1HPTA

Three-dimensional structure of a recombinant variant of human pancreatic secretory trypsin inhibitor (kazal type)
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
56
structure length
56
Chain Sequence
b'DSLGREAKCYNELNGCTYEYRPVCGTDGDTYPNECVLCFENRKRQTSILIQKSGPC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PANCREATIC SECRETORY TRYPSIN INHIBITOR (KAZAL TYPE) VARIANT
publication title Three-dimensional structure of a recombinant variant of human pancreatic secretory trypsin inhibitor (Kazal type).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Serine protease inhibitor
total genus 13
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 1992-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00050 Kazal_1 Kazal-type serine protease inhibitor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1hptA00
2NU0I 1KMAA 1CE3A 1PPFI 1M8BA 2KMPA 2KMQA 1Y1CA 1IY5A 3HH2C 1R0RI 2LEOA 2GKTI 1CT2I 5DAEA 1NUBA 4GI3C 2N71A 1HPTA 1AN1I 2NU3I 3SGBI 2JXDA 3B4VC 2NU1I 2V53A 1OMUA 1SGNI 3SEKC 2N52A 2SGDI 1CT0I 1Y1BA 2F3CI 1CT4I 1BUSA 1TBRR 1TURA 1CGJI 1M8CA 2ERWA 2JYYA 1CSOI 1PCEA 1N13A 2SGPI 1DS3I 2ARPF 1DS2I 2SGEI 1TGSI 1TIHA 1TUSA 1SGPI 2B0UC 2GKVA 4SGBI 1FYBA 1TBQR 2KMOA 1BMOA 1SGRI 2QQCA 5JHWC 1OMTA 4OVOA 1UVFA 2QQDA 1OVOA 3QTLD 2KCXA 1SGDI 1HJAI 2M5XA 3TJQA 2NU4I 1HDLA 2SGFI 1PJUA 1LR9A 3SGQI 2WCYA 1SGQI 2P6AC 4HGUA 1CGII 1OYVI 1MT1A 1YU6C 1LR7A 2OVOA 2N17A 1IY6A 1CHOI 1H0ZA 2JZMA 2BUSA 1Z7KB 2NU2I 1LR8A 3OVOA 2XRCA 2KMRA 2SGQI 1UVGA 2GKRI 1YTPA 1SGEI 1SGYI 1UUCA 1IW4A
chains in the Genus database with same CATH superfamily
2NU0I 2LUYA 2DIPA 4JCVE 1KMAA 1CE3A 1PPFI 3BJIA 1M8BA 1V1HA 2KMPA 5CCLA 2KMQA 1MJAA 2QPOA 1Y1CA 2ENZA 1KBFA 1IY5A 2JA1A 2A20A 3HH2C 2L8EA 1R0RI 2LEOA 1X4SA 1CT2I 2GKTI 2RC4A 5FUVA 5DAEA 2E73A 1NUBA 4GI3C 2N71A 1HPTA 1AN1I 4E1RA 1WGTA 2NU3I 3SGBI 1KBEA 1WKXA 2E5RA 2JXDA 3B4VC 5CCMA 2NU1I 1MJBA 3D00A 2OD1A 1K7UA 4DNCA 3QAHA 2V53A 1OMUA 1RFHA 2GVIA 1SGNI 2J9RA 3FSYA 3R5DA 3SEKC 2N52A 1K7VA 4A24A 2SGDI 1CT0I 1Y1BA 1CT4I 1FARA 2F3CI 2PQ8A 2W0TA 1BUSA 3CXLA 2OZUA 4UXHA 1TBRR 1TURA 2DKVA 1CGJI 2J87A 2UZ3A 2V1CA 1M8CA 3R5BA 3UOEA 2ERWA 4UXIA 2JYYA 3TO7A 3FC3A 4UXJA 1CSOI 1FY7A 1N13A 1PCEA 1DS3I 1PTRA 1VDDA 2SGPI 5EX3A 5HQ8A 2VRWB 2ARPF 2CJSC 1ULMA 3OXLA 1DS2I 3PDNA 1ULKA 2L7XA 2SGEI 2DB6A 1TGSI 1P9GA 1TIHA 1TUSA 1X74A 2V1CC 3OXFA 1TBOA 1SGPI 1TOTA 2B0UC 2GKVA 2B8TA 3E2IA 3UEYA 1Z2IA 2CWFA 3QWPA 4SGBI 1MJ9A 1PTQA 1TBQR 3GOXA 1FYBA 2KMOA 1ULNA 1BMOA 1SGRI 1XX6A 2QQCA 2YQPA 3TO6A 5JHWC 3E59A 1OMTA 2X52A 5E3PA 4OVOA 1UVFA 1U5KA 2QQDA 5HI7A 2CWHA 2GIVA 1OVOA 1Y8FA 1K7TA 2FNFX 2Y0MA 3OL0A 2QQ0A 3QTLD 2KCXA 1SGDI 1HJAI 2M5XA 2ORWA 3TJQA 1W3SA 2NU4I 3UFFA 1UHAA 1HDLA 3OXGA 2SGFI 1PJUA 4E1PA 2WGCA 2WVJA 5J8CA 4WP4A 1S20A 1XA6A 1LR9A 3TOAA 3TOBA 5FUWA 3RU0A 3SGQI 2N1AB 2ELIA 2LB7A 1TBNA 1SGQI 2P6AC 2WCYA 3FSXA 4MPIA 1HEVA 5E3RA 1W4RA 1P9ZA 2ENNA 3R5AA 3VE5A 4HGUA 3R5CA 1CGII 3MEKA 1OYVI 4B6DA 4AMLA 2JW6A 5E3QA 2RIJA 1MT1A 1YU6C 1LR7A 3TO9A 7WGAA 2OVOA 1WTJA 5J8FA 4L9MA 2N17A 1IY6A 1CHOI 4FKDA 1NXUA 2JZMA 2OU2A 1H0ZA 1WGCA 2BUSA 1XBTA 5EX0A 2ODDA 1Z7KB 5FUXA 2NU2I 2K9HA 1FAQA 1R79A 1LR8A 3UGLA 3UGDA 3OVOA 2UVOA 2XRCA 1V1IA 2KMRA 3UGIA 2SGQI 3VDUA 2CWGA 1UVGA 2GKRI 2YUUA 2ROWA 1Q9BA 1YTPA 1SGEI 1SGYI 5FUYA 9WGAA 2X3TA 2ORVA 3KY9A 3UEJA 2QQEA 1UUCA 1IW4A 3VDPA
chains in the Genus database with same CATH topology
2NU0I 2LUYA 2DIPA 4JCVE 1KMAA 1CE3A 1PPFI 3BJIA 1M8BA 1V1HA 2KMPA 5CCLA 2KMQA 2QPOA 1Y1CA 2ENZA 1KBFA 1IY5A 2JA1A 2A20A 3HH2C 2L8EA 1R0RI 2LEOA 1X4SA 1CT2I 2GKTI 5FUVA 5DAEA 2E73A 1NUBA 4GI3C 2N71A 1HPTA 1AN1I 4E1RA 2NU3I 3SGBI 1KBEA 2E5RA 2JXDA 3B4VC 5CCMA 2NU1I 3D00A 2OD1A 2V53A 1OMUA 1RFHA 2GVIA 1SGNI 2J9RA 3SEKC 2N52A 4A24A 2SGDI 1CT0I 1Y1BA 1CT4I 1FARA 2F3CI 2W0TA 1BUSA 3CXLA 4UXHA 1TBRR 1TURA 2UZ3A 1CGJI 2J87A 2V1CA 1M8CA 2ERWA 4UXIA 2JYYA 3FC3A 4UXJA 1CSOI 1PCEA 1N13A 1VDDA 1DS3I 1PTRA 2SGPI 5EX3A 5HQ8A 2VRWB 2ARPF 2CJSC 3OXLA 1DS2I 3PDNA 2L7XA 2SGEI 2DB6A 1TGSI 1TIHA 1TUSA 1X74A 2V1CC 3OXFA 1TBOA 1SGPI 1TOTA 2B0UC 2GKVA 2B8TA 3E2IA 3UEYA 3QWPA 4SGBI 3GOXA 1FYBA 1PTQA 1TBQR 2KMOA 1BMOA 1SGRI 1XX6A 2QQCA 2YQPA 5JHWC 3E59A 1OMTA 4OVOA 1UVFA 1U5KA 2QQDA 5HI7A 1OVOA 1Y8FA 2FNFX 3OL0A 2QQ0A 3QTLD 2KCXA 1SGDI 1HJAI 2M5XA 2ORWA 3TJQA 1W3SA 2NU4I 3UFFA 1HDLA 3OXGA 2SGFI 1PJUA 4E1PA 2WVJA 1XA6A 1LR9A 5FUWA 3RU0A 3SGQI 2N1AB 2ELIA 1TBNA 1SGQI 2P6AC 2WCYA 1W4RA 2ENNA 3VE5A 4HGUA 1CGII 3MEKA 1OYVI 4B6DA 2JW6A 1MT1A 1YU6C 1LR7A 2OVOA 4L9MA 2N17A 1IY6A 1CHOI 4FKDA 1H0ZA 2JZMA 2BUSA 1XBTA 5EX0A 2ODDA 1Z7KB 5FUXA 2NU2I 2K9HA 1FAQA 1R79A 1LR8A 3UGLA 3UGDA 3OVOA 2XRCA 1V1IA 2KMRA 3UGIA 2SGQI 3VDUA 1UVGA 2GKRI 2YUUA 2ROWA 1YTPA 1SGEI 1SGYI 5FUYA 2ORVA 3KY9A 3UEJA 2QQEA 1UUCA 1IW4A 3VDPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NU0 I;  1KMA A;  1CE3 A;  1PPF I;  1M8B A;  2KMP A;  2KMQ A;  1Y1C A;  1IY5 A;  3HH2 C;  1R0R I;  2LEO A;  2GKT I;  1CT2 I;  5DAE A;  1NUB A;  4GI3 C;  2N71 A;  1HPT A;  1AN1 I;  2NU3 I;  3SGB I;  2JXD A;  3B4V C;  2NU1 I;  2V53 A;  1OMU A;  1SGN I;  3SEK C;  2N52 A;  2SGD I;  1CT0 I;  1Y1B A;  2F3C I;  1CT4 I;  1BUS A;  1TBR R;  1TUR A;  1CGJ I;  1M8C A;  2ERW A;  2JYY A;  1CSO I;  1PCE A;  1N13 A;  2SGP I;  1DS3 I;  2ARP F;  1DS2 I;  2SGE I;  1TGS I;  1TIH A;  1TUS A;  1SGP I;  2B0U C;  2GKV A;  4SGB I;  1FYB A;  1TBQ R;  2KMO A;  1BMO A;  1SGR I;  2QQC A;  5JHW C;  1OMT A;  4OVO A;  1UVF A;  2QQD A;  1OVO A;  3QTL D;  2KCX A;  1SGD I;  1HJA I;  2M5X A;  3TJQ A;  2NU4 I;  1HDL A;  2SGF I;  1PJU A;  1LR9 A;  3SGQ I;  2WCY A;  1SGQ I;  2P6A C;  4HGU A;  1CGI I;  1OYV I;  1MT1 A;  1YU6 C;  1LR7 A;  2OVO A;  2N17 A;  1IY6 A;  1CHO I;  1H0Z A;  2JZM A;  2BUS A;  1Z7K B;  2NU2 I;  1LR8 A;  3OVO A;  2XRC A;  2KMR A;  2SGQ I;  1UVG A;  2GKR I;  1YTP A;  1SGE I;  1SGY I;  1UUC A;  1IW4 A; 
#chains in the Genus database with same CATH topology
 2NU0 I;  2LUY A;  2DIP A;  4JCV E;  1KMA A;  1CE3 A;  1PPF I;  3BJI A;  1M8B A;  1V1H A;  2KMP A;  5CCL A;  2KMQ A;  1MJA A;  2QPO A;  1Y1C A;  2ENZ A;  1KBF A;  1IY5 A;  2JA1 A;  2A20 A;  3HH2 C;  2L8E A;  1R0R I;  2LEO A;  1X4S A;  1CT2 I;  2GKT I;  2RC4 A;  5FUV A;  5DAE A;  2E73 A;  1NUB A;  4GI3 C;  2N71 A;  1HPT A;  1AN1 I;  4E1R A;  1WGT A;  2NU3 I;  3SGB I;  1KBE A;  1WKX A;  2E5R A;  2JXD A;  3B4V C;  5CCM A;  2NU1 I;  1MJB A;  3D00 A;  2OD1 A;  1K7U A;  4DNC A;  3QAH A;  2V53 A;  1OMU A;  1RFH A;  2GVI A;  1SGN I;  2J9R A;  3FSY A;  3R5D A;  3SEK C;  2N52 A;  1K7V A;  4A24 A;  2SGD I;  1CT0 I;  1Y1B A;  1CT4 I;  1FAR A;  2F3C I;  2PQ8 A;  2W0T A;  1BUS A;  3CXL A;  2OZU A;  4UXH A;  1TBR R;  1TUR A;  2DKV A;  1CGJ I;  2J87 A;  2UZ3 A;  2V1C A;  1M8C A;  3R5B A;  3UOE A;  2ERW A;  4UXI A;  2JYY A;  3TO7 A;  3FC3 A;  4UXJ A;  1CSO I;  1FY7 A;  1N13 A;  1PCE A;  1DS3 I;  1PTR A;  1VDD A;  2SGP I;  5EX3 A;  5HQ8 A;  2VRW B;  2ARP F;  2CJS C;  1ULM A;  3OXL A;  1DS2 I;  3PDN A;  1ULK A;  2L7X A;  2SGE I;  2DB6 A;  1TGS I;  1P9G A;  1TIH A;  1TUS A;  1X74 A;  2V1C C;  3OXF A;  1TBO A;  1SGP I;  1TOT A;  2B0U C;  2GKV A;  2B8T A;  3E2I A;  3UEY A;  1Z2I A;  2CWF A;  3QWP A;  4SGB I;  1MJ9 A;  1PTQ A;  1TBQ R;  3GOX A;  1FYB A;  2KMO A;  1ULN A;  1BMO A;  1SGR I;  1XX6 A;  2QQC A;  2YQP A;  3TO6 A;  5JHW C;  3E59 A;  1OMT A;  2X52 A;  5E3P A;  4OVO A;  1UVF A;  1U5K A;  2QQD A;  5HI7 A;  2CWH A;  2GIV A;  1OVO A;  1Y8F A;  1K7T A;  2FNF X;  2Y0M A;  3OL0 A;  2QQ0 A;  3QTL D;  2KCX A;  1SGD I;  1HJA I;  2M5X A;  2ORW A;  3TJQ A;  1W3S A;  2NU4 I;  3UFF A;  1UHA A;  1HDL A;  3OXG A;  2SGF I;  1PJU A;  4E1P A;  2WGC A;  2WVJ A;  5J8C A;  4WP4 A;  1S20 A;  1XA6 A;  1LR9 A;  3TOA A;  3TOB A;  5FUW A;  3RU0 A;  3SGQ I;  2N1A B;  2ELI A;  2LB7 A;  1TBN A;  1SGQ I;  2P6A C;  2WCY A;  3FSX A;  4MPI A;  1HEV A;  5E3R A;  1W4R A;  1P9Z A;  2ENN A;  3R5A A;  3VE5 A;  4HGU A;  3R5C A;  1CGI I;  3MEK A;  1OYV I;  4B6D A;  4AML A;  2JW6 A;  5E3Q A;  2RIJ A;  1MT1 A;  1YU6 C;  1LR7 A;  3TO9 A;  7WGA A;  2OVO A;  1WTJ A;  5J8F A;  4L9M A;  2N17 A;  1IY6 A;  1CHO I;  4FKD A;  1NXU A;  2JZM A;  2OU2 A;  1H0Z A;  1WGC A;  2BUS A;  1XBT A;  5EX0 A;  2ODD A;  1Z7K B;  5FUX A;  2NU2 I;  2K9H A;  1FAQ A;  1R79 A;  1LR8 A;  3UGL A;  3UGD A;  3OVO A;  2UVO A;  2XRC A;  1V1I A;  2KMR A;  3UGI A;  2SGQ I;  3VDU A;  2CWG A;  1UVG A;  2GKR I;  2YUU A;  2ROW A;  1Q9B A;  1YTP A;  1SGE I;  1SGY I;  5FUY A;  9WGA A;  2X3T A;  2ORV A;  3KY9 A;  3UEJ A;  2QQE A;  1UUC A;  1IW4 A;  3VDP A; 
#chains in the Genus database with same CATH homology
 2NU0 I;  2LUY A;  2DIP A;  4JCV E;  1KMA A;  1CE3 A;  1PPF I;  3BJI A;  1M8B A;  1V1H A;  2KMP A;  5CCL A;  2KMQ A;  2QPO A;  1Y1C A;  2ENZ A;  1KBF A;  1IY5 A;  2JA1 A;  2A20 A;  3HH2 C;  2L8E A;  1R0R I;  2LEO A;  1X4S A;  1CT2 I;  2GKT I;  5FUV A;  5DAE A;  2E73 A;  1NUB A;  4GI3 C;  2N71 A;  1HPT A;  1AN1 I;  4E1R A;  2NU3 I;  3SGB I;  1KBE A;  2E5R A;  2JXD A;  3B4V C;  5CCM A;  2NU1 I;  3D00 A;  2OD1 A;  2V53 A;  1OMU A;  1RFH A;  2GVI A;  1SGN I;  2J9R A;  3SEK C;  2N52 A;  4A24 A;  2SGD I;  1CT0 I;  1Y1B A;  1CT4 I;  1FAR A;  2F3C I;  2W0T A;  1BUS A;  3CXL A;  4UXH A;  1TBR R;  1TUR A;  2UZ3 A;  1CGJ I;  2J87 A;  2V1C A;  1M8C A;  2ERW A;  4UXI A;  2JYY A;  3FC3 A;  4UXJ A;  1CSO I;  1PCE A;  1N13 A;  1VDD A;  1DS3 I;  1PTR A;  2SGP I;  5EX3 A;  5HQ8 A;  2VRW B;  2ARP F;  2CJS C;  3OXL A;  1DS2 I;  3PDN A;  2L7X A;  2SGE I;  2DB6 A;  1TGS I;  1TIH A;  1TUS A;  1X74 A;  2V1C C;  3OXF A;  1TBO A;  1SGP I;  1TOT A;  2B0U C;  2GKV A;  2B8T A;  3E2I A;  3UEY A;  3QWP A;  4SGB I;  3GOX A;  1FYB A;  1PTQ A;  1TBQ R;  2KMO A;  1BMO A;  1SGR I;  1XX6 A;  2QQC A;  2YQP A;  5JHW C;  3E59 A;  1OMT A;  4OVO A;  1UVF A;  1U5K A;  2QQD A;  5HI7 A;  1OVO A;  1Y8F A;  2FNF X;  3OL0 A;  2QQ0 A;  3QTL D;  2KCX A;  1SGD I;  1HJA I;  2M5X A;  2ORW A;  3TJQ A;  1W3S A;  2NU4 I;  3UFF A;  1HDL A;  3OXG A;  2SGF I;  1PJU A;  4E1P A;  2WVJ A;  1XA6 A;  1LR9 A;  5FUW A;  3RU0 A;  3SGQ I;  2N1A B;  2ELI A;  1TBN A;  1SGQ I;  2P6A C;  2WCY A;  1W4R A;  2ENN A;  3VE5 A;  4HGU A;  1CGI I;  3MEK A;  1OYV I;  4B6D A;  2JW6 A;  1MT1 A;  1YU6 C;  1LR7 A;  2OVO A;  4L9M A;  2N17 A;  1IY6 A;  1CHO I;  4FKD A;  1H0Z A;  2JZM A;  2BUS A;  1XBT A;  5EX0 A;  2ODD A;  1Z7K B;  5FUX A;  2NU2 I;  2K9H A;  1FAQ A;  1R79 A;  1LR8 A;  3UGL A;  3UGD A;  3OVO A;  2XRC A;  1V1I A;  2KMR A;  3UGI A;  2SGQ I;  3VDU A;  1UVG A;  2GKR I;  2YUU A;  2ROW A;  1YTP A;  1SGE I;  1SGY I;  5FUY A;  2ORV A;  3KY9 A;  3UEJ A;  2QQE A;  1UUC A;  1IW4 A;  3VDP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...