1HOCA

The three-dimensional structure of h-2db at 2.4 angstroms resolution: implications for antigen-determinant selection
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
272
structure length
272
Chain Sequence
GPHSMRYFETAVSRPGLEEPRYISVGYVDNKEFVRFDSDAENPRYEPRAPWMEQEGPEYWERETQKAKGQEQWFRVSLRNLLGYYNQSAGGSHTLQQMSGCDLGSDWRLLRGYLQFAYEGRDYIALNEDLKTWTAADMAAQITRRKWEQSGAAEHYKAYLEGECVEWLHRYLKNGNATLLRTDSPKAHVTHHPRSKGEVTLRCWALGFYPADITLTWQLNGEELTQDMELVETRPAGDGTFQKWASVVVPLGKEQNYTCRVYHEGLPEPLTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CLASS I HISTOCOMPATIBILITY ANTIGEN (H2-DB) (ALPHA CHAIN)
publication title The three-dimensional structure of H-2Db at 2.4 A resolution: implications for antigen-determinant selection
pubmed doi rcsb
source organism Mus musculus
molecule tags Histocompatibility antigen
total genus 56
structure length 272
sequence length 272
ec nomenclature
pdb deposition date 1994-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1hocA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 1hocA01
5DJYB 4IIQC 4NRZA 3G04B 5FF6B 3DBXB 1QA9A 3I2CL 3SE8L 1JRHI 4NNYA 1CU4H 5CZVL 2ZOLB 4BK5A 1EAPB 3UO1H 3KLAB 5FYJU 2WIIB 3RZCA 3PNWA 3VFWB 4ORZC 3BIAX 1XGTA 1Z0MA 3VXMB 4QO1A 5I16B 1NBQA 3EYQD 4PTTB 3LH2H 1F6AA 1P2CA 3N85L 5C3TA 1KCSH 1MVFA 1T21A 2JJSA 2Q76B 3DVGA 4LCCB 1D5BB 2YC1B 1MVUB 2IC2A 4ODTL 1KIUA 3T0BA 4MXVE 3BN9D 1FNLA 3GI9L 1PJ9A 3LQAH 5KSBB 1TPXB 4R90H 3ZKSD 4JO3H 1YY8B 4MZ3A 1RZIA 1XMWA 4PJ7B 2V7NA 3P11L 3QRGH 2B2XH 4FQHB 3KDMA 4M6AA 3BPLC 4PJAB 3HE6C 3QUZC 1CFSB 5KS9E 3MRGA 2K9UA 4Q74A 4Y5XC 4ZAKC 2DQTL 3U0WH 1A14L 1ZLVH 1AC0A 4BM7A 5BV7H 1TCRA 4KTDL 1RUKL 2EXWC 3HFML 1YYLL 1XGRB 3MMEA 4LLDA 1AP2A 1MQ8A 2R2EA 3S35X 3IJSA 1TJGL 4MS8A 1MLCB 3I6GA 1ZA6A 5E8NA 2V2XA 3VGFA 2W9LA 3LEVL 1ZEAH 3PWPE 4F80A 2YHGA 2QADD 3GMNB 1FHGA 1CWVA 3P4NB 4PBVC 5LXGH 2W0PA 1X5YA 4JRYE 2MOVA 4PGBA 3Q5OA 4G8GA 1NAMA 1JPFA 2HAZA 4A2MA 3JZ7A 3DPBA 5DRWB 4OQ1A 3SPVB 3L3GA 5DK2B 5D70L 4PJIF 4N8VB 1DBKL 4IRSA 1H5BC 1X4XA 5F8QC 1OP5K 2DKMA 3WFHB 1S9YB 1GYAA 3ARDB 4UQ2B 4D0DA 1CK0L 3MLUH 5I1AA 35C8H 1UXSB 2CH8A 2LVCA 4PJ9D 2ADGA 3QIWB 1QSFA 2OMBA 2YXFA 3O9WB 3VH8A 2XZQL 2A73A 5T3ZL 1HEZB 3BDYL 2BOBA 5E2WL 4RGNB 4C58B 4G6JH 1WZ1L 1KLGA 1BD2E 3MV7E 4JFQB 2GFBB 4M8QB 4ELME 1X4YA 2EDOA 5D93B 1Y18B 1A6PA 1KJ2H 4EUPH 1Q9LA 5F3BB 4MHHI 4JG1H 1QNZL 2OXHA 2HTKC 2DIJA 2Y6SD 4J6RL 4X4XA 2GJZA 5DR5L 1RHHA 2PTUA 4YZFF 1NBZA 1N5YL 3QA3A 3T09A 4U6XB 3R06B 4H1LH 2QQKH 3FB6B 4Z0XB 3FQRA 3EJJX 1X5KA 5SWSA 3O6LL 5ICXB 2CDFB 2AXFB 4WEUD 2VYRE 1BIHA 3S5LB 1V8HA 3BWUC 5GS0H 1EO5A 3VXUE 1MWAH 4WVRA 3REWB 1QSEA 3LZFL 3SKNA 3MRRA 4RZCB 1E28B 2GUOA 2VLRA 2LAGB 1J0KA 2XZAH 1I1CA 3GIVA 3WLWC 2ITCB 2W0KA 1A02N 5C86A 2IMNA 1HCVA 2UZYB 4NQED 4PRNA 5HPMA 5T1KB 2BZDA 4LEXL 3NZHH 2WBKA 5FHBH 1TZIB 2I24N 3PWUB 4F2MB 4HKBB 3D3VB 4X6BB 3SGJA 1W0VB 3MRHA 2WUBL 4GAYA 3EJYD 1RUMH 3DHJA 3RPIB 3VWJB 4NQEB 3EYFB 3V5KB 2EH7L 1U2HA 4PB0L 3JV4B 4J1UB 3UTSE 4R4FH 5IGXL 1GGBH 1FFQA 2VLJA 1OGAD 3RL1B 1G9NH 3EDEA 2R1WB 2VC2L 3VXSE 1L8JA 1ZLUH 1J10A 3IF1A 4RAHA 4UOW1 25C8H 1F4AA 1ZLVK 4LCYB 2XPGB 3LSOA 4CVXA 4BUHA 3VWKB 1X5LA 1CE6A 4O2FA 3INUL 3DV6B 5GGRB 4GKNB 2MHAB 2GSGA 3MRIB 4AM0A 1T04A 3LD8C 4JHAH 3MGTA 4OTXH 3RWHA 3BJLA 5KJRH 4I0PB 1IAKA 3CPLB 3EDFA 3RIAK 4EVNB 3BGMA 4AEEA 1CI5A 2BRRL 5CJQH 3ZYOA 4ODHL 2X1OA 1MCQA 4R26L 3S96A 2JB6B 1OSZB 1Z9MA 4DAGH 1MY5A 1T6WA 3TIDA 4C54A 3QDHA 3TPUB 5JQ6L 4XPTL 2AEPL 2HP4A 1GZQA 1PG7X 3STLA 3NVQA 5C09D 3V5DA 2FJHA 2FATH 4FQJH 4X9HA 2NTSP 4EXKA 1WISA 1F58H 2CRIA 3EOAA 2AXGB 4JJ5B 3SGKA 4GXVL 1YN7A 5DVKA 1OARH 3VXQB 1A22B 4NUJA 4WI5A 3WXWL 1MY7A 4EI6B 5TQ0H 5DLML 1MRFH 4F7CB 4GRWF 1EUTA 2XKNB 2JB5L 2PETA 5D1QA 2E7LA 3QWQB 4GBXB 1KCVL 4BFIB 5JORB 1YMMA 2OTPA 3HG1A 3TC9A 3QP3A 2PW1B 4QRPD 1DQLH 1HH6B 3MJGX 2F8VA 4CU6A 1EO8L 3UPRA 1BWWA 2FGWH 1M7IB 3FCTB 4OZ4B 4LARH 2OMNA 4PRHD 1IQWH 3O2VL 3KLSA 3RGVD 4PJCE 3CFEA 1A7QH 3ZHKA 1T1XA 1FIEA 5HJ3B 4UU9A 5EUKB 1EH9A 4PUBL 3VRLF 2E9BA 3QDJA 1W0WA 4Z7VA 2DWDA 3SKOB 3HE7B 4NQTA 5JW4Q 3UYRH 4NKDB 3C5ZA 3RGVB 4HBQA 3SY0B 2IH1A 1VACB 4NP4H 5EO9A 4KJYB 4FP8L 4HFWA 1KB5A 2V2WB 4XPHL 2I07A 4Q97A 3RNKA 1KJVB 4XNXL 1AC6A 1VERA 5BO1L 1N8ZB 1MIEL 4XMPH 3T2QA 5JR1H 3HPLA 5D72L 2PR4H 2BHYA 4L8DA 3NACH 4Y5VA 5A2KH 1MFDL 5B3JE 2WUCL 5EU7C 1HYSD 2YA2A 3K1KC 5FV1L 2Q86B 2VQ1A 2XTLA 5E4EB 2JIXD 1BIIB 3G6JE 4GG6E 5FAAA 3QH3B 3VU2A 1ZLUK 3WNPA 2HTLC 4Z7UB 1NCDL 1D3CA 4N9GB 1U8LA 4NWTL 4YBHA 1R3LA 5KVDH 3QEGH 1H8OA 1CGXA 1D5MA 3C6LD 3DHMA 4YFLF 3OJVC 2K3TA 5IROC 4DVRH 2JIXB 2XG5A 1INEL 4CRPA 2J8UB 1T0MA 3EHBD 5DHVH 1AY1L 5I1HH 4G8EB 2VKXA 5C0JA 5IB2A 2NY2C 2X2YA 3NCYS 5DJCB 3TBWB 3D69B 1WBZB 3HKFA 3NN8B 5GGTH 1FNGA 1GJIA 2I9LB 1BP3B 5DJ8A 4YHYC 4PJHE 3I6KB 1OTUC 1IEAA 2VXUH 4KK5D 3KPRB 2P49B 1WAAE 4H25A 1IC5H 5IJKA 5I1CH 4X5XA 1BJ1H 4RA3A 1F4WH 2Y23A 4M7JH 3ZDZE 1YC7A 3B9DA 3QAZB 3EGSA 4XX1E 1QO3A 1JPST 1QRND 2A9NL 5TDPB 2VZSA 1JTPA 4PJEE 4HH8A 4LKCA 1VFAB 3PHOA 4NN7B 1S7UA 3JWOH 1XGUB 1JVKA 5EU6B 1UT9A 5DJ2B 1DUYA 1VEMA 2XTJC 5EUOF 5ACZB 5C6WH 4PJXA 1FFNA 2E8YA 3WDIA 1JZ8A 3W81A 3PGDB 2C9AA 3P0GB 4PLOB 3D2UA 4G7VH 5FO7A 1HHJA 1R3KA 1MFEH 4Q6IB 2I5YL 4I18A 4JB9H 1YEDB 5D5MA 3U79A 4LSRH 1FVEB 2A9ML 3P9LA 2E3VA 4S0UC 3H7LA 3MLXH 1E6JL 3G5YA 3STZB 3HR6A 4OCSL 3NH7L 2D0FA 3P73B 3RY4A 4YJZL 4MVBA 2VLKD 1BOYA 5EPMB 4JO1H 1F2QA 4NHUE 4WI7A 3OR6B 4ONHB 1A6TA 1FYTA 5GGRY 4K7PY 4QHKI 5DJXB 3OKNB 4GW1A 2WV3A 4K71C 3MUGB 1NUFA 5HI5D 3NPSB 4YBLC 3JWDC 5D7JC 4KH2A 3D0VA 4HWEH 4K7FA 5E08L 4NSKB 2DF3A 2W60A 3WFDL 2HFGH 4J4PC 5K9JH 1F4XL 3JSSA 2X4RA 1E4XL 1K8DB 1INQB 1JBJA 3FB5B 1D9KD 1DFBL 3A67L 4OKVB 4W6YB 5E0QA 5INDA 3CDCA 3SDAD 5KS9B 2O5ZL 5FYJD 5ESQA 1NSNL 1JJUA 5I71C 1PBYA 2FEDC 3PWPD 3BE1H 3HAEG 4K2UL 3UDWA 3GSXB 1OPGH 3AMKA 1MAML 4OFDA 2BVYA 1F8TL 3GJFH 3PGFL 4P2OD 4MA8L 4YAQB 1J8HE 5IG7A 5GGVY 1B88A 2DLFH 2PO6A 4HUUB 3PWPB 5KANG 3GNML 5M94B 4M7LH 1OF2B 5D8JL 1RK1B 2XWTA 3L7FB 3DETD 3S36H 4NQCA 4P2OB 4JRYB 5D1ZA 5HYEA 5FM5O 5DD1L 3CC5B 1ND0A 3HTLX 3H0TA 2VXQH 3SBWA 2DI9A 5AD0A 1K5NA 1A0QL 1A3RL 2DB8A 4KMLB 2R0LH 5FGSA 4AJ0A 4CVZB 1W72A 4QRRE 4P5MA 5LAXB 5MEOB 4JKLA 4FFVD 4NOBA 1BD2D 3MV7D 1SEBB 4WUUE 1HNGA 4QXGL 1PX3A 3BSZH 1BM3H 1T7ZA 1F4HA 3T0EA 1MJ8H 3MLVH 3UP1A 4B5EA 3WJJC 4U0RC 1DBJL 5GIRB 4LSUL 1NKOA 3ABZA 4LF3A 3EOBA 4XPFH 1IT9H 3CSYB 4E41A 1BD2B 3MV7B 4OIIH 1HILB 4J3TA 4ELMB 3QXWA 2B1HH 3G9AB 3K3QA 4K23L 4GW5A 5DS8A 3QG7H 3RU8H 4QHMB 1PSKL 5FYKU 1CTNA 3I85A 4G7YH 3RWEB 5EBWB 3QRFM 4TUOB 4UDTB 3HCVA 2VZTA 4YPJA 4YUEL 3LEYL 4HZLA 3U1SL 5GRXG 3S3JA 1UH4A 2YK1H 3QXVA 2X89A 1MCEA 3T2OA 3MA7B 4R3SB 1G9MH 2NY3D 4JY6A 4JANA 1DANT 4KTEH 4JFEA 4PJFE 3VXUB 1BOGA 1GHFL 5F44A 1SYSB 3QWOA 5FGBA 4XP9L 4WWKD 1B0GB 5E00B 1T4KB 4KHTH 4HPOH 5J4MA 1R3HA 4LCCC 4RMRA 4FFWD 2CDGB 3LS5L 2M26A 5C0GB 4WUKL 3WKMH 5F1IA 1AGFA 1GIGL 5TGBA 1TPXC 1U42A 3QI9B 1KG0A 5IBTL 4LCIL 2FX8L 2JLLA 3EYQC 2OZ4H 2BVOB 1AKJB 1PY4A 3MC0A 3VXSD 1U0QA 3L5IA 2NY5H 3NFSH 2AXJA 3PV6A 4P5KA 1ZLSL 3BN9C 2GJ6B 3RHWF 4OD2B 3UTSB 3CFCH 1BX2B 3WXVH 3VXSB 4YHML 2YUVA 3BEVB 4G6AD 4M6OH 4ZMAT 4ODVL 1NBVH 4Y19E 5GS2D 3C9NA 4CVUA 1TZHA 1WIPA 5KN5B 3BGFB 1JGEA 4NYLA 3E2HB 1HH9A 4I0KA 3GJFK 1DN2A 5F88B 4G9DA 2FJFB 3VJ6B 2OJEB 5FOBB 2EDDA 1IAIM 1EX0A 3DIFB 2IPUG 2QHRH 3EZ8A 3U2SB 3KPLA 1FL3B 1JWUA 2AABH 4OLUL 1NMAL 5ISZD 3ILPB 2QADC 1JNJA 5C0IA 1UXWB 3EAKA 5L2JB 4GRMA 1OP3H 2ATPA 4LEOA 4P23D 3ZYIA 3T77B 4OJFH 3LB6D 4OV5B 3THMH 2UY7A 2AI0L 2RR3A 2W9DH 3P77B 5IQ9A 4AG4L 4LMQI 1MH5B 4B41A 3E6FB 4CNIA 1QBMH 4X6CE 5JW5A 3RUGA 4OF3A 4HEPG 3A6BH 4WW1B 4MD4A 4PJXF 1CT8B 5FA4B 1UVQA 1BQUA 3GSUB 1CR9L 4DKDC 3SDXF 5D5MF 4LLYA 4PJ9C 1HI6B 1FG9C 4IBLT 1F6FB 2YPLA 2RFXB 4BQ9A 3UXFA 3DYMA 5C08A 3O2DH 4KI1A 3HAEH 1D5IH 2YKLH 5D6DA 4U6HA 1JGVL 4KVNL 4RFNB 3X3FH 4HGWB 1IILE 4A6YH 3N1GC 5F7MC 1ORQB 4IOIB 4Z7QF 4AL8H 1A7NH 1FV1A 4G3YL 3LRSA 1IM3A 1NMCC 5DMGD 5C0FB 5DEGB 3SJVE 4AY0A 3HMXL 4Y1AD 2Y6SC 4XCFL 3DSFL 3B5GA 4PJCB 4X80L 1NUNB 5GRVK 5DQDH 4GSDH 5E2UH 2AJVL 1RUQH 4PP8C 4HIHB 1OLLA 1Z2KA 4H8WC 4DVBA 2AK4A 4G6KH 4L3CA 4RFOH 3V8OA 3DO3A 3TEUA 2F74B 4PGJA 3KYKL 2IANE 2ILLA 3CMOH 5C8JB 2YD9A 5JMRA 5ECJE 1YEJL 1ZVSA 5ID1B 3GKWH 1B4JL 3TCXA 3F12A 2P8MA 4FTVD 1BVKB 4BQCA 2XWBA 1NGXB 3T2PA 2P42B 2YZ8A 2PCPB 2CLVB 5I0ZA 4WEMB 1MCHA 4P4RA 5MI0B 1MJJA 3MXWL 5EWIL 4ERSL 2H8PB 2OBGA 3B83A 3EJYC 4EI5B 3FONB 3RWFA 1LDPL 4M6ML 1AR1D 3JWDL 3G6JB 2CXGA 4GG6B 2BMKB 3O4OB 2BERA 2EDXA 4KRLB 3LVEA 2BY3A 1I8KB 2X9XA 2IGFH 3GRWL 5AZ2L 4NZTL 1FYHB 2IADA 3QEUA 5IIEA 3MV8A 3HMWH 3QIBB 2CR6A 2JJTC 2C7UA 3MREB 5SV3A 4EIGB 4R9HA 5HY9A 4FQIH 4MQTB 5FKAA 3SGEI 3U83A 3NFPA 1CGYA 1TZGH 1IC1A 3BD5A 4BELD 3AS1A 1OP3K 4PJHB 1RZ8B 1BZ9A 2DBJA 3RIFF 3OF6D 3LKQA 1XF4A 2AAVA 5C2BL 5JNYB 1OAYL 4HV8B 2QTEA 2YS4A 4U3XA 5AYUH 1S78D 1U8KA 4MWFB 4R0LB 4RFEA 3RWCA 5FO8A 1JZ5A 1ADQH 3NPZB 5TQ2L 1IC4H 1HN1A 5J0BA 4OUUB 1KEGL 5DURD 3RBGA 1CLZH 3AY4C 3MJ6A 2FIKA 4P2RB 4RAVA 3K7UA 4HAGA 3UJIH 1JGUL 2GITB 5DVNA 4Y2DA 1URLA 1UM6H 1UM5L 3HUJA 5AG9A 1OTTD 3BQUB 3X3GH 2Y7QB 5BZDB 2H32A 4JRXA 2X9WA 1A3QA 1KENL 5FUZH 3BXNA 5ID0B 3SQOH 4N8VG 4UB0H 4MNQE 4HS8L 4ZUUA 4P57B 1LD9A 4XNYL 4CN6A 5JHDE 1DVFA 4QTHA 4XMLH 5DVLA 5CHNA 3RAJH 4HC1A 4X4ZA 5CEZE 4UILL 1FVDB 1KLUB 3FRUB 2R8SL 3BN3B 2GEEA 2P1YA 4O51B 4OLXL 4V1DA 2DQJH 1J1OL 4JQXA 1MCDA 3H9HA 5FEBA 5F7DA 1EHLL 4NHUB 5MP6H 2EYRA 3MXVH 5C0RL 1RJCA 2NCMA 5E6IB 3RGVC 4ZFZA 1X7QA 1EZVX 1CZ8L 3KYMB 4KDVA 4YXHL 3UTZB 4D9LH 4UV7L 3TVMB 3I9GL 1Q8MA 5EZOL 3FMGH 4BFBD 3QHTC 3R8BB 4APQD 1OCWL 5D7LE 4XNZB 4XPGL 1YPZF 4PLKD 5CZXD 4ZTOL 4J8RA 3TNMA 5KVEL 5DRZB 1U2CA 1P7QD 1PVHA 4APQB 4L4VE 4ORGA 3CUPA 4NC1E 1LP9E 1OD7A 3S5LG 1RZFH 4ODSH 4QGYA 3L1OL 2A6JB 3Q48A 1P4BL 1PZ5B 1J1PH 1VFMA 1J8HB 4OZFA 4KI5F 4E0RB 3KR3H 4JG0L 4X6FA 1I3VA 1P7QB 1HYSC 3RX8A 5IB3B 4LNRA 1VGKA 2W38A 3P9WB 4QRRD 1C16B 1B6DA 1HHIA 1E4KA 4OM1L 4WUUD 1WV7T 3WFEL 3OMZA 4ZOEA 1BZ7A 5HHME 1CDGA 4HXAL 4ZD3L 3FFCE 3RI5F 5FYKH 3BGAA 3MRDA 3C6LC 1CCZA 5E95B 1SJHA 1TMCB 4QRRB 1U95A 2NY6D 4JZNA 3EHBC 4R6UA 2EO1A 1YEGH 4OGXH 1K6QL 3MUHL 4HKZB 3VFPB 4F7PB 4WUUB 1CL7H 3OAYH 5C07E 1FIGH 1U3HD 2R23B 1YY9D 4OLZL 2IBZY 1ZHLB 4EZMA 3OKKA 5EZLA 2DQHH 2Y07H 3GUTA 2NY6B 1XFPA 5DUMH 2MQ0A 4WCYL 3BHBA 3DUSB 4JPVL 4LHUD 4KK5C 5JQHC 4MJIA 2HN7A 4NN7C 4UTBH 1U3HB 4YWGH 1OGTB 4PRPA 4ZUWB 1RI8A 3GSVB 4XNUH 4H0HB 1YEEL 5DK0A 1J9CT 3BP7B 3GBML 5MERA 3KWWB 3PWNA 4LHUB 4CL7A 1N5AA 2ZP0T 3NIGF 4L4JA 3UO1L 4ONFH 2YR3A 3B8SA 1EXUB 1NCUA 3WFCH 3EUUA 4HXBL 1UC6A 2CUIA 4FS0A 1N6QH 4IDJH 3RL2B 1R5WB 3VFTB 2OR7A 5MHSE 2J4WH 2EECA 4UAOB 3PIQA 4XXCA 4PP2B 5DT1H 5LCVH 1RURL 3HLAA 3X13B 4NKMA 4EQ3A 4NCDA 2F19H 4PJFB 1FE8H 5DEZA 1RK0A 2F5BH 2WINB 1XF5B 4MCZA 4XBGB 1R0AL 5D7SH 2GK0B 3GGWB 3DV4A 4M1GH 2IPUK 4WFHD 1MCBA 3BT2H 3P4OA 5B8CC 1SBBA 2B2XL 4AYFA 2RCSL 4OCNC 3DO7A 2XA3A 4CN1A 3MNZA 4JM2B 2C1PA 2ICES 2OK0H 3DGGB 3L5JA 3D39E 4DKFH 3C2AH 4WHCA 3GSOB 1XR8A 1KIQA 1FAIL 3FB8A 5BV7L 1PKQA 3FO1A 5HI5C 4Y19D 4NGHH 4H8WL 4JFHE 3LKSA 4XVTL 1LO2H 3RDTA 2OI9A 1WFUA 3WIHH 2R1XA 1XGQA 2X05A 1HSAB 5IFAH 2NTFB 4NQVB 1KCLA 3U4AA 4LLAA 1N6UA 1D9KC 1F4YH 4TUJB 3SDAC 4M8VA 4KY1H 3U4BL 3FTGB 1QG3A 5IB5A 2IPKA 6CGTA 1PGRB 3B9KB 3K2UH 3MQIA 5KSAA 1G7MB 5JIHA 3KHQA 3CU1A 2DQUL 2VE6A 3HNVH 3V0AC 4P2OC 4N8PA 4TRPH 3OKLA 1MPAH 4NRYA 4QYOA 1T1WB 4TSCH 2DQEL 1LWRA 3MLUL 3V79C 5EBMA 4Y4FD 5IM7B 4OBSA 3U9UB 3S6CA 1I3RB 3OKMB 5IMOB 1RUPL 1CXEA 2IG2H 3DETC 2IPTL 4YHIB 5F7LB 4CKVX 3BVNA 1UACH 3P2TA 1A4JB 4P48A 1JNNL 3HUJF 4QRQA 4Y4FB 5ICYA 2GY5A 2GTZB 5DK3A 1JV5B 4K07A 3OAYK 4X6CB 4C55A 3MJ8A 1DSFL 2CJUH 4FFVC 3LY6A 4MQSB 5KOVC 3HB3D 1REIA 4MJ5A 4LCUA 5EC1A 4Z9KB 4TVPE 2WIMA 3QDGA 5EU5B 1U3YA 4TOYH 3GMPA 4J3VA 4F7MB 3V4PL 1MEXH 4I2XE 4YNYA 3KYNB 1S7WA 1IQDA 1IMHC 4S2SA 4WI2A 4BKLA 3VFVA 4PRDB 5J9PA 3QO0A 2IMMA 5IKCA 1MWAL 3PJSA 3AS2A 3SJVB 4TUKH 5CJ5A 4WENB 2YWYA 1IGTA 2AJUL 3O2WL 2X4NB 1J0YA 3JTTB 3MROA 4BA8A 3F58L 2KH2B 4XCCH 3I50H 4RDQF 2GSIA 4PJDA 3CK0H 3FT3A 5FHBL 4P2QD 1AHWC 4NRXB 1EFXD 4U7MA 1Z9OA 4QRSB 5KAQF 3BIKA 1NMBH 2NY3C 3FJTA 4XVSH 1C5CL 3QXAA 4XMKH 2IANB 3B9AA 5GS1B 1CG9B 1S8DB 2FZ3A 1LNUB 4HCRL 4LQFH 4WWKC 1FZJA 5CILL 3PQYE 4BSVB 4R4FL 4G6ML 4LCWA 3W0WD 3DMMA 4FFWC 3CDFA 1UQSA 4OCMC 1EFXB 4U1IA 3EO1B 3MLRL 4MB3A 5BVPL 1ZGLP 2EIDA 4K7PH 5EOQL 5GJTH 2OCFD 4XP5L 3QO1B 1JPGB 3LHPH 4I3SH 4RMQA 1JWSA 3IVKB 2AQ2A 3MCKB 4X4YA 2CO7B 3I6LE 4KQ3L 5E7FA 1ZWIA 4IRJA 5HHVH 2FH8A 3BGFC 5F7FA 4XBEL 4F7EB 3O3BB 1F3DJ 3AUVA 1WBXA 3E2HC 4NZUL 5A1AA 5KJRL 3MGAA 4CMMB 8FABB 3LOWA 3M1BA 5CSBA 2WWKO 1K8IB 4F9LC 3AREA 2VLLB 1WC7B 4G6AC 1G6RB 3S97C 4DAGL 4QGTA 3BKMH 2R4RL 3ULVF 3WNMA 5EOCH 4KXZH 1P7KB 1QFWH 4KU1A 4J23A 4QCIB 2VISA 1CQKA 1NGPL 2VSCA 2DM2A 3QIUD 5DHYA 4JO2H 1PAMA 4R97C 5KVGH 1J0IA 1F58L 5JDSA 5HVHC 5KANI 5ICZA 5JUEL 1B2WH 3NCEB 1NC4D 1N64H 1JFQH 4MAYA 4XPBL 4YPGA 4PV8B 3HC0B 1JNLH 1CD1B 3QIUB 3G6AA 3ULUE 1AXTH 5IB1B 3SKMB 1Q72H 3U30C 4P23C 4I1NB 2WNGA 5I17B 3LB6C 3B9EA 1EEYA 2P5EA 2WLYA 1MCOL 2O5YL 3UTQB 4MNQD 1GXEA 2ICWB 3WNKA 4EN3D 4U1NA 3V6OA 5CEZD 4RFNC 1ZS8A 4M43L 4LARL 1N59A 5IP4A 1QYGH 3QNYA 4XGZB 4NWUH 1JF1B 3L5XL 3QUYD 1JGDA 1G6VK 4MNQB 1A7QL 2LQRA 4EN3B 5JHDB 3GB7A 2A77L 5KVFH 3MRPB 1LE5A 5ESVB 3D9AH 3SDCA 4DUWA 4G8GE 5E8PA 2AJ3B 2GTWB 5I8CB 5DMGC 3TP4A 4NP4L 4YDLB 3V0VB 1S7SB 4X6DA 5KSVA 3WHXA 3QYCA 1H9VA 4FQXA 1S7TA 5I30H 1NC2A 1Q94A 3CLEH 3MLPA 1YUHB 1SVCP 4NO0D 1KELL 5JR1L 4M1CD 1I1FA 3TZVD 5DZOA 1T1YA 3EKCA 1UZ8B 2EYTB 4BK4A 1MCRA 2GAZB 2PR4L 2UV3A 3HPJA 4Y16D 2NW3B 4FZ8H 3KPQB 1UCBH 1I9EA 4NC0B 4L4VD 5D7LB 4Q9RH 5AEAA 4QHUA 3EYSH 5TH2A 3WIIH 2R1YB 5D96B 5MI0C 1HIMH 3MUZ1 4WU7A 1UG9A 1KJ2A 4EUPA 3DUUA 3GK8L 5D1XD 4YHNB 5BRZE 5L88H 5LQBH 2NXYD 3HNTH 5KVDL 4L4VB 3QEGL 3S9DB 3O45B 1LP9B 3VFOA 1F3DH 4ZO9A 4NM4H 2ATKA 4WW2F 2J5LB 3O3DA 4MDIB 3QHFL 3ZE1E 4XP1H 3IDJB 5HHMD 1SVZA 3FFCD 5D1XB 1IJ9A 2DN7A 4MX7A 4H1LA 2NXYB 3K81A 1T5WA 1AR1C 1FNEA 1VFOA 1OSPL 2H6PB 2I26N 3BPCB 4XNMB 4AMKL 1GPOL 1I1AD 1MWAA 4OD3L 2R69L 3MRLA 3GBNH 1QBBA 2AV7B 2DRUA 2DQFA 3DVNA 3H9SA 3IFPA 5C07D 2B4CC 5HHMB 2VIRB 3LKOA 3BPNB 3FFCB 2VLRE 1HQ4B 1L7IL 5GRYA 1IC5L 5T3XH 5FYJL 5I1CL 2Z91B 4P4KD 3V6ZA 2VH5L 5I1GH 1MUJA 4PJGF 2XNAA 4XCEA 5E5MB 3ROOB 3I84A 4JFZH 3VW3H 2WBJD 3LS4L 4R0LC 4QHNB 4FNLH 1VGEH 1Z3GH 1A7PH 4P4KB 3D18A 2W1NA 3VD9A 5HHNB 3MLTB 3O3UN 4L8SA 4N8CH 5JXEA 2JELL 2VLJE 3ALWA 3CFDB 3Q5TA 1S78C 4MQ7A 4R7NB 1LK2A 4GO6B 4P3CH 5DVOA 4ALAH 1MFBL 1MFEL 4JFDA 5MHSD 4JB9L 1N0XH 3GMLA 2OJZL 3DJ9A 4PJDF 3VRIB 3T4AA 4IRZL 4PP1D 1H15B 4LDLB 3MLXL 3CCHB 1XT5A 1G7HA 1GC1C 2VUYA 1I8LC 2C4FT 3WHE0 1K4CB 2X7LA 1OTTC 1GOFA 2FBJH 2Z31A 4TNWK 4KAQL 4NQXB 4X8JA 4FA8A 2G9HB 3GMMA 1R3IH 3BRDA 2VAAA 4RCAA 1Y6NR 4HWEL 4QXUL 3F7VB 1RJLA 5FO9B 2HFGL 3MCLH 3MV9A 1D7FA 4Q2ZA 3WE6B 4JFHD 2NY7H 2WM0A 1WVZA 2V7HA 3VFRB 4ZS7H 4YX2H 4TQEL 3U36B 3D39B 5CWSA 4ZTPL 1WCQA 4HJJH 2ZCHL 4HWZB 3TN0A 4IS6B 1TTFA 2EE6A 3AGVA 2D7NA 1EJOH 3NCCB 1HSBA 5C1MB 5IWLC 4G43B 1QFPA 4Z76A 4OM0L 4CMHB 1AQDB 4APQC 4JN2B 3CD4A 2WK2A 3STBA 2DLFL 1I4FB 3GI8L 3VRJA 4Z7OE 4DTGL 1MCFA 3NFNB 4M7LL 4PLKC 5CZXC 4M62L 1YMME 3HG1E 2XFXA 3BP6B 4ZUVB 2DOCA 3HRZA 5SWQA 4MA7H 1TNMA 2PXYD 3CXHJ 5IQ7H 1K2DB 2VXQL 5DFWH 2W91A 1FN4A 1MRDH 1JI1A 2ZUTA 2R0LL 4OZIA 3CLFH 3QUXA 4XNQA 1I7RA 2KUTA 3QQ3B 5FM5M 3BI9X 5HGHB 1A9EA 1FPTH 5E6ZA 4LSVL 4H5SB 4LLQA 1OWRM 4K3GA 3QDJE 4Z7VE 4OZGA 3KPNB 5M7QA 4DKEL 1A6ZB 4ONGH 5EIIA 1Y0LA 4WGWB 4QRTB 4TVPD 4OIIL 4U7SA 3BH8A 5JOPD 4NUGH 5BS0A 2B1HL 2NY6C 5DQJA 2BNQE 3HI6H 4OI7A 4HAFA 4P9HC 2P44B 4P3WA 1U3HC 1UWEH 1YY9C 3SCMD 5T3ZE 4G7YL 2VDKH 4HG4K 1ACYH 4PJ8D 4U2ZA 4N5ED 3T0XA 4O4YH 5DJAA 3DI3B 4JQIH 1HHGB 1MCJA 2BCKB 2XICA 1C5DA 2YK1L 32C2B 4I2XB 2MQ3A 5J6HB 1UEYA 5GRVL 1OT2A 1WICA 3SCMB 5F9WB 3TESA 1HQRB 3ECBB 2Q7YA 4K3HA 2YMXH 4PJ8B 1R5VB 1O0VA 2FJGA 3CSBA 4G42A 3UMTA 5JA8B 2R39A 3TJEL 1KIRA 5BXFA 4UAOC 4KHTL 5DHVA 5IF0A 2FX7H 4AIZB 1ONQB 1ZHBA 1KIPB 5T5FH 3PQYD 1BEYL 1CICA 3M45A 2P7TA 4YDIH 4K8RD 2WP3O 5GGTA 1VEPA 3QPQD 4Z8FH 4B53A 4ODUB 2XXCB 1NDMB 3LDBB 1R5IA 3CVIL 1J0ZA 4QNPE 1YJDH 1I7TB 1ZT1A 5TE4H 1U8JB 3C60A 5EG6C 1NEUA 3IU4H 4HIEA 4XC1H 5TDNA 1X6LA 3FAXA 2F54A 4LRIC 3FB7B 3PQYB 4GXUN 3CFCL 3FRPG 3OHXA 1KCUH 4HT1H 3MRFA 1UFUA 2X44D 3I6LD 3VI4E 5JOEA 2Z8VC 2VJXA 1Q9KB 4FMKA 5DI8B 4M6OL 4PREB 5EBLA 1JYNA 4NO3B 1P4LB 4YIQA 3V4VL 5FKPA 4OCXH 4F58L 1UB6B 3CFKB 3KPPA 4ZXBB 4F57L 4L8CB 1IM9B 4YFDB 3RZCD 3DXAA 3L5HA 3L6FA 4LSDA 4HGKC 3S3SA 1YYML 4NRZB 4UT6L 3K8LA 1IL1A 3GMQA 1CDUA 1QA9B 1A6UH 3DARA 4NNYB 3EJZD 2H9GA 3UROR 1NANI 1Q1JH 1T22B 3MRKB 3C6SB 2DQGH 1BF8A 1RVFL 5DC0A 3RZCB 4LLMA 3PNWB 3V6BR 2OL3H 3VXTA 3PXJA 1A1NA 3FO9B 5C0ND 3UC0H 1FVCA 1SJVA 3VCLA 1KPVA 5C0AE 4JZJB 1CBVH 5EZIH 4KMTL 1KC5H 2ICCA 3QISA 5T1LA 1F6AB 1P2CB 2EYSB 3N1FC 4XI5D 3KGRA 5ADOL 4YHKH 5DMJB 3A6BL 4PGEB 5FUCE 4LVHC 3U0TA 2VB5A 4Y4FC 2M8XA 4P49A 3RWJA 2IEPA 5ESAB 2BC4B 3MCG1 5JA9A 3HNSH 2V7NB 4W4OC 4KGLA 2OXGA 1GOGA 3O2DL 2B4CL 4MS8D 3KYAA 1D5IL 5E94B 2YKLL 3MRGB 3X3FL 5DMKB 2QSQA 1AO7A 4A6YL 1HXMA 1AH1A 2HT4D 4AL8L 1WBYB 4JDTH 3IKCA 4PRIA 1TCRB 4Z0BL 4XVJL 4EOWH 3GJFA 4J3OC 1CXKA 1CTOA 1FDLH 4LSQH 1XGYH 3HB3C 3MMEB 1AP2B 1RZJC 2R2EB 4E42A 4G8GD 1EHAA 4ZPVA 2DM3A 5E8NB 5HHPA 3MRNA 4KHXH 5ETUA 5E2UL 5IV2A 5TPWL 3I02A 3NTCH 4KDTC 1Q0XH 1OTSC 4IRSD 3U7AA 3ZYJA 4G6KL 4RFOL 2APVA 1H3WM 4PGBB 3HZYA 4MD0A 4G8GB 1NAMB 1JPFB 3L3IA 4D0BA 3OXSA 4Z7NF 1QSFD 4KUCF 1CXLA 2ZUVA 3BYYA 1MCWM 2BRQA 2MPAH 1OAKL 3BKCH 4IRSB 1M7DA 4OFKA 4ZSOA 5HSFA 3JWNC 4D0DB 5F9DC 3CFJB 1UJ3A 5I1AB 2ADGB 4R2GD 5BQ7A 2CK2A 3T0EE 4WV1A 3VH8B 5HGAA 4LKXB 4LHUG 4YDVB 2BJMH 3MNVA 2BOBB 4KFZC 1KLGB 4E41E 3Q2CA 1KN4L 1KJ3H 4XPAH 4R2GB 1JWMA 3LKNB 5CEXB 5BRZB 2X70B 2ZCLL 1CFTB 2IGFL 4P3DA 5SWSD 5KW9H 2AK1L 4X4XB 1AIFA 1SM3L 2GJZB 2HLAA 4BZYA 1IKFH 1RHHB 1QSED 3N1PC 1H3UA 2VLRD 4FQIL 5EU3A 2UZIL 2ADJA 3FQRB 4WHTA 2DLEA 4M6NH 1AD9B 5DD0L 4JFEE 4NNPH 1IEBA 2J1KA 4JR9L 1MAJA 2E7CA 3MRRB 2VDRL 2VLRB 3LN4A 4LL9A 1HKLH 2JJWA 2APTA 3C5SA 1D5ZA 4OCRL 4G59A 1N3NA 2LU3A 3S8WA 4PRNB 5HPMB 1NLBL 3SE4C 1G7PB 1H3GA 1FGNH 1IC4L 3QIUC 2EICA 4ODWB 2VLJD 5JZ7D 4WI3A 2OZ4A 1E27A 2KQNA 2XOTA 1MREH 2J6EL 5HGBB 3T8XB 3MOBH 1UM6L 3G9VA 2CUHA 4IJ3C 3LIZH 2P8LA 5BJTA 4XHQA 5J06A 2HT3D 1JPTL 2VLJB 2K7PA 4TSAL 3MOAL 5L0QB 3B5TA 2G2RB 3BWAA 2AJXL 4U05A 1NUGA 3SQOL 3P9MA 2EDFA 3IF1B 1I9IL 5IOPA 4G8IA 5HYQA 5D9SB 3LSOB 4RQQB 4CVXB 4KK9C 2C3WA 4NJAL 4XAKE 3GSRA 4EN3C 4AM0B 1T04B 2EDTA 2FRGP 1A1OB 4F9PC 3MGTB 1AGCA 1FZMA 2D03H 1ED3B 1IAKB 1OW0C 3ALPA 3BGMB 5MP6L 1JHLH 3MXVL 5KG9B 4OCLC 4LDEB 3BDBA 1BF2A 3QUYC 2DDQH 3QDAA 2JKXA 1XCTA 1U58A 2CD0A 4KI5E 4NKOA 4Y4KA 4D9LL 1XF2B 4O2EA 3ARBA 4L5FH 5EZJA 5JPNB 5IVXF 3SO3B 1YEHH 4NHCH 3TIDB 4I4WA 4U6YB 1FO0L 5TF1L 1GZQB 4JFXB 4JO4L 1IRAY 3V5DB 2FJHB 5IR1A 1BGXH 3Q6FA 2MWCA 5DQ9B 1T66D 2VDPL 3EOAB 3RUGE 4PJBA 4WFFE 5D1QD 4P46A 3TH4T 5CBAA 5MEPA 1YN7B 3IDXH 5D96C 5DFTA 1YMMD 2EKJA 3HG1D 3OB8A 1RZFL 4M1CC 2OTWA 3TZVC 3V4UH 4NUJB 2DQCH 1N7MH 1QLFA 2YD6A 2YPLE 4Y16C 3O2DA 1HDMA 4F7TB 3HAEA 1Z9LA 4PGDA 5D1QB 2AERT 5D6CA 1A6VL 4A6YA 2J5LC 3TYFA 1IAIH 3IGAA 1IGIH 1YMMB 3HG1B 5LBSH 2AS5M 1XF1A 3V95A 4WU5B 2BNUA 5CD5D 4NM8H 1Z6JT 1SY6L 3I75A 5D1XC 5AZEL 2OQJA 1TITA 2NXYC 5CSGA 3OZ9H 3KLHD 2VLME 3QDJD 2ITDA 5F1OB 4OF6A 5FYKL 5L8KB 4KZEH 4DOHE 3IFOB 2WAHA 5CKGA 4RNRA 1DQQA 1FFOA 5DXWA 3FHQA 5D71H 3CFEB 4X7EC 1T1XB 4L9LB 4OGXL 3CFBA 2D9QB 1CL7L 3GSWA 5DJ0B 2HFFA 1F13A 2V5TA 3MRMA 3QDJB 5C0BA 1XIWA 4Z7VB 4XVUD 2V17H 2DQHL 3E3QA 1I1AC 3BPOB 1G0YR 3C5ZB 3SGDH 5F72S 1ITBB 2IH1B 3OAUH 3AS0A 5T3ZD 4JPIB 4HK3N 4HFWB 1RZGA 2I07B 4M5YH 3DX8B 3RNKB 1J86A 4P4KC 2BNQB 4NOFA 3M07A 5M95B 1INDH 4KVCH 5CP3H 1M4KA 3HPLB 4L8DB 3DX6A 1CFNA 3WFBL 2WBJC 4M02A 4ONFL 3TA3A 4G5ZH 3WFCL 4KV5F 5AAMA 2WMPA 1DLHA 1N4XL 4ZOAA 1N6QL 1WTGT 3AC0A 4GLRI 4IDJL 4D0CB 3K4ZA 1U8LB 5DT1L 1T83A 3BYTA 3C08H 4MXWH 4WHYH 3CVHH 1R3LB 1JFMA 3BKJH 2KPNA 5LCVL 3QFJB 5E70A 5E8DL 1FE8L 1D5MB 2CLRA 2F5BL 1LEIA 5DF0A 1J87A 3MTRA 3QEQA 3NCJH 4PP1C 1T0MB 2HT2D 4M7ZC 2UWEE 1P84K 1DL7L 1JE6A 1JPSH 4BZ2H 3MJ7B 3O11A 5HXMA 3VI3E 1RZJL 4OQTH 4HLJA 2HJFB 3NA9H 3C2AL 4PG2A 5FDWA 5DJ8B 1VHPA 5A2IH 4EKXA 1IEAB 2F53E 1BAFL 5IW6A 5DJDA 4XXDA 4NGHL 1QHOA 3PDDA 3V9FA 4OLYH 2YN5A 1LO2L 3OX8A 4X5XB 1ADQA 4O00A 5GRJH 1QO3B 1MRCH 2B1AL 3ZKMD 4MSWA 1BFOA 3JV0A 2VDQH 5TJWK 4C83A 1T7YA 5E9DA 4ISVA 4CMHC 3ZL4H 3R1GH 3D2UD 3QQ9D 3B8YA 4XZUA 3VG9B 1VPOH 2VDOH 4BFGA 1BZQK 1DUYB 4I0CC 5I66B 2Z92A 5H35A 1TQCC 3K2UL 1A6WL 3HNVL 1FFNB 1P9MA 2N1KA 4ZFOL 5SWZA 3ZDYF 1C1EH 1FORH 4LGSB 4QT5B 4TRPL 1MPAL 2O26U 3D2UB 5FO7B 3S4SB 4MVBD 5ADPH 1QVOA 4I18B 1QZ1A 4H20H 4X6EA 3P9LB 5HYJA 4JZOA 1FYTD 4YHPA 5MENA 4Q9QL 4Z77A 1JZ7A 3G5YB 3KNBA 1IGYA 3T08A 3T65A 4V1DE 4OCWL 5C0AB 4R8WH 1WWCA 1Q0YH 3QPXH 5HD8D 2PXYC 1JP5A 3GO1L 1CXIA 5CKAA 1IVLA 1CS6A 1A6TB 4N0FA 3KJ6L 4IMKC 2QQLH 1NFDF 1NDGB 4MD5B 4J3SA 4C56A 3VFMA 4YQXH 4ZDHB 3F6IA 3H7BA 2X4OA 4I48B 5KTEH 3D0VB 4DKAA 4HPYH 4K7FB 2CDEA 3S37L 2W60B 4D3CL 2ICWJ 1KSRA 3MA9L 5LGJB 4PYHA 2A38A 3IU3B 1GGUA 4FQCH 5ESQB 2PO6D 2F5AH 2ZOKA 5DDHB 3DVIA 4M7KH 2PYEE 5AUMA 4QY8B 1JNHA 1NJ9B 4NQCD 1HXYA 4XCYA 1QEWA 5IEKA 3SCMC 5ERWA 4HUWA 4MHHG 5D1ZD 1EEUA 5IG7B 5F9WC 3WYRA 1F5WA 4OI9A 4PJ8C 3ARVA 4N0UA 4N5EC 5JPMA 1ZV5A 2IH3B 3I50L 3HC3H 5H94A 2EXYD 4CUCA 4KQ4H 2YZ1A 4LDOB 5GZOD 4UT9L 4LVOB 3RVTD 1NMBL 5D1ZB 4NN5B 4BH8B 1S5IH 3M8OH 4XMKL 5GGUA 3H0TB 3T0ED 5AD0B 5SX4H 1EGJH 3EYVA 3LDBC 1BLNB 5L7XH 1AFVL 4LBEA 5E2TL 1S7RA 4HKXA 3VDAA 2PTVA 2XTJE 2H41A 3PDOB 2CMRH 4PS4H 4E41D 2B39A 1A7RH 4IIQB 5I74B 1T80A 5CEZL 3A6CH 4K8RC 3T0EB 3QPQC 2A1WH 2XT1B 5GJTL 4X99A 1B0RA 5DJYA 1GZPA 2AP2A 4LF3B 3G04A 5F9OH 3DBXA 4Y89A 2W65A 2JK5A 4K94C 4Q9CA 1CYGA 2W92A 1EJ6A 5HHVL 4E41B 2DQDL 2DIAA 5I1JH 1X5JA 1FLRH 4PRPE 7FABH 5LG1A 3KLAA 1G6RH 3WL9B 3CIQA 2WIIA 4N0YL 1LO0H 2X89D 4GW5B 3VFWA 1O7SA 5DS8B 5FHAL 4U31A 3VGDA 3LN5A 1DZBA 3VXMA 5I16A 3DLQR 4DGVL 3BKML 2AQ1A 4JFED 4PTTA 1IGCH 5EOCL 4Z7WF 4X8XA 3NZ8A 4XWGL 3QBTB 4XRCA 3B2UD 1QFWL 2ZSVB 3EO0A 3MBED 2R9HD 5DMIH 4KPHH 3RZCC 1MFAL 3BPLB 4H88H 4V3DB 1F11A 1S9WA 1JRHH 4JCLA 3HE6B 2QSCH 4JFEB 4OZHA 4PJ7A 1BOGB 3OKEA 1X3DA 3QWOB 3EJZC 1B2WL 4FQHA 3W11D 1YEKL 4Y5XB 2OSLA 4HH9A 1JNLL 2VNCA 2JJSC 1R3HB 1AXTL 2DQIH 3CSPA 1CFSA 1GGIL 2BVQB 1MI5A 4M93C 3QJFB 2DL2A 5C0NC 3ZE0E 5F1IB 4XP6L 1AGFB 2ARJB 4KC3B 5TGBB 4Y8AA 5DD3H 2WP3T 2C1OB 1B4RA 1KG0B 1PFCA 2XWJA 2HVKA 2FD6L 4XI5C 3X14A 3FN9A 3N06B 4PGCA 2GY7B 4P5KB 1E6OL 1AR2A 1PKQE 2HG5A 3GJEB 3V7AG 3QSKB 2EIBA 3WIHA 1YNKL 1RIHH 1U41A 4TTDD 4ZUSA 1P5UA 1F02I 2ZCKH 1WGOA 4MS8C 4M4PA 5DRWA 5KVFL 4KGJA 3C9NB 3SPVA 3ZTNH 1JGEB 4LPCA 4NYLB 2HT4C 2ZNXA 1HH9B 4N8VA 1RFDH 1HZHH 1JYXA 4BH7B 1S9YA 4KI5D 3ARDA 4UQ2A 3WMSA 3FOLA 3QEHB 4MJ4A 4Z6AT 4OLWL 1UXSA 4UDUA 3QIWA 4QTIL 3O9WA 1H3VA 3KPLB 1C8PA 5I30L 1JWUB 3WDHA 3PABA 2QQQA 1CIDA 1F97A 5C0IB 3TH3T 4IRSC 4GRMB 4ZOCA 2ATPB 2YXMA 2UY6A 4JFQA 4LEOB 2HKHL 4M8QA 3M17B 3BP5B 5K93A 1Y18A 2FNBA 1V7MH 5F3BA 3EYSL 3WIIL 4ONOA 1P6FA 3P4MB 2YPLD 1JN6A 1HIML 3B3IB 5C08D 4CNIB 5JW5B 4K7PX 3RUGB 1CXHA 1FFPB 4EDWL 5L88L 1DBAL 3U7YL 3HNTL 3B9VA 1OT1A 3PL6A 4HS3B 4LLYB 4KK8D 3TIEB 4R2GC 1XR9A 4U6XA 3R06A 2YPLB 3FB6A 3L3KB 4KZDL 2VLMD 1MJUL 2IQAA 4ZO8A 4NNXB 2OM5A 4U6HB 4M5ZH 4IMLB 3REWA 5EOTA 2GHWB 3B6SB 3ARFA 5E6YA 5DJZB 1FV1B 2AEQH 1IM3B 5DGRA 5E4IA 4DZBA 3GBNL 4U3CA 4MMZC 1YZZA 1A2YA 2AK4D 4W6WB 4B7LA 5T1KA 1R24B 4FFZH 1TZIA 4DOHB 3OSKA 2YRLA 3D3VA 5I1GL 1MLBA 5T1DH 1KFAH 5D7IA 1TENA 3AROA 4ZO7A 2QQNH 3VWJA 4L3CB 3VW3L 3JV4A 4J1UA 1YEIL 3P40A 2W0FA 1I9JH 1Z3GL 2CGRH 2ICEB 1ZVSB 3EO9H 4X7SL 4N8CL 3OXRA 3SGJC 3C8KA 3F12B 4LCYA 3F7QA 2XPGA 2G60H 5JW4N 2XWBB 1JF5A 5GHWL 3VWKA 3LD8B 4P3CL 3KYOA 5EN2B 3ME0A 1N0XL 4P4RB 4YHZH 3V52L 1ODAA 5JZ7C 4GKNA 2MHAA 4GAGL 3MRIA 3TH2T 1MJJB 5L0QC 5I2IA 4K55A 4I0PA 5I8EA 5JHLL 4MCYB 3RWFB 3MV8D 2JJTA 5FV2A 3FFDA 1KTRL 4IEFB 3QUKA 1MFCH 2HT3C 3TWCL 4D9RE 5CD3A 4OGZA 1SYVA 3EFDH 5IVNA 3QEUB 3BMVA 5IIEB 1YEFH 1R3IL 2KL6A 4J3UA 2UWEB 1JYWA 4LU5L 4LSSH 4XWOD 2K7QA 4HQQH 4LRNH 5FKAB 1UH2A 4ZS7L 3MYZA 1FGVH 3NFPB 4HJJL 3TGXA 3WJLA 1OB1A 4EI6A 1BBJB 4F7CA 4POUB 2F53B 4BZ1L 3SOBL 3LKQB 4RMVA 4Y2DD 1HINL 1U8KB 4GBXA 4OB5L 3SGKC 5JORA 4X98B 3RWCB 3IAGC 5ALBH 5BMFL 1YDPB 4JRXD 2P5EE 4X7TA 3OGCB 2FIKB 12E8H 4RAVB 4XCNA 3SDDA 4NCC1 4OZ4A 1T66C 1DVFD 2YD7A 4P9ML 3VMOA 5KSBF 3BD4A 5D1QC 2E7LC 3V6OE 4JHZA 1AI1L 4PJ7F 3QCUH 4IDLA 2H32B 4JGJA 3OG4B 5EUKA 2APWA 4V1DD 4K9EC 2O5XL 1Y6MR 3HE7A 1LD9B 3L95A 3C5JB 1DVFB 3FN0H 4K94L 2J3SA 3SY0A 3LKRA 1VACA 2RJMA 3N50A 3VH8G 2V2WA 5CD5C 2VITA 3H3PH 4V1DB 2N7AA 4ZFGH 5K9OB 4NZRH 3TO2A 1RZKC 4ONGL 3KLHC 1N8ZA 5CINH 5LGKA 5F7DB 3TBTB 4X6DE 5FYLD 1HHKA 3DOSA 5DJ6A 1I7UA 3DX9B 3BPOC 1T5XB 3C5ZC 1S9XA 4NUGL 2Q3AA 4Z95L 1LHZA 3OPZL 2OR8A 1X7QB 3LAFA 5T5NG 2KQMA 4KJPD 1RU9H 3DI2B 3VGAB 4UIKL 2Q3ZA 1OGAE 3QB7C 1ACYL 4HDIA 3QH3A 1VA9A 4XVUC 2FX9L 4Z7UA 1JHKL 2CLZA 1PZUB 4N9GA 1S3KL 5A40E 4W4NA 2RBLA 4J8RB 4Y5VC 2XQBH 1T03L 1FL5B 1P1ZB 4K3DL 1T1ZB 4IHOB 5I18L 2NY2B 5F1KC 3DX7B 15C8L 3CUPB 1U3ZA 3ZTJG 1YQVL 5GISH 5C0EB 3S3PA 4HK0B 2PYEB 4DQOH 3QT2A 4UNUA 2YUZA 4TPRL 2BVTA 3MLYH 3TBWA 1Q9OA 1WBZA 4GOSA 2ZG2A 3MLZH 3NN8A 2VO5A 3O41B 1NKRA 4LNRB 1VGKB 1E4WL 2I9LA 5T5FL 2XV6B 3KPRA 4GQPH 4ELKA 4Z8FL 1MHPH 1HHIB 1YJDL 5HHXL 2AJYL 3H9SE 4S1RH 3ULVD 1BZ7B 5C09E 5TE6L 3GHEH 1KPUB 5JLZA 2X9YA 3UBXB 3MRDB 1BFVH 3K74B 4RWYH 1U95B 2HT2C 4X5WA 4JZNB 1KTDA 2XTJB 4MJID 5EU6A 5IJKC 3ESVF 4PRPD 1KCRH 1X5ZA 3OKKB 5EZLB 3MSPA 5TFSH 4OCXL 5ACZA 1NAML 3BX7C 3V6FA 5J1TC 1CLYH 1KEMH 3LN9A 3BHBB 3U6RA 3HZMB 2HA1A 4Q6IA 1HOCB 4AEIH 1FVEA 3VXRA 1ULVA 4PRPB 4HUKB 3T04D 4PGZA 2NMSA 1A6UL 1EMTL 5I1LB 5I15L 4NZDA 5DK0B 3ZKMC 3QULA 4DJMA 5I75C 2KDGA 5D7IF 1N5AB 5EPMA 4K71B 2OL3L 1D6VH 4YBLB 4I18C 3QQ9C 5K59F 3MRCB 1P4IH 2FDBP 4LFHD 5DJXA 4O02L 1C5BH 2Y5EA 3PIQB 3H42L 4U6TA 1V7NH 1YNLH 4NSKA 4RGMC 5DFVD 5JW3H 2GCYB 3OKDB 3ULUH 4MVBC 4C4KT 2DICA 1RK0B 2X42A 3REVA 5I71B 4FQ1H 1INQA 1FH5L 3FB5A 2F15A 3DV4B 4DGIH 3WUWA 3P4OB 3MJ9H 3HNSL 2ZUUA 3IJYB 1SEQH 3MV9E 3S35L 4LPYA 5FUCC 2P8PB 3RDTD 5HD8C 3MNZB 2C1PB 3FQTA 5IT2H 1OAUL 4XH2A 1XR8B 3TF7A 1KIQB 5F96H 4JDTL 3FB8B 5IFJA 1PKQB 3FO1B 1AGDA 4HUUA 2QEJA 3VGHA 4LSQL 1XGYL 3BIBX 2EZ0D 3BKYH 4DWHA 3RDTB 5J1SC 2XG4A 1DQML 1OF2A 2R1XB 1XGQB 4YHLL 1RK1A 3UDWC 3L7FA 4JRYA 4KHXL 1JGLH 5KSAD 3S34L 1BQLL 1BVZA 5J56B 5DZNA 3CC5A 2DBLL 3AMLA 1HNFA 3ZKND 2Y36L 3V5HA 4KWUA 1CLOH 4JFYA 2PO6C 3CFIC 4WO4A 1I3UA 2BOCB 4PJ5A 5IB5B 3QFDB 2IPKB 5MEOA 3PG2A 3T0WA 1NCWH 4OZIE 1QRKA 3L3JB 5D1ZC 3IJHA 3OKLB 4QYOB 1AD0A 4PG9B 4Q58C 2Y5TA 4AENA 3SBWC 4GAFB 5EBMB 2J12B 1LO3H 1FJ1B 1U8OA 2BFVH 1KTLB 2EXYC 5C7XL 1X5FA 4OZGE 3CSYA 5HI3D 4ZPTB 5C6TL 5GZOC 5FIEA 5J8OA 1HILA 3RVTC 5TDOB 5BW7A 1QRNE 4S1QH 5I74C 1IGJA 3T0EC 3QDGD 43CAA 4HF5H 1KJMB 3GEWB 5ICYB 1QOKA 4QHMA 4XPAL 1DBMH 3MJ8B 4KMQA 4TNWF 5E99H 2OP4L 4UDTA 2I9TB 4O9HH 3P0VL 4MJ5B 4LCUB 5E2VH 5EC1B 4KUZL 3IFLH 4MJ6B 2Z9TA 4RISH 1IKFL 1MJ7H 1NCTA 2ICWI 3MOQA 2W9EH 3VXUA 4YNYB 2C3GA 3ZTJH 1LK3H 2X1PA 1U93A 1IQDB 3Q5YA 3TCLA 1T4KA 3QO0B 4ODXA 4LAQH 3U7WH 4OLVH 1J05A 2VLKE 3TO4A 5C0GA 2HJLA 4LOUD 3HR5A 1IGML 2IWGA 1G7JA 3JVGA 1IGTB 1TQBC 3GDBA 3QI9A 4WTXA 1P53A 5DUPL 3OB0H 4FZEH 4LSPH 2BVOA 5FGBC 2WQ8A 3B2UC 4HMEA 1CDIA 2GSIB 4Z7UF 1FGNL 4HIIA 4FQLH 2AVGA 2R9HC 2IJ0C 4LCWD 3R8QA 1CFVH 3DMMD 2GJ6A 4OD2A 5F9JA 4K9EL 3UTSA 3QXAB 5ITBH 4WEBL 1BX2A 4WFGE 5IB4A 1SBSL 1MIML 3MZTA 4RSVA 5FYJE 3W11C 2J8UF 2FZ3B 4OFIA 2F54E 1FZJB 3BEVA 3LIZL 4RGOL 2HVJA 5B39B 3KLDA 4M48L 3DMMB 1UQSB 5KN5A 4UTAL 1JL8A 1BBDL 4IRJD 1RZKL 3S4SG 1FNHA 3GIZL 3WD5L 2IBZX 4CAGA 5F88A 3CX5K 4D9RD 4HS6A 5FUOL 2FJFA 5TF0A 3ESUF 1FZKA 2OJEA 1NPUA 4LHJB 5FOBA 3ARED 2QADB 1JWSB 3FN3A 4X4YB 3I2CH 3SE8H 5E2JA 3U2SA 1FL3A 5CZVH 3DXAE 1KB5L 1EZVY 1V5JA 4AH2B 3IAQA 1PG7L 2D03L 4V2BA 2P45B 5L2JA 3PXHA 4TTDC 3AREB 1EA9C 4W68A 2XZCL 4OV5A 4BSJA 2P46B 2OL3A 2D7OA 5HDQL 2NZ9D 2FBOJ 3N85H 5KOMC 3K4DA 3ARYA 4TULL 4MAYD 2VISB 4B0MM 4OLEA 1NGYB 4UOW0 4PJ9B 3RBSA 2IBGA 4M61A 4XT1C 4WW1A 4N0RA 5DHYB 4KI5C 2J88L 3GI9H 4HWUA 4GRLA 4LP5A 1TVHA 1MCLA 3CNKA 4AZ8A 1HI6A 5TE7H 5JDSB 4DZ8B 2P5ED 4NPYA 4JPKL 1U8IA 4YPGB 1XZ0B 3Q3GB 3V4UL 4AQOA 2DMCA 3G6AB 1N7ML 1NMCB 4YHOH 1I8IB 2ADFL 4X0KB 2VABA 3ZKQD 4GMSH 2R0KL 4K3EL 2P5EB 4X7FC 5C0FA 1IAIL 3DVFA 1C7SA 1RUKH 4KTDH 3HFMH 5EUOA 5ITFA 5HBBA 5LBSL 4MXVF 3O6ML 4FFYH 5BV7B 1TJGH 4NM8L 2DLHA 2NX5A 4LGPB 4PRIE 4U1NB 2NY1D 1U8HA 3OZ9L 3P0YL 4PJCA 5D6DC 5E56A 4J3XA 4Z18A 2EO9A 1KB9K 4KK8C 3SDCD 4HIHA 1Q9WA 3EDKA 3QNYB 4GG8B 2Q8AH 4X9GA 5D71L 5KS9F 3GB7B 4Z5RA 2Q8BH 2EIEA 2WY3A 4FQXD 4FHBD 1LE5B 3D87B 1NC2D 5D70H 3FO0L 5E8PB 1CK0H 1QBLH 4HFUL 2CIKB 3OB0K 1OAQL 2V6HA 2CLVA 4X6DB 4YLQT 5KSVB 3WHXB 4FQXB 4ZSOE 4M5YL 3VFSA 1Q94B 2XZQH 3ARSA 1T1YB 1T20A 3BDYH 4N1CA 4EI5A 1WZ1H 1OGAB 3G6JA 2BMKA 4JEGB 3GMRA 4G5ZL 4QHUB 5IMMB 4PV9B 4QXWA 3Q1SL 5TH2B 4HULB 4PR5A 1KJ2B 3DUUB 4J6RH 3CVHL 1T89A 3QIBA 4L8BB 3CZJA 3QUMH 2ATKB 1UCTA 1QFUH 3O3DB 5GS0D 5LWYL 2VWEE 3H9SD 1P69B 3GSNH 3TYGL 1OP9A 3O6LH 5ISZE 1ES0A 3OV6A 1DJSA 1PYWB 4QXTB 1AJ7L 1JPSL 1WWBX 3BZFB 4H1LB 1T5WB 4RBPH 4BZ2L 4ELMF 2WSKA 4YK4B 1FNEB 4F37K 1H8NA 3LZFH 4HEME 4OQTL 5JNYA 4H0GA 3WSQH 1MWAB 2C3XA 3MRLB 3B43A 3H9SB 2DQFB 3IFPB 5FFLA 4PPTA 4MWFA 4X9BA 2EDNA 5CJBA 5CUSL 5C09B 3LKOB 2Y1VA 1CF8L 4OUUA 3N9GL 3V0WH 4JFPA 1DN0B 3QQNA 4P2RA 3LPFA 3V6ZB 4OAWA 1MUJB 2XNAB 4XWOC 2WUBH 5JXED 4NZJA 3SGEH 3G6DL 3IXAB 3FKUS 1ZHNA 2EH7H 2ERJB 1MHHB 3BQUA 2Y7QA 5IGXH 1WTLA 3FRPA 4JFDD 4XC3H 2VZ1A 3D18B 2XQYG 4UOJA 5B38B 1KNOA 2VDOL 5ID0A 3PF2A 1PQZB 1W72L 4QRPB 4P5TA 1ROWA 3T3PE 2YPKA 2VN7A 4MQ7B 4Y2DC 1F45A 1C1EL 1LK2B 4U1LA 3FRUA 3ROLA 5EORL 2Z31D 4Y1AE 3VXPA 1KULA 3GMLB 4H20L 4PRHB 4L29B 5HPOA 2FGZA 2EDKA 1OAZH 1U8NB 4JKKA 4WFEE 5E1HB 5B3NA 2VXSL 2LTQB 4NHUA 2NQCA 1U8MA 1DVFC 2XRAL 1G7HB 1DBBL 5E6IA 2BRRH 4DK3A 3QPXL 4JLRB 2X7LB 4JQVA 3UCRA 3PUCA 4OT1L 1UGNA 2Z31B 3KYMA 4ODHH 1HHHA 4LSTL 1NAKH 3MV9D 3UTZA 3TVMA 3RTQA 2QQLL 1WK0A 3I3DA 1TVBB 4JQXC 4U1KA 4Y7MA 2AEPH 1I1RA 1WSST 2VAAB 3TN0D 1QP1A 5KTEL 4KUCD 4FTVE 4HPYL 1RJLB 5DRZA 3SKUD 2UVEA 3MV9B 1UA6H 1L7TL 4Q2ZB 4XBPA 3MACH 1NGWB 4NFCA 3FOMB 4GXVH 3VGAC 4DUXA 4MNGA 2V7HB 3U46A 5CWSB 4FQCL 3PP4H 5IVOA 5EU4B 4PJBE 3WXWH 4DN3L 1J8HA 5DLMH 1PLGH 4MXQA 3QNXA 1HSBB 4KJPC 4CADA 5IB3A 3IXTA 1FP5A 4Z76B 2FR4A 1RY7B 1C16A 2Z35B 4X7CC 5E8EA 3C6LB 3G08A 4PD4J 3VRJB 3O8XA 3NA4A 1EO8H 3QUXD 1ZHKB 4KQ4L 4OF0A 1CD9B 1ZANL 1GOHA 4M00A 1ZGLB 2V2TB 3O2VH 3EW3B 3X17A 5SWQB 3F5WA 3OG6B 3M8OL 2GJJA 2VL5A 4UZGA 1NCAL 4BQBA 2F58L 3VFPA 4OZIB 1MF2L 1E4KC 3QUXB 1V3LA 4RBPK 4XNQB 3BO8B 1I7RB 1WIOA 1A9EB 1TTGA 2P24A 1A7RL 1PX4A 3GMOA 4LPWA 2EDBA 5CZKA 5F7EL 3TJHA 5F3HA 5BS0D 3DUSA 4JPWL 4FP8H 4OZGB 3E3QE 3RWIB 4XPHH 1EERB 1G9EA 1OGTA 1QRNB 2BY2A 4HK3J 4XNXH 4ZUWA 3NCFB 5F9OL 3GSVA 3ULVC 1Y0LB 1MIEH 5DMYA 4GKZB 2ZPKL 4PJCF 5D72H 3SDXA 3BH8B 3BP7A 5I1JL 3QG6A 1MFDH 5CP3A 4UQ3A 3MLWH 4ENED 1LO0L 2WUCH 2OTUA 3OJDA 1ZOXA 4TNVK 5J6GA 3PHSA 3VFTA 1IEHA 4K3JH 3D48R 4KTYA 1NCDH 3KPOA 3MRJA 4Y5YA 2J8HA 4PP2A 5DJAB 1JIBA 5GS3A 1T2QL 3BD3A 1A3LL 5B8CB 4ZYKA 3ORJA 2WINA 3P4LA 3CVHA 1D6EA 1INEH 3GGWA 2Q7YB 2DM7A 1CICD 2QSCL 2FJGB 2APBA 4G42B 1AY1H 2VLKB 5CBEB 3KG5A 4MGXA 5BXFB 4XXCC 3QEQE 5DHVB 3C60D 5IF0B 1G0DA 4FQQB 3GM0A 1YC8A 4JM2A 5DWUH 4WFGD 5IFHL 3GSOA 3G6JF 4GG6F 2FYYB 2D4FA 1ZHBB 2Q7NA 2F54D 4NT6B 4OQTA 2H26A 3VXNA 2P7TB 2R0WL 5DD3L 3W2DL 2QSVA 1NGQL 1R5IB 2QL1A 1U91A 1RV6X 3C60B 1D9KB 4HIEB 5TDNB 5DFVC 5EA0H 3SDAB 1HSAA 2G5RA 4KKCD 4YFLI 5IMKA 1JTTA 5HYIA 1DQJB 2A9NH 1IKNA 2F54B 4LGRB 4EEEA 5C70A 3IDNA 3OHXB 1RIHL 4JFOB 3SE3A 4JVPA 3C2SA 5LGHL 3DXAD 4YO0B 3ARRA 3JTSA 5ILTH 2ZCKL 5E9DE 2HWZL 2OI9C 3RDTC 1RIUH 4YIQB 1A5FL 3IS1X 3B9KA 3ZTNL 1X4ZA 1I3GL 3AB0B 3RZWA 3DRQB 4PTUA 1MNUL 1WAAF 1T1WA 2I5YH 3DXAB 3L6FB 2A9MH 4DFHA 2EZ0C 2JF1A 3U9UA 2L0DA 5HYSB 2JE8A 2AJSL 2VMFA 1E6JH 3RY6A 2H9GB 3HZVA 1EEZB 3MV01 4YHIA 5T1LD 5KSAC 2DI8A 3NH7H 4OCSH 5HYJE 1K3ZA 4D2NA 1A4JA 5MENE 3LRHA 4LLMB 3ZKNC 2DKUA 3VCLB 1FVCB 5F7UA 1VFUA 1JV5A 4TYUA 3RJDA 3VXOA 5GJSH 2XKUA 4X6CA 3OL2A 1ETZA 4HX1B 1V7ML 3O6FA 5GXBB 1XCQB 2AEIT 5A16B 2YA1A 1UZ6E 4HLZG 5E08H 2H1PL 3QWRA 5HHQB 2E6QA 4C56E 5C71A 3U0TB 1E4XH 4WJ5A 5J13C 1AO7D 1XGPB 2ZZUT 3RWJB 3A67H 2O5ZH 4MA1C 4PRAA 4PRID 4ZOBA 5HI3C 3IDMA 5HVWA 1DEDA 1GAFH 4K2UH 3IETA 2LU4A 2IFFH 2NLJB 3EOTL 2BK8A 4FABL 1MAMH 5EC2A 3SJVA 4LPXA 5ACLA 2R4SL 3MBEA 3IKCB 5DZLA 4PRIB 1AHWB 2R2BB 4PLNC 4GJTB 5IEHA 4U1JB 5A2FA 1C12A 1CGWA 2YUWA 1GGCL 2NY3B 2HJKA 2HRPL 4E42B 4FFZL 4ZQKA 5D8JH 3UBXG 5HHPB 4ZUTA 4N0UE 4NRXA 3TT1L 3MRNB 4QRSA 1MHEA 1ERNA 4WWKB 5IV2B 3I02B 5JXAL 2WQRA 5DD1H 4WFHE 1QLEH 3UTOA 2DAVA 2IANA 4WI8A 5F6IB 5GS1A 2QQNL 1S8DA 4XP4L 3MRQB 3LMJH 2DD8H 3RRQA 3HZYB 3BFOA 4MD0B 3L9RB 1E0OB 4D0BB 5FYKE 1I9JL 2CGRL 1EGJA 2OX5A 3EO1A 4LOUC 4QXGH 3EOYG 1A1MB 3F65A 1M7DB 2H2PD 3QQ4A 2MKWA 4ZSOB 1F90H 1DBJH 5DC4B 4LSUH 1UJ3B 2AGJH 4HC1L 3IVKA 1YPZA 3MCKA 5BQ7B 4YGVA 4WV1B 3DMMC 5HGAB 1FAKT 2P48B 3O3BA 2J7LA 3WO4B 1UM4L 1RHFA 4CMMA 8FABA 4K23H 1WFOA 5IW3A 2CKBH 2VLLA 1ORSB 2C3VA 5I1KL 1G6RA 1JWMB 1LMKA 3FZUD 1TXKA 1L6ZA 5FXCH 4CGTA 4IRJC 4R97B 3LEYH 4PD4K 4P3DB 3DTXA 5B21A 2EIZB 1AIFB 2VQTA 5HVHB 2HLAB 5FYLL 3UJJL 4D8PB 4G8FB 3EFFB 2NW2A 2VZ3A 3AREC 4L3EA 5ISZB 5EU3B 2X09A 1GHFH 2Y4SA 1MFNA 4OCYL 4X5LA 1U8QA 4LRNL 4WHTB 2X41A 3U30B 4P23B 5GRUH 4PV8A 3HC0A 1AXSA 5ENWB 3B2VH 4WHDA 1FGVL 5IB1A 3SKMA 4OZHE 3LS5H 2B0SL 4RAUB 1QSVA 2D7MA 2YRPA 5I17A 1DE4B 3QJHB 5L6YH 3CXDL 5IBTH 3RFZC 5E5RB 2XY1A 1MI5E 2FX8H 3DRTB 2NZ9C 1N3NB 3LQAC 1DTUA 2D31A 3NGBC 4MAYC 2DL9A 1EHXA 5ALBL 4ETYA 3MUJA 3MFFA 4X7DC 3R0MA 1J7VR 4PJFF 4UINL 3ET9F 1SJEA 2AV1A 1NEZG 2CK0L 4YHMH 3GHBL 1LGVA 3QCUL 2P8LB 4DCQA 4ODVH 5JHDA 4WFED 5BV7C 3FT4B 1M05A 1I85A 3MRPA 3BWAB 4OUOA 4E5XB 3P9MB 4LLUA 5IMLB 3BEWA 4JM2F 3V6OC 4L1HA 4Y1AB 3CMGA 5F1NA 3ULVL 3O81A 1KUMA 1H0DA 1A4KA 5HYQB 5F7HA 4HZAA 3HZKB 1S7SA 5DA4A 4ZFFA 1A9BA 1CGTA 2NY4D 1N0LA 3P3YA 3GSRB 3X11A 5C6PB 5AWNL 1O5DT 4P2QE 2FH6A 2DTMH 2NY1C 4Y4KD 4JDVB 3ARBD 3KPMA 4OLUH 5E24E 2PN5A 3BZDA 1FZMB 3SDCC 1QBAA 4GKSB 5D2LA 3JTCA 4N90E 3KPQA 1KYOJ 1U92B 2ZG1A 3KXFA 4I77L 2NY4B 2V9RA 5D7LA 4NKOB 5C2UB 3W0WE 4Y4KB 1LQVA 4O2EB 5DEFA 3ARBB 4FQXC 5DRNA 5EZJB 3ZE2E 5H37G 4FTVB 4AG4H 4P46D 2HH0H 1JI2A 2EEDA 1K4DA 4RRPG 4I4WB 3T4YA 5I8OL 1X5AA 2HFEB 4NJ9L 4YHNA 3LQZA 3BJ91 1H3XA 1IFHL 2XQBL 5IR1B 1LP9A 2IAMA 3HC4H 4PJBB 4MDIA 5CBAB 5MEPB 3PWVB 3IDJA 2A6KA 5GISL 1DEEA 3ISWA 4FG6D 5EO0A 1JGVH 5GGQL 4KVNH 1MQKL 3DNKA 3LEXB 3MLYL 4LPUA 1AQKH 1J1XH 2FB4L 4MJ2A 4PGDB 1CE1L 5EDXA 3BP4B 1YQ2A 3LQMA 4A6YB 2Q20A 2AV7A 1CFBA 4X6CF 5L9DH 3HMXH 3IGAB 4HMDA 1UENA 1HQ4A 4LAJH 1MHPL 2YBRB 4XCFH 4PRBA 2OQJB 3DSFH 2BDNL 3AU1A 2I27N 2Z91A 4YK4C 5C0BD 1XIWD 2SEBB 4JRWA 1TJHL 2AJVH 3TT3L 2CKNA 1BFVL 3NIDF 5GS0C 4ESKA 1MCKA 4DN4L 5B39G 4RNRB 1FFOB 2EEBA 2GT9B 1W8NA 3D3VE 2FO4A 4PJEB 5HTSA 5D7IE 3KYKH 4YE4L 2HFFB 3MRMB 1XIWB 4DW2L 1KN2L 5K59E 3VFNA 1J5OL 1B4JH 1QTYT 1A7OH 3AVEA 5DURB 1KEML 5I1EH 5GGSB 5F6HJ 2ADIA 3LV3A 2ERJC 3WKNA 5D2NA 4NQSA 2EH8L 3KS0J 4YDKL 3TA3D 4AEIL 3MXWH 5EWIH 3D25B 2R29H 4YR6A 3BW9B 3CCHA 4JKPL 5I19L 4L8SC 5JXEC 1LDPH 1G9NC 4M6MH 4QRUB 3JWDH 1CFNB 4L4TA 3TA3B 4DGYL 1D6VL 1WWAX 2UVFA 3PWLA 4ZNCD 5CLTA 2VXTL 5FB8B 3UYPA 2RQ8A 3QEQD 4MB4A 1C5BL 2CRZA 1J0JA 3GRWH 4NZTH 4O2CB 5CP7A 3G5VA 1D5XA 2LTQC 3OJMB 1T2JA 3F7VA 1UYWL 3ZHDA 2ID5A 1G84A 2DJUA 2Z31C 2CLRB 4DFIA 3MX0A 1VFBB 4UIMA 1WT5A 4O5LH 3ZDXE 4DGIL 3TFKA 3VFRA 5C92A 3U36A 4HUXB 3D39A 1SEQL 4HWZA 2EDWA 3O11B 3T3ME 5CS7A 1BVLA 5L8LB 2IALA 1JZ6A 1OAYH 4YDJA 5FDWB 5I6XB 4N0CA 5E9DD 1RJYA 5IW6B 1H3PL 4JN2A 5C0DA 2LE9A 4XXDB 4Y4HA 4I3RL 4JY4A 1I4FA 1KEGH 3BKYL 3OX8B 3TN0C 5T33L 4CW1B 2X5PA 4C59B 3MGOA 3VD5A 5FCSH 3W9DA 4OF8A 5EULV 5C0CA 5CCKL 1FNSH 4MSWB 2ORBL 4C83B 5E9DB 5SWZD 1K2DA 3ZO0A 2ZKHL 4S1SH 1CLOL 2JCCA 5HYJD 1FCCA 4HS8H 3QZWB 5H35B 5MEND 5E8OA 3QCVH 4U1SA 1F3JA 4H5SA 2X4UA 5F70A 5C9KA 1NL0L 2R8SH 1QVOB 2W07A 4J12A 2R2HB 2VDLH 3KPNA 2D0GA 2XA8H 5HYJB 4F15C 1J1OH 3QUXC 5B22A 4GQ9L 4YHPB 1XH3A 5CGMA 2BFVL 2I25N 2X4PB 2YEZA 4QRTA 3ZT6A 5MENB 1NLDL 4C56D 1IGYB 5CIPB 3CH1A 4MYWB 4OFYA 2EDYA 4YXHH 1LILA 3OBAA 3ZT7A 1CU4L 1MOEA 4UV7H 4YFEA 3I9GH 2XN9A 1MHCA 1RIVH 5JOFA 5EZOH 3OKOA 3TBVA 1OCWH 5E99L 3VFMB 4V2CB 3U0PA 1M6OB 4XPGH 4O9HL 1HHGA 2BCKA 4EBQH 4ZTOH 1FO0B 32C2A 5KVEH 5HGDA 5J6HA 4NKIH 3LH2L 5CEYA 2CSPA 1KCSL 1R5VA 1F6LL 2W9EL 2EDHA 2BSRA 1RMFH 4AK1A 4GAJH 3LQAL 2ZOKB 4R90L 4LAQL 5D2LF 4JO3L 4ENEC 5I1IH 2VDMH 2CQVA 3WLBB 1Z9SA 4AIZA 5AUMB 2YOCA 1JNHB 3QRGL 1IGFH 3J7HA 5ERWB 4HUWB 4AT6B 4G6FD 5FYKD 4N0UB 4ODUA 2AKRB 5I0DA 5JPMB 4LSPL 5JO5B 4R7DA 4OM1H 1U8JA 4WI4A 3VE0B 5F9AC 3WFEH 5CGYD 3U0WL 1EUUA 4PJIE 3TNNA 1LP9F 5AAWA 4MZ2A 1CICC 3WIFA 5T3XE 4R96A 3ES6A 5B38G 1MAKA 1ZEAL 4OLZH 4PREA 3C60C 4LBEB 4Y19B 1UB6A 5KBNC 2YD8A 3ILQD 5LXGL 2X4SB 3CFKA 4ZXBA 5B4MD 5T1MA 5HVGB 4WCYH 1K9TA 4JPVH 1IM9A 3MYJA 4X99B 1B0RB 1GZPB 3VMNA 2I60H 1AE6H 3V7MA 1RJZA 2BSSA 2W65B 3VXMD 2JK5B 2E7BA 1ZSDA 1DUZB 3JWOC 4KKCC 1YEEH 3VXRE 1FCGA 1T22A 3MRKA 2P5WA 3C6SA 4WW2A 3GBMH 3AB0C 35C8L 2H3NA 1X44A 4UNTA 1E4XI 4PFEA 3MNWA 1ZA3A 4YZFE 5GGSY 3FO9A 4HXBH 3LKPA 1TETH 2FL5A 3RVXD 2DLIA 2DYPA 2FLRT 3LN5B 3FO2A 4JZJA 1OY3B 1L9NA 4U1GB 4LVHB 2WWMD 2EYSA 3MBXH 4G6JL 4PYGA 3NZ8B 4XRCB 1CN4A 2VL4A 1XF3B 3EO0B 1RURH 4BSWB 4PGEA 4JFFA 1KJ2L 1JMXA 3U48A 3W5MA 1G7QA 1MI5D 3BZ4A 1R0AH 4JG1L 5GSRA 1F11B 1S9WB 5ESAA 2BC4A 5TE7L 4WTWA 1NANH 4OZHB 3OKEB 1MCCA 1WEJH 4OF7A 4PJGA 1BQHB 2OSLB 2RCSH 5DD5H 4HH9B 5JOPE 5SX5H 3MJ9A 5IJVA 5E94A 4YHOL 2WZPD 1MI5B 1IARB 5DMKA 2YWZA 2QQKL 2VSDA 1FAIH 2QR0B 4W6XB 1LEKB 1WBYA 2A2QT 5DD6A 4GMSL 3RWDA 2A0LD 1QLRA 2A6IB 3IDIB 2Z4QB 4H8WH 5GS0L 2XWJB 2HVKB 4XVTH 3X14B 4FFYL 4PGCB 3MR9B 4J2XA 2XZAL 2HG5B 1QKZH 1FL6B 2R2CA 4D9QE 3U4BH 2LFGA 1QSZA 3NZHL 2B5IB 3ARDD 4ZUSB 2Q8AL 3D6GA 5D7KD 3CAFA 1B6UA 4JKMA 3QIWD 2Q8BL 3O9WD 1RUML 4N90D 2DQUH 2JJUA 4MMXC 1JTOA 4PJ5E 5F7YC 4LVNC 4P2QB 1GGBL 4RGND 2X6MA 2DQEH 3FOLB 3CFJA 5F6IC 4ZFOB 1C7TA 1QBLL 5E03A 1G9NL 5E1AB 4UDUB 3KJ4C 2X4TA 25C8L 1RUPH 3HN3A 4RIRA 4LKXA 2IPTH 3PABB 3S98A 3GSQA 4YDVA 4ODBD 4LLWA 3W9EB 3W0WB 1JNNH 5IUSA 5ALCH 1UJ3C 3D85A 4FQ2H 4JHAL 4KK6D 3LKNA 3PL6D 4OTXL 5CEXA 1A6AA 4PLJD 5BRZA 1DSFH 2X70A 2JCCF 3RA7H 1M71B 4WV1C 2HMID 1CFTA 1JN6B 5CJQL 2H2PC 4JDZA 1T7WA 3WO4C 1NFKA 3UAJD 2ARWA 2BVPA 4GRWE 4I5BB 1DLFH 5FA3A 3VD4A 3PL6B 3V4PH 3ARFD 3QUML 3IFNH 4WGVB 1QFUL 1XR9B 3BZEA 4LIQH 2X10A 3GSNL 1S5HB 3TBSA 5GGVH 3CZFB 2E9WA 2EDEA 1AD9A 2FATL 4FQJL 2IQAB 5T1KD 4PY7A 2Y9RT 1T3FA 2VWEC 5EOTB 3TV3H 2FWOB 1G7LB 1UWXH 4URTB 1QQDB 3ARFB 2WBWB 2ZSWA 3D3VD 1OARL 3FQWB 3WSQL 3FZUC 2AJUH 3O2WH 4DZBB 2KZ1B 3ULSB 1A2YB 3F58H 1G9MC 3VWJD 1DCLA 5TQ0L 3HS0A 1MRFL 1G7PA 3EYOA 3V0WL 3VRLE 4ODWA 2GI7A 1IAOA 4IJ3B 5KSUA 5I1DB 1NC4B 4KKLD 1HKFA 3WS6A 3NABH 1MLBB 1C5CH 5HGBA 1LO5A 2BHZA 5D7IB 3T8XA 1DQLL 2M1KA 2GJ6E 3SKJH 4HCRH 5CILH 3VWKD 1JK8A 4X83A 4AEHH 5SV4A 2FGWL 2W0FB 4G6MH 1F00I 1RD6A 5SX5K 4XC3L 2YSSA 3L3DB 2G2RA 1IQWL 2E6PA 3MLRH 5LKNA 1LO4H 2X40A 4DUVA 5BVPH 2NY5C 4FXKA 4MA3B 3OXRB 3PE9A 3C8KB 4I0PD 3BMWA 5D9SA 1LE9A 4RQQA 4QHLA 5EOQH 3UX9B 4XP5H 5HYSG 4XHJD 5AYQA 3KYOB 1SMOA 2EKSB 3UYRL 4KQ3H 3MLSH 1A1OA 1HWGB 3QUYB 4PIRF 4XBEH 5I2IB 1OAZL 4NZUH 1ED3A 5F7WC 5I8EB 1R3JB 2YD3A 5KG9A 3WNLA 3FFDB 2NR6D 4Y0GA 5IHZA 2RGSA 4O58H 1ZMYA 3QUKB 1NAKL 4XMPL 1KOAA 1XF2A 1QSFE 2R4RH 5JPNA 3NACL 5CD3B 3UPAA 2BSED 4U6YA 4FQPA 1CGVA 1SYVB 1NGPH 1EV2E 2A83A 4I3GA 4JFXA 2N4IA 2CO6B 4NO0B 3TZVB 1UA6L 2NY4C 5DQ9A 3MACL 3GKZA 5JUEH 4Y4KC 1BJ1J 2YD4A 4Y16B 3ARBC 5A2JH 4GBXD 1AGBB 4XPBH 3IRZA 3RNQB 3UBXI 3K8MA 3PP4L 3QCTH 2A74A 4N1HB 3X12A 1OB1B 2HFTA 4ZODA 4DVRL 4F7TA 5FECA 5EIQA 1PLGL 2NZIA 2O93L 4RMWA 1I7ZB 3RY5A 3W39A 3SDDD 2N56A 2X4QB 5I1HL 1L4IA 5DRXB 4P46C 1MCOH 2VR4A 2O5YH 4WU5A 5SWSE 1EVUA 5GGTL 4X7TB 5I73B 5LVEA 3AM8A 5GSVB 5EUOE 4XCNB 1QSEE 2XKSA 4M43H 3SDDB 2VXUL 3HE7D 3H9ZA 1MCSA 1EBPA 2NX5E 3IFOA 4FXGA 4NFDA 1MCIA 3L5XH 3ULUF 4CBPA 1F4WL 4M7JL 4L9LA 3KPTA 1I1AB 4FG6C 2A77H 2QBWA 5DJ0A 3WEXA 5C07B 1S9VB 1ACZA 2OS7A 3L95B 2QLVB 1UWXK 4QEGA 3PHQB 4KKBD 1FNAA 3JWOL 1Z5LB 3PGCA 3LKRB 4YEFA 4JPIA 4MDJA 4M1DH 5J7CC 2D4DA 2VITB 1QD0A 3DX8A 4FFEX 3PWJA 3TO2B 5CMAA 1TTUA 2BNQA 1KELH 1XIWC 2WBJB 4HKJB 4YGAB 3NAAH 1HHKB 4G7VL 3E3QC 5DJ6B 1WZKA 5CJXA 1I7UB 4LSRL 1S9XB 4GUPB 3MLWL 3RWGA 4YBQD 1NFIA 1V3JA 3MODH 4ETQB 4D0CA 4K3JL 4HDIB 5ACMA 2CLZB 2XACC 3GK8H 1JZ2A 4JO1L 2EE2A 3QFJA 4M7ZB 3TA3C 4NO2B 1B3JA 3IDGB 3WN5A 1J11A 3QHFH 1S7QA 5F97E 3MRBA 3QUMA 4W81A 2ED8A 3KPRD 3O4LA 5K9JL 3MJ7A 2MNUA 3GSNA 1S7VB 1T83C 1OSPH 3G5ZA 1Q9OB 5DWUL 2GW5A 1GPOH 2HJFA 4AMKH 5T3XD 4OD3H 2R69H 4GLRH 3BAEH 3BUYB 3QHZH 1N2RA 3BE1L 5T5NF 4ELKB 1L7IH 5I9QC 1OPGL 4PJIB 5FYJH 1CXFA 4M4RA 5F1SA 4F33A 2YA0A 1EHNA 5EU6D 3NOIA 5EA0L 2E8ZA 2VH5H 2Q87A 5JLZB 2Z0BA 4KKNA 3ZE1F 4HIJA 3C87A 1H8SA 3TBYB 3QDMA 4PG2C 4ZNEA 2E7LE 4UUJA 4P2RE 4X5WB 5I6XC 3LS4H 4Q9BA 1T0NA 1KTDB 1TQCB 3S36L 4UT7H 3VXRD 5J3HD 5ILTL 1G7IA 4EXPX 5BCAA 5I66A 1RIUL 4GMTH 4RX4A 1X5IA 2JELH 5IHBA 1FBIH 3V6FB 2OLDA 4YC2C 2E7HA 4QT5A 3U6RB 4Y2OA 3S4SA 1MFBH