZGLA 5SWZB 3JWDH 5I76A 1LDPL 1FSKB 3BYTA 3HZVA 4PLJD 2ICCA 3QUMB 5D2NC 4MA1C 4FQ1L 4LBEA 3G6AB 2RB8A 3SJVA 3ULVL 4ZO7A 1X3DA 5C0AD 1M7XA 5IQ7H 2NY6C 1T21A 5GS2D 3ISWA 4PGDA 5CJQL 1Y18A 4CU7A 4IOIB 2LU4A 3MLPA 3KYOA 3PGDA 2C1PB 3VFWB 5C0FA 1MI5D 4QXGL 2DIJA 2UUDH 2G60L 4NQSB 4LASH 1D5XB 3CD4A 3OKYA 4KJPC 1F4WL 1YMHA 1EHLL 2AXFA 3SY0A 1NQBA 1P7QA 2AK4E 2IJ0C 1NCCH 4WW2A 3RX8A 2ATPA 1AC6A 1UENA 3EFFB 2YD6A 2VLKB 1JBJA 1RIHH 5D1QC 1NUNB 1R3LA 1T7XA 1C12B 1MFNA 1I1AC 3QEGH 4PJDE 3PGFL 5FYLL 4Z5RB 3P30H 4WW1B 4KDTC 3KLHD 1UXWA 2VH5L 4EIZC 2WP3T 1LP9B 4OGYL 5DWUL 3MV9A 4JZJA 1KELL 2H2PC 1K8DB 5CBAB 1HEZA 3U4EB 1DQDH 1EFXD 2VQ1A 2FD6L 4ENED 3GBNH 3TBVB 3TVMA 3SKUD 2A74A 2ZG1A 1G7QA 4C59B 1GIGH 2VXUL 2Y36H 2GCYB 4P2RE 4EXPX 2HN7A 3O4LB 5C0GA 4KUZL 4ODSL 4MB4A 1S9KC 1TFHA 2F9BT 3O9WA 4R6UA 1HQRB 1EEZA 5K9OA 4NOFA 2NZ9D 2JCCA 1FBIL 3VJ6A 5DVMA 1HSBA 4UDUA 3VMPA 4D0BB 1KN4L 5DT1H 4MA7H 5I73B 3PDDA 4MYWB 3EDEA 3PQYE 3CXHJ 4F3FA 1I3VA 5IFAL 2G5BB 2OXHA 5SWSB 4M6OH 1NGQL 5L9DH 2NY2D 5ICXA 4DW2H 1PJ9A 4Y4FA 4O02L 4M1CC 3KJ4B 3KPSA 4BSWB 5INDA 3DV4B 1VGEL 2AGJL 1RHHB 3IU3A 3TT1L 3IETA 3UTSB 1JPTL 4M61A 3LN4B 4OI7A 4ZOEA 1J11A 2BRQA 3PL6A 5C7XL 2P5WA 5J6HA 4M9PA 4KROC 5DMKB 3B6SA 2PCPA 1EJOL 4HBCH 3H8NA 1AXTL 1VFBA 3HPLB 3E6HA 4LCYB 1LMKA 1MELA 3TCLA 3X3FL 1KCRL 1MUJB 4GRLA 1DUZA 2PR4L 5ALBL 4GG8A 4U6HA 3SGDH 3T0AA 3BH8A 2BC4B 1JNJA 2NNAA 1IKNA 5E00A 1HOCB 1SBSH 5C0DB 3TPUA 3VXNA 3C09C 3DTXB 5I0ZA 2XN9B 4NFBA 4D3CH 3CXHK 3G6JA 1OLZA 1CLYL 3QDJD 8FABB 5DJCA 5D70H 2OYPA 1FGNL 2HJKB 2B5IB 4KZDH 3BPCA 1IAOA 1G7HA 4PJXB 3RNKA 4U6XA 2Q87A 5IQ9A 3WXWL 4WY7L 3BQUB 5HGAA 4X8JB 5GRUH 2CIKB 5FUCE 5M95B 5IOPB 1CICD 1NFDE 4WW2C 4ZUUA 4YJZL 4ALAL 1A1OA 4M5ZL 1F3DJ 4N8CH 1CXLA 1FL3B 3OPZL 2P8PB 3S9DB 3QXDA 1YJDL 5KSBA 1NAMB 1S78D 2WIIA 5F1NA 5ID1B 4V3EB 3I02A 3SDCD 4QT5B 1II4E 3KPLA 3RHWK 4X9GA 3WFEH 1KCVH 3RVTC 1N8ZB 2CGRH 4WI5A 5F96H 3DYOA 4IOIA 1OAXL 1K2DA 4LQ1A 1MCJA 4LCWB 5LGHH 4JZJC 3U9PL 4HS8L 1QACA 1QSFD 3QDAA 1RZ8A 4O00A 1R24A 5IVXF 1MJUL 4UZGA 2CLZB 4K3GA 5GRJL 3TVMC 1AI1H 1EEYB 5TDNA 3EFFA 5KANG 3NTCL 1INDL 1C5DA 3WKNA 1U8PA 4RAVB 4S1DD 4UQ2B 4EUPG 4LAQH 1P2CA 3RP1A 4Z5RA 3N1FC 3O9WC 4LSVH 4XWGL 1QA9B 1I7UA 3PWPD 1RSFA 4I48A 4WGVB 3S5LA 4PY7B 3IDYB 3P4OB 4NBXB 1LP9A 3EO1B 5GS0C 3W39B 4PG9B 4IRSA 1TCRA 3MGOB 1QSEA 4HWNA 1U8IA 3RAJL 3PP4H 3NBNA 3UBXG 1ZLWH 3QEQE 43C9A 4EBQH 4FQQA 2W1NA 2D7MA 5F7UA 2DIBA 4KZEH 5KJRH 3QXWA 5EUOB 4ZXBD 3ROLB 4F80A 5CJBA 5F6IC 5FM5M 1G9EA 1RD6A 3S3SA 1R0AL 1HQRA 3U6RB 3V5KB 4U3HA 2QHLA 2XICA 3S34H 1A5FL 4OLUL 3VE0B 3HC3L 4GLRH 3GSOB 4DN3H 4O9HH 3QXAA 5D5ME 3QFJD 3PL6C 3K2UL 1MFAL 4KV5F 3GBML 4GW1A 5IBUG 4N0CC 5C70A 3T4YB 2B20A 1NLBL 3H3KA 4L4VD 4YPGB 5FYJH 3GJFH 5C9JB 1OP5H 3T2QA 3LPWA 4JGUA 5IGXH 2RR3A 3BP4A 4I5BA 1MFEH 4HJJL 4I2XE 4GRLC 3B9AA 5TFSH 4NHUB 4PTTB 1GGCL 2VC2L 1RQ5A 1IKNC 2PXYD 3DGCR 1QPPA 1DQLH 3LRHA 4XPTL 5DJYB 1RUAH 4R2GD 5SX4H 5F7WC 5DMKA 4JO4L 3P4NB 5C0ND 4TSAL 1GVIA 3HFMH 4ZSOB 1MHEB 1I9RH 4GBXC 3K4DA 5C0CE 4EDXB 4I77L 4P9HH 3FTGA 2X89D 4QLRA 3SDYH 2W9EL 1ITCA 1UA6L 2JJSA 3MOBH 5MHSD 4IMLA 3E3QE 5HYFA 5BS0E 3IRZA 5HYIA 3X12B 2Q76A 3MLVL 5LQBH 3U7YL 3MMEA 2EZ0C 4MDIA 2GW5A 1XGTB 1FVCA 4NQXA 1FSKC 4RDQF 3H9SB 4OSUL 2HJLB 1OF2B 2FHFA 1RFDH 1UACL 4K7FA 1JNHA 5FUOL 1AY1H 3FQNB 3EAKA 5ITFA 4XMPL 3NCBB 1JYWA 1DDHB 3OB0H 3W11C 4XVUD 4FQ2L 2XXCB 4K3EL 4WUUE 5ID0B 4FFYH 3C2AL 5I2IB 5DD1L 2H3NB 1U2HA 1GOHA 5HJ3B 4P4KD 1KF9B 2W92A 1NBYB 2AJZB 1AO7A 2X4SB 4TRPL 1GYAA 3CC5B 1I1YA 1OARL 4FTVD 3MUY1 3WNPA 1S3KL 1GC1L 4YNYB 5E99H 3PV6B 5C08D 4LHJB 4FA8A 1JJUA 4X6EB 1A6ZB 1L9NA 4OFPA 3WO3B 2QQKH 4MB3A 3T0BA 3HZMA 5IHBA 4RIRB 4O51A 1ZHBA 4NQEA 1F5WA 1Y0LB 2F5BH 2P46B 4NQDD 1A6UL 4BJLA 5IT2H 3BP5B 4MJ6B 4N0YH 2YXMA 4C56D 1MHHA 3ARBB 2R69H 2VZSA 1KUMA 5E8NA 3MO1A 4IRSC 4YFEA 5ICZB 1YPZA 1UKQA 4RFEA 5CIPB 2EDOA 4KAQH 2NY4B 1OM3L 4WHYG 2BVPA 3RNQB 4DCQB 3LIZL 4PJ7F 4I8DA 1MCOL 3GIVA 1OSPL 4RAVA 2EIBA 1E0OB 2XY2A 3ULUH 3ZL4L 5E8PB 5A40E 3BO8B 1JZ2A 3HHRB 4G8GE 5ESAA 3BKCH 5DXWA 3EYFA 2J8UE 1ZVSB 4POZC 4Y7MA 5I1LB 4BK5A 1NC2A 4XAWH 5GISH 3HAEA 3C5ZB 5CBEA 3Q6GL 2J5LC 2ZUQB 1SJHA 2NR6C 2HLAA 1SJVA 4IMKA 1A6TA 1JTTA 3N1PC 1CDUA 4O4YH 1EH9A 1U8QB 4UNTA 3W2DL 2DQEH 4LVEA 4GRMB 2ZCKH 2EDRA 2D9QB 4OQTH 4TUOB 1AGEA 1CGUA 4LMQE 3KJ4C 4AENB 4PRPA 1Q9LA 4L9LA 4G9FD 1LD9A 2A9ML 1QUNA 2UUDK 2Z8SA 1PLGH 1QO3B 4HIXH 2WIMA 1BP3B 4NKIL 5I8OL 1JWUB 4NJAH 3MZGB 1FCGA 1NSNH 2VL4A 2X2YA 5I74B 4KQ3L 4L4JA 1MPAL 1IC7L 3P77B 3DSNA 5J6GB 1GRWA 1G7MA 2ZOLA 5IFHL 2CKBA 3I9GL 4ZO9A 1DVFD 1L7IH 2YXFA 1FZOB 3CPLB 4XC1H 1MAML 5I6XC 4NHUA 1HHHA 1JFMA 5IFJB 4P5TD 3O3DA 1CG9B 2VLRA 2OR7A 3QUMH 5EPMA 5DFTA 3TT3L 5JW4N 3D0VB 3U9UA 4WFFD 2GSGB 3I50L 1KGCD 1NEZB 1OD7A 1MSPA 3LKSB 4MMZC 1YA5A 1CDGA 3VGFA 4XNMA 1OWWA 3P2TA 5DMIH 1BOGB 4JJ5A 2XQBH 4CJ0A 1FFPB 3HNTH 1KT2A 3OJDA 1NEUA 1YY9C 3OKOA 4AQ1B 5C0BE 2VO5A 4RA3A 3MUZ1 1MNUH 3H7LA 2AEQL 2Z91A 3TIEA 3D85A 3BQUC 3WUWA 5FUZH 4X4YB 2PUQT 4UOW1 3G5YB 3CMOH 4KKBD 3CGTA 4ZNCD 3BMWA 5CD3A 1MOEA 5CD5C 3H9SA 2ATKA 2J4WH 5IM7A 1WF5A 3LMJH 3UJJH 2G75B 4ZTOL 3FB8B 3I84A 2I24N 4Y19A 2X4RA 3D39B 4LGSB 5EO0B 3MRDA 4X4ME 2JIXD 2GAZA 5HJ3A 4NO0A 2YD3A 5D2LA 3W82A 3FFDA 3IXAB 3UPRB 4K8RL 3MXWH 1HKLL 3WEXA 4S2SB 2ZUSA 2UWEE 4YC2B 3NZHL 3GSQB 2HYMA 1OCWL 1H5BA 2QQLH 3TESA 4AEFA 1FVDB 3GNMH 1KSRA 3UYRL 3CDCA 1I7ZB 1TIUA 2DM7A 5DQDH 2GI7A 3PABB 4OIIH 4P2OB 4YHYB 1KULA 4BH8B 4DKEL 1CXHA 3ZE1E 3I6KB 1LK3L 1LO0L 2VISA 1QLFB 3D5OF 4G80B 4QXTB 5FO8B 2M1KA 4L8SA 2PNDA 2I60H 4IMKC 4UOJA 3G5VA 1J8HA 1F2XK 5F9JA 2NY1D 4NKQB 3MV01 5C2UB 4PJHA 2FR4A 3GUTB 4BZ1L 1ULVA 1I8LA 1T3FB 2OLDA 3W0WD 3TF7C 4S1QL 4W6WB 2VOTA 5HDOA 1GZQA 2ZP0T 1PX3A 1IRAY 3B9KD 4OZHB 4XCYB 1KLGA 3MRLB 3L1OL 2DLHA 1XGQA 4ODHL 4WU5B 2OP4L 2CDEA 3TYGH 2WQ8A 3DMMB 5CJ8A 3KPRD 3EYOA 2DQUH 4JO3H 3QIUA 4Q9QH 4I9WD 5SX5K 4DGIL 4R3SB 2VLLB 4HG4K 1RUPH 4G8EA 1HCVA 3DV6A 1QQDB 4Y4HD 35C8L 2CIIA 4Z7WE 5IVXA 4QO1A 2DQTL 3HI5L 4D0DA 4YHOH 1UH4A 1KIRB 2NLJA 1F4YH 1HH9B 2Q3AA 4NO5B 2AJ3A 3F6IA 5EBWA 1K4CA 1QLEL 4BSVA 1L6XA 4WHTB 2W9LA 2V7NB 3EO9H 1TENA 2FZ3A 5FKPA 3L3GA 4AEHL 1AD9B 3EDKA 3GI8L 3IFNH 4HF5H 2BMKB 4U1IB 3I3EA 2EYRA 1FZKB 4Z95L 3NCYS 3QUYD 2VLJE 2Y5TA 5FOBA 1J0HA 4IJ3C 3TBTA 3JV5A 1J7VR 1PYWA 3VFVB 2R8SL 1A14L 4G7YL 1NAMH 4LLAA 4QHUB 4ZTPL 1JZ4A 5FCUL 4U05A 4J4PD 4QRRE 2L7JA 1DBKH 2HFGL 1TVHA 4MAUH 5IEHB 3LEVH 4BFBD 2I9TB 3IGAB 2OR9H 3NOIA 4PD4K 3TH2T 1L0QA 5KSUB 1BOGA 5I9QC 1S7XB 1NCDH 3BAEH 3DETD 4A2MA 1YECL 5T5NG 4KGJA 3PWUB 2QKIA 1JP5A 1XMWA 2YUXA 4HPYH 4Z0BL 2R0LL 4HK0B 2BJMH 3UPCA 4P3CH 1Z5LA 3MLTA 4X4YA 1IFHH 3GMPA 4PP1C 4DTGL 4JY4B 1OP9A 4HEME 1VACB 3O3UN 3VXSA 3QPXH 3NN8B 3QNXB 4P99A 5ETUA 1KOAA 4ODXB 2FLBT 4CVXB 1AQKH 4C58B 3I6GA 3GJFK 1FNEA 4XX1E 3JV6B 4UT9H 5HBBA 4WDIA 5DK2B 3PWNA 5HI3C 2DM2A 1V8HA 3EO0A 2C26A 4OJFL 5AEAA 4YBQD 2YPVH 3CH1B 3BIBX 4PJAB 5EZJB 4WFGE 5I18L 3VG0H 4L8SC 1AP2A 1YQ2A 1N6QL 1WWBX 3BP7B 2PW2B 3IDIA 4P46D 4N8VA 1W2KT 1B3JA 3LS4H 4UTAH 5CFHA 2WM0A 4PBXA 3U7AA 4YDKL 1VFOA 2F54D 1ZHLA 2QBWA 1KCUL 3TBWB 3I6LD 1G7JB 1I8LC 1WBXB 1J0IA 2Z8VC 3CFIC 3CH8A 3LKQA 2DMCA 4HWBH 5L2JA 4NNYA 3MFFA 3D0LB 2PTUA 3WIFB 4PRHB 2BSED 3ZKMD 5FO7B 3FRUB 3T0EA 2KUTA 4FP8H 1RURL 4AT6B 4OLVH 4E42A 1I9IL 3QIUC 3UTPD 5I1CL 3BPLC 1X5ZA 1RV6X 3V4PH 1IAIH 4Y8DC 4ZO6A 4RMVA 3RJDA 3SKMA 2WUBH 4E0RA 3SO3B 2HKHH 3DXAA 3OAUH 1QTYT 5JORB 4OZIF 3T3ME 1LO2L 3HG1D 5EA0H 5TQ0H 4L3CB 5KAQG 4NJ9H 1OTUC 3NGBC 4OFVA 5JNYA 3REWA 1TTGA 5KOVC 4D8PA 1CDBA 4EI5D 3DMMA 5DQJA 1XF2B 1JPSL 4RMWA 4P5MB 1Z2KA 4PJEA 3Q2CA 4OT1L 5FYJE 2RQ8A 1D9KA 1YMMA 3CZFA 2VDMH 5DMYA 1HXMB 4TQEH 5E2WH 1YN7B 1LWRA 1RIVH 3SDXF 4MS8D 5CP7B 1WJ3A 3CVHA 3L5XH 5CSGA 2P47B 4AEIL 4QOKD 5FHAL 1N0XH 6FABL 4EEEA 2W91A 1WBZA 3MJ7A 4OIAA 4HS6B 2HVJB 4O2EA 4KHTH 1F4XH 4WHTA 2Q8AH 3AS0A 1MY5A 5JUEL 3FT2B 1ZHKB 3QNYB 3KJ6L 4RRPA 4NN6B 3MUHL 2CRZA 3OX8A 1WUNT 3WFBL 3EOAB 1TQBC 3GMRB 2Y25A 2D7PA 4LIQH 3S4SA 4PS4H 2H41A 1SMOA 5E6IB 3GSNL 3JWNC 3IGAA 2DLFL 3WLWD 1IT9H 3QHTC 5D7KD 2NY0B 4MQSB 5FGSA 2OSLA 1OSZA 1INQA 2Q8BL 5KW9H 4GKSA 3P4LA 2EDQA 3D6GA 2ZCHH 1Y6KR 5JLZA 5E9DE 1X5JA 5C6TL 1WGOA 4H5SB 4UBDC 4HK0A 5IB5A 4WRLA 1RUQH 5KVEH 1BD2E 2BSRA 1U36A 4MD4B 15C8H 3DGGB 4KTDH 4MXWH 2EDEA 4OF7A 5HHMA 1CGWA 1MWAL 2FBOJ 4D9RE 3QQ3A 1IKFH 2IMMA 5JQ6L 3ZHDA 3SE3A 3V6OA 4FQIH 5AD0A 4NKMA 5E2TL 1TNMA 3K3QA 5CGYC 3W9EB 5KZCD 1CGVA 4TUJB 2JCCE 5FV2A 3VW3L 2JB6B 3OKMA 4XP6L 3SGEH 1AR1C 1SMAA 1CWVA 3BFOA 5EU6E 1WZ1L 3EYVB 3QIWD 2YD1A 3MJ9L 3NVQA 2F74B 4ZOCA 1FJ1B 2XWTB 3PDGA 4PLKC 5C92A 1ROWA 4R4BA 2X1WL 1BFVL 4PRAB 1QR4A 5CEZL 2AS5M 2CRIA 3T0EC 4YX2H 2IWGA 2NY3C 3CCHA 3DX8B 3L7FA 5IMOB 2VWEC 2WINB 4LKCA 4DVBA 2AV1A 1MCPL 4YGVA 4G6MH 3GRWH 1VKXA 4QRRD 4GKZB 4KI5D 2IF7A 3KPSE 1KC5L 4QRPE 4M8QA 4X5WB 1MJJA 4HKJB 2X6MA 1U6AH 5ADOH 3ULUE 5KVFL 3TJEL 1VSCA 3HCVA 3SKJL 2QQNL 1U91A 3R1GL 1JZ7A 1SY6H 4F2MA 1JYXA 2BSSA 2P5WE 3VXMB 1GGYA 2HT2C 4HX1A 4JG0H 4E41E 1F58L 2VDQL 2NTFB 3G04A 4JFPB 3RVXC 1X4YA 4PGBA 3K74B 3DMMC 2ZSVB 2IQ9L 3VXUB 1EO8H 2FIKB 2D4FA 4GAFB 2CDFB 1SEQH 3LQZB 4GMTH 3EDFA 1A3RL 1FNAA 4AJ0A 1D9KC 2HVKB 4JGJA 4R97B 5I71C 5IVNA 1AHWA 2NXZC 5FEBA 4KJWC 4M7JH 3MLZL 3V8CA 3PWJA 2V2WB 3LHPH 3PUCA 2BSTA 4YIQA 1DJSA 4PR5A 4BK4A 2UYLB 2UY6A 3RJQB 1FE8L 1PY9A 2FO4A 3U2SB 1YN6A 1FLRL 4PB9L 5DD0H 3TPKA 3TFKA 2IH3A 1A1NA 2R23A 3GKWH 5E4EB 3WJLA 2JB5L 2NCMA 4ZNEA 1UQSA 2RHEA 4CW1B 4B50A 3HNVL 1YN7A 2Y7QB 5SWZE 3O3EA 5FYKD 2GY5A 4UUJB 1UXSA 3E8UL 3IS1X 4MHHI 4K3DH 3TO4B 1HDMA 3PWVB 2R29H 3IJSB 2MQ3A 3DO7B 3ILQC 4ORGA 1IQDB 1NBQA 4Z7VB 2GUOB 4S1SH 4HS6A 1ZE3C 1CFSB 2QTEA 1F6LL 1FO0A 5HHOB 4LSRL 4O2CA 2ARJA 4JHBA 3F7YA 1MFDH 2ITCB 5EBMA 3AXLB 1VADB 1A7QL 4HIIA 1IGJA 3T2NH 1H0DB 1UM4H 3DX9A 4HCRA 2DJSA 1BVKB 3DSFH 3ECBB 5D7LD 3L5WB 4PJFA 2DYPA 5GRYA 4KKLD 2DLTA 4IRJD 3F12B 1NGXB 3QZWA 5F7LB 1ACYL 3PJSB 3MV8A 1JL8A 2VLKE 2A77H 5L88H 2GITB 1G7LA 4WCYH 3ROOA 5L0QC 4OV5B 5FK9B 5DHVB 1G9NC 1H8OA 2GSIA 1S9WA 3SE3C 3V6OC 3PGCB 3F5WA 1XF3A 1IGIH 3AAZA 3BHBA 4DAGL 4TPRL 3ARYA 1INEH 3D3VA 4K07A 4ODUA 3C08H 4DK3A 1LP9E 4JKLA 4KRNA 5FHBH 2I07A 5IBTH 1UZ6E 4F37F 5DMGD 1CL7H 3VFMA 3AMKA 4K9EL 5C09B 1BVLA 1ODAA 1OT1A 4RFNC 3RRQA 3VH8G 2PYEB 3QQNA 3O4LE 5LCVH 2DTMH 4KQ4H 2ESVA 2E6PA 2IFFH 3STZB 1N26A 1TZIA 1QLRB 3CVIH 5FA4B 5KG9B 2ZZUT 3CU7A 1YEFH 5T1LA 4NKOB 1QHPA 4GW5A 4LPXA 2Z8WC 3OKDA 1RULL 3MA7A 3BRGC 1AE6H 2J3SA 4V2CB 5DLMH 3IDMB 3HI1B 5SWSE 4LDLB 4Y5XA 5IMOA 2OL3A 5T3ZD 2YN5A 3FONA 3O6ML 3WFDH 2E7CA 3V79C 2X4QB 5L2KD 1JHLL 2R2EA 1SEBB 1VGKA 2W07A 2E7MA 2FL5A 1FG2A 5FDWB 3PHOB 4JKPH 1CU4L 1ONQA 3BKYH 3PG2A 4Y5YA 3UTSE 4FQHA 1BFSA 3B8SA 5F7YC 4I0KA 4R4NC 4PRIB 5E9DD 1ZTXH 4PJ8B 1MIEL 3WHXB 4L8CA 2H32A 3ARSA 3LSOB 3ES6B 5MENB 3BKML 2VIRB 4JM2B 4CADA 2EEBA 2R39A 3TFKC 2NYYD 2BNQD 1GSMA 3WJLC 5JO5A 2O5XL 4R4FL 3OZ9L 5DUBA 4JFEB 3IDNB 2QSVA 3HPJA 1T20B 1IM9B 5F93C 2PETA 1IEAB 2OTUB 4MA8H 4OZFA 2A1WH 2W38A 1BIIB 3ARUA 2YBRB 3U30B 5CJ5A 1WCBB 3ZDYF 2XN9E 3BT2L 4LGRB 4ZS6D 5CJQH 4ZUWA 2VL5A 3ZDZE 1CLOL 2PO6A 2ENSA 3FO0H 2R2BA 4UU9B 2I9LB 4QXGH 5HD8C 1OAYH 2VR9A 1MAKA 4PJXE 3FOLB 2OCFD 4EI6B 3FRPG 5CS7A 3P9LA 4NN6C 4KMQA 5DS8A 3A6BL 5KVGL 5EUKA 5DI8A 4LAJH 1J18A 3S96B 3VD9A 1LEIB 1G9NH 4Y1AA 5FYLH 5JW4R 2YN3A 4UIKH 4ONGL 1NCWH 4GO6B 1IBGL 1NJ9B 1H3PH 4MCYB 3SDAB 3U0PA 4HDIB 4H8WL 5DWUH 4Q74A 4TNWK 3WXVH 5MEPA 1CK0L 1HQ4A 3HLAB 2ITCA 3QO0A 5F89A 2AQ2A 3DHJA 1ZLVH 1F00I 3C60D 4LCWE 1M71B 3FZUC 5GGQH 4LPWA 3D25B 2X4PB 4GSDH 2HTLC 5DHYB 3WIHL 4UIMA 2WLZA 1EBAA 2JJWA 5EOQL 1Q0YL 2ICEA 5EO1A 3BPOB 4KUZH 3NIDF 4OLXH 4ELMF 3HMWL 4OV5A 4L3ED 5I1AB 1OB1B 1V7NL 4DZ8B 1JIBA 1J1PL 4CVZA 5LGKA 4P57B 1NGWB 2XRAH 4G6FD 1UYWL 3SHSA 4BKLB 3LKOB 1A3LH 2HTKD 3SDXA 4A6YA 2V6HA 3KYMA 1CLZL 3WL9B 4YXHH 4NUGH 4JFDA 4MNQD 2QEJA 4JDZA 2XZQL 3S3PA 1FGVL 1OQXA 1HHGB 1NGQH 25C8H 4YZFF 3LN5A 1B2WL 1NMAL 2EC9T 1M7DB 4Y5XC 5SWQB 2NY7L 4KH2A 4HQQL 1AKJB 3L3IB 1X5YA 1VGEH 2DOCA 3GI9H 4F7TA 3B3IA 4RFOL 4PJ9D 3IDJB 2HG5B 5C7XH 3L95A 3P11H 5F70A 4TTDC 1E6JL 1QHOA 4HWZB 1AXTH 4EN3A 2QL1A 5HGHB 4MXVE 1BZ9A 5LG1A 2R1WB 2ADFL 4MX7A 4URTB 1KIUA 3TJHD 1KCRH 3BUTA 4BFGA 1OGAA 1BQHG 5GGVH 2CR6A 2IMNA 4P4RB 4X7SH 1BWMA 3F58L 3T8XB 1A9EA 4D0CA 2X4QA 1IJ9A 1JV5B 2MWCA 2NXYD 4NHUE 5LAXB 4WO4A 2VLRE 2COQA 4OQ1A 1I8KA 1OTSD 3V4UH 5FDWA 4E5XA 1E6OL 5KSVB 4LHUB 1P4LB 4XGZA 5DJ8B 4ONHB 1QKZH 1FGNH 1G7PA 1MJ8H 4CU6A 1EGJH 1EXUA 1KG0B 2PO6C 3M1BB 3CK0H 1HINH 1DANT 5D72L 5MENA 3WXWH 4WY7H 4HCRH 5JDJA 5IW6A 2IQAB 5M94B 4U6YA 4OZGF 3B2UD 4CN1A 4ALAH 4XNXL 1ZXQA 2P8LB 4WJ5B 3VFPB 4EQ2A 1IM9A 1P5UA 1YJDH 4OIBA 5I16A 3H9SE 1UWXH 4UT6L 3SBWA 5ENWA 1XAUA 3BZEB 4Y2OA 4OCLC 1U8HA 1J5OL 3U9PH 2P5EB 4KKAC 3IJYB 4TVPD 4JZOB 5F1IB 1QVOB 1U8KB 3BJLA 5DSCB 5GRJH 3E1F1 4G6AD 4C4KO 5IB4A 1JGVL 4HGWB 1P7KA 1NBVH 4N9GB 3BMVA 3K1KC 1FNSL 3ARFB 1INDH 3KGRA 2IAMA 4JY5L 3PNWB 4P5KA 4FZ8L 1A1MB 5GZND 3ARED 5CINL 4QY8B 4XWGH 4NYLA 1YEHL 1QSZA 1RZ7L 2XTJB 1A8JH 4LIQE 1CLCA 5IWLA 1GOGA 4KK5D 5FF6A 3EJZD 5I0DA 1U3HA 3UTZB 4L29B 3RGVA 4C83B 4F8QA 4HKXB 4AH2B 4MJID 4MJ5B 4JB9H 4OCYL 1V3MA 2X7LB 2XKUA 3U7WH 3ARDA 3B5HA 7CGTA 5AZ2H 5F3BB 3EYSL 2EH7H 1DQJB 1ZGLP 2C4FT 1DLFL 1CZ8L 2BFVL 3OJ2C 3BDXA 4AM0B 3VRJB 3OQ3B 3T04D 3VGAB 4JFFB 1XGYL 3KPPA 5HGBB 4HHAB 3V8OA 4EUPA 3K4ZA 3UYPA 1A7BA 2Z92B 3C6SB 1S9XA 4XB8A 3P3YA 4OLUH 4X7TB 3HZYB 1EPFA 1KJMA 3HC3H 4R90H 4LOUD 4ZG1A 4PGZA 2OQJB 3WV0A 2FHCA 2IALA 5DGQA 3MRPA 5DRNA 3SGKA 3GBMH 2E7HA 5DVOA 2CSPA 3QDHA 4YHKL 1RHFA 2H32H 2R0ZL 5EC2B 3UBXA 3THMH 2J6EL 1NLBH 4X98B 1KCSH 3DBXB 4EN3C 2BY0A 4LP5A 1QRNB 3DURA 2BRRL 5IF0A 3OF6A 1ED3A 3MBEA 3KYNB 2K9UA 2R2CA 4HJJH 4N0FB 4OZ4A 3MLYH 2E9BA 4QNPE 4RAHA 5AZEH 3HC4L 5T5NF 4WO4C 5TE7L 1C08B 3DX7B 4JR9H 5DA0B 3REVB 4X6FB 5K9JL 5IK3A 1TDQA 5TDPB 1L7TH 1CDYA 4GG6F 2HFEA 4PJ8C 2ED9A 3NZ8B 5ISZA 3BH9B 4YAQA 2W9EH 1AFVH 1AGBB 4YK4C 3V6ZA 3RZCA 1WLHA 1RVFH 2EC9U 2IBGA 2CLVB 2YK1L 1OQOA 4WV1B 3TNMB 3X13A 4M6AA 2BNUB 3OAYK 2ZKHH 4HH9A 3JTTA 4KJQC 4OSUH 1RJCA 2V17H 3KXFD 2EXYC 5C2BL 1UACH 4Y16D 4G5ZH 2Y72A 4PV9B 3SBWC 4FQ2H 3TWCL 1XGRB 4WWKA 5DK0B 2P42B 1JNLL 5F7NC 2W0FA 1ZT7A 2YPKA 3QUZB 3MLSH 4J7RA 1OARH 5EU3A 4DVRH 4ISVB 1S3KH 3CSPA 1BF8A 1BZ7A 1N3NB 5MP6H 3ZT7A 3VWKD 1XR9B 5J0BA 3CMGA 2IAMC 3OB8A 3RWCB 5LWYH 4NZTH 1MLBA 3QQ9C 2EIDA 4NQCD 3WD5H 3FMGH 4JRXA 1MEXL 5E8DH 8CGTA 3UZQA 1F2QA 4H1LB 3GSNB 1T7VA 3ERYA 4RGND 3K7UA 5IWLC 5I8EA 3GIZL 1T0NA 4CRPA 5GGRA 1U3HC 1MI5B 4P49A 3L5IA 2RCSL 3RGVC 3D39E 3GZKA 5J1TC 2EIZB 4IDJH 4LRNH 1M6OA 1DANU 1YEGH 4XNZB 3R4DA 5DYOB 4U1GB 1OM3H 3ARDC 4AG4L 1HCFX 3L7EB 3MRGB 4U3XA 4XP9L 1WAAE 1VFAA 3OKEB 1OSPH 1C16A 2HP4A 3MACH 5HDLA 1MWAB 2KQNA 5B8CA 5KAQF 1RZIA 3ZL4H 4NO3B 3QSKB 1UG9A 1YEKL 1N5YH 4AIZB 2EDBA 5T33L 2APVA 1A3QA 2DQGH 3L3DA 5C3TA 4PJDF 2WK2A 1HHJB 3O11A 3SGKC 4ETQB 5KSAD 1EFXB 3LV3B 5K33A 2FLRT 1Q9KA 4XP1L 2EE3A 1E27B 1WCQA 3P9MB 1V3KA 3W2DH 3L3HA 1YUHB 2VXTL 2EDKA 4OKDA 4HUUB 3MBEC 3VRJA 1FHGA 2BX5A 4J3OC 3RWGB 4JZNB 4O2FA 1KPRB 3VGHA 4UTBL 1RZFL 2VE6A 1MHPL 2ZNWA 3ARWA 1JMZA 1RJYB 1D6VL 3UROR 4L8DB 2MOVA 4NKIH 3DXAE 4XCCL 2F15A 1YNKL 4J3UA 1QBLH 2IPTL 5EH1A 3T1FA 3QHZL 5EN2B 4D9QE 3W9DB 5IW1A 2GJ6A 3R8QA 1H3VA 4OZHE 4KQ3H 1MPAH 1IC7H 4DZBB 2Z8RA 5BZWB 2WAHA 1BX2A 5JIKA 2F53A 2NY2B 1YNLL 5TJWK 5IFHH 3I9GH 1DR9A 4N9OB 5FO9A 3TYFA 4HLZH 4KK9C 3KYNA 2C4FU 4S0UC 5F1SA 3RZCC 5BOPA 1RY7B 5JOPD 4MWFB 3TT3H 4JO2H 2AJYH 1NAKL 4NN5B 4YEFA 2BNRA 1C08A 5HHVL 1NC4D 4GAJH 1MHCB 2IANB 2DM3A 3R06B 3QUXA 2VZ1A 4ZAKA 2DF3A 4PJIB 4HJ0D 4WWKC 2DQIH 2DBJA 3MNZA 4S0SD 1NL0L 3SE9L 5IBLD 2AEQH 4QYOA 1PG7W 4WFED 1BAFL 2PW1B 4LPUA 3G08B 1JVKA 1JTOA 2VDKL 5FYJU 1XIWD 1A6WH 4KPHH 1TCMA 3ZKNC 1KNOA 4OF6A 5I1DB 4M3KB 4TULL 1FC2D 3NH7L 1VFUA 4ZTOH 3RX5A 2LQRA 3QDJB 3QWRD 2F8VA 5CILH 1YY8A 1JGUL 1UB6A 2IEPA 5F7KC 2UV3A 2V9QA 5E6ZA 1FH5L 5LGJB 4MXQA 4U1MA 3GSWA 2YD5A 2WNGA 2DAVA 4FNLL 4HW6A 1MRFL 1S8DA 5HYJD 4K8RH 4P23A 3V4VL 1CICB 4R7DB 2VKWA 3SCMB 3BEVA 1N3NA 3NFNB 2JK5B 1D5ZA 2GTWA 2XA8L 2WWKO 4KJYB 4X99B 3SDCB 4S1RL 4G43B 5B8CC 3UYRH 1YEEL 1NFDF 5C0AA 2FSEB 5FYLE 1U93A 4PJBB 2XTJC 1ORSA 3D9AH 3R0MA 3EKCA 4MNHB 4XRCB 4DKEH 1A2YA 1GGUA 3MV7A 1TZHB 4WI9A 1KBGH 4LSSL 3VWJA 5HI5D 5LXGL 5D7IB 5T3XD 1QSFB 2V2XB 3RFZC 1A7PH 1SYVB 3DI2B 3M17A 4CNIA 4QTHB 5ABDE 5DJAA 5JTWA 1D5BB 4PJ7B 4HUXB 4JVUA 4PJAE 3NCEB 3L7EA 3MRGA 4CBPA 1FFNB 4LF3B 4CMHC 3H7BA 5BVPH 5IB1A 3VFTB 2CMRL 3PWPB 4Z8FH 1W0VA 3O8XD 5EG6C 5IB3A 2XYCA 4TSCH 4LLUA 5DZOA 1HHJA 3P73B 4NN7B 1KB5L 3PWLA 3L1OH 5EO9A 1EEQA 1S9YB 2FNBA 3LV3A 1PAMA 2B4CL 2VUOA 4JRYA 4YE4H 4F9LA 4UOW0 3BKJL 3TN0D 1L6ZA 4U1LA 4RWYL 4PRHE 4ZXBB 2Z93A 5DR5H 1UWXK 5IUSA 2HWZH 2Q86A 3FQUB 5E2UL 2OZ4A 1WTGT 1FNGB 4K71C 4JO1H 5I19L 1KPRA 43CAA 5KS9A 2FEDD 2V5MA 4IDLA 1NBZB 1OD9A 5I1GH 5C3LD 4P9ML 1WWCA 1IL1B 1GGBL 1QLEH 2R4RL 5D1ZD 5HY9A 1BFOA 2YEZB 4AEHH 2NQCA 3QUXC 4HJGA 4ZAKC 1W8NA 5DJDB 4DZBA 4YDLC 5D5MF 5CMAA 2C1OA 4U1SB 1KJ2B 2EYTB 2DWDB 1J1XL 4Z95H 4HV8A 4XWOD 3C9NB 3PF2A 3LKNA 2UVFA 4BFIA 1AGDB 4JFHE 4NC2B 5K59F 2XWJA 4KWUA 2R8SH 1A7NH 3VXQB 3RHWF 4LNRB 3VI3E 3IFLL 4JE4B 5FCUH 3QCVL 4UI2A 2L0DA 4R2GB 3EHBC 2A6JA 5A16B 3CSYB 1NDMB 1T0PB 4OKVB 2BOCA 4U0RC 5CUSL 3UDWA 3VXRB 4NNPL 4YO0A 1J9CT 4MXQC 1YECH 3OHXA 5TQ2L 3WS3A 3SKOA 2X4TB 4KHXL 4M43L 3QHFH 2R0LH 3WNMA 5AUMB 1J0ZA 4V1DB 4HK3J 4P23C 1BHGA 4ZMAT 1K4DA 5K9KA 1RZKC 2AKRB 1TJGH 3HZKA 3ARPA 4LLDA 1ZT4B 1IGFL 4K94L 1BLNB 4NSKA 3OGCB 1I9JL 2GT9B 4XPFL 5D1XA 1XH3A 5C07A 4OJFH 2V9TA 1KCKA 4PGCA 5MERA 2EKSB 3VRLE 4OI8A