1HPTA

Three-dimensional structure of a recombinant variant of human pancreatic secretory trypsin inhibitor (kazal type)
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
56
structure length
56
Chain Sequence
DSLGREAKCYNELNGCTYEYRPVCGTDGDTYPNECVLCFENRKRQTSILIQKSGPC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PANCREATIC SECRETORY TRYPSIN INHIBITOR (KAZAL TYPE) VARIANT
publication title Three-dimensional structure of a recombinant variant of human pancreatic secretory trypsin inhibitor (Kazal type).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Serine protease inhibitor
total genus 13
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 1992-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00050 Kazal_1 Kazal-type serine protease inhibitor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1hptA00
1CT0I 2KMOA 1CGJI 2KMPA 1TURA 1AN1I 1PPFI 2WCYA 1SGPI 2B0UC 3SEKC 1HDLA 1TUSA 1OVOA 1UVFA 1CGII 2GKTI 4SGBI 2KMQA 2SGDI 3SGBI 1DS2I 1SGEI 1SGRI 4GI3C 1CHOI 2OVOA 2QQCA 1N13A 2F3CI 2QQDA 5DAEA 1Y1BA 1LR8A 1YTPA 1SGNI 1LR9A 2NU0I 2ERWA 2LEOA 3TJQA 2ARPF 2SGPI 2JZMA 3B4VC 1Y1CA 1TBQR 1MT1A 1IW4A 1OMTA 4OVOA 2GKRI 1TBRR 1M8BA 1SGDI 2N52A 1CT4I 1IY5A 1TGSI 1NUBA 1CT2I 2GKVA 1HPTA 1M8CA 5JHWC 2JXDA 2NU1I 4HGUA 1LR7A 3SGQI 1BUSA 1Z7KB 1OYVI 1UUCA 2N71A 3QTLD 1FYBA 1CSOI 2NU4I 1UVGA 2SGFI 2V53A 1H0ZA 1R0RI 2NU2I 1YU6C 2N17A 1IY6A 1KMAA 1TIHA 1HJAI 1CE3A 2M5XA 2SGEI 1SGYI 2XRCA 2KCXA 1PJUA 1BMOA 3HH2C 3OVOA 2P6AC 1SGQI 1OMUA 1DS3I 2JYYA 2NU3I 2KMRA 1PCEA 2SGQI 2BUSA
chains in the Genus database with same CATH superfamily
3QWPA 1CT0I 2KMOA 1CGJI 2KMPA 1PTRA 3OL0A 5FUWA 9WGAA 1TURA 1AN1I 1PPFI 1K7TA 2WCYA 2B8TA 1U5KA 2ENZA 4UXJA 3UFFA 1SGPI 3FSXA 2B0UC 3SEKC 5HQ8A 4MPIA 1RFHA 1HDLA 2N1AB 1TUSA 1OVOA 2J9RA 1UVFA 1CGII 2GKTI 2CWHA 2LUYA 2ODDA 1R79A 2OD1A 2OU2A 4SGBI 2KMQA 2SGDI 3R5DA 3SGBI 1DS2I 1SGEI 1SGRI 4GI3C 5FUXA 1CHOI 2OVOA 5J8FA 2QQCA 1XBTA 1N13A 2Y0MA 2F3CI 3OXGA 4A24A 5E3PA 2QQDA 3UEYA 2QQ0A 5DAEA 1KBEA 1WGCA 1Y1BA 2JA1A 1LR8A 1YTPA 2RIJA 1SGNI 1LR9A 2NU0I 2ERWA 2ORVA 1ULMA 2GVIA 2LEOA 3UOEA 3TJQA 2ARPF 2J87A 2SGPI 1TOTA 1W4RA 2JZMA 2L8EA 1FARA 3B4VC 2QQEA 1Y8FA 1HEVA 5EX0A 1PTQA 2ROWA 1Y1CA 1XA6A 1MJBA 2UZ3A 1VDDA 3UGDA 1TBQR 1XX6A 1MT1A 2LB7A 1IW4A 1OMTA 4OVOA 1ULNA 2GKRI 1K7VA 2K9HA 3R5AA 1TBRR 4L9MA 1M8BA 1SGDI 5EX3A 1V1HA 1TBOA 2L7XA 2N52A 1CT4I 2RC4A 2WGCA 3FC3A 2E73A 4JCVE 1IY5A 3UGLA 1TGSI 1NUBA 1CT2I 1MJ9A 1S20A 2GKVA 1KBFA 3R5BA 1HPTA 3TO9A 1M8CA 2X52A 1UHAA 4E1RA 4DNCA 5JHWC 2JXDA 3OXFA 2NU1I 4HGUA 3RU0A 2JW6A 5FUVA 1MJAA 2CWGA 1LR7A 3SGQI 1BUSA 1P9GA 1WGTA 2A20A 1NXUA 5FUYA 1Z7KB 2VRWB 2PQ8A 3TO7A 1X4SA 1OYVI 4UXHA 1UUCA 2N71A 4WP4A 3QTLD 5J8CA 1TBNA 1Z2IA 1FYBA 1P9ZA 3UGIA 3OXLA 1FY7A 3MEKA 2YQPA 1CSOI 2NU4I 2GIVA 7WGAA 1UVGA 2DIPA 2SGFI 2V53A 1FAQA 1H0ZA 5HI7A 1ULKA 3PDNA 2ENNA 1R0RI 2NU2I 1W3SA 5E3RA 3UEJA 2CWFA 1YU6C 2X3TA 3KY9A 2N17A 3VE5A 1IY6A 1KMAA 1TIHA 3R5CA 4E1PA 3VDUA 5CCMA 5E3QA 2UVOA 3D00A 3FSYA 1HJAI 2FNFX 3TO6A 1CE3A 3E59A 3E2IA 2M5XA 1Q9BA 1WTJA 2SGEI 2V1CA 4UXIA 1SGYI 3GOXA 2DB6A 2W0TA 2KCXA 1PJUA 1K7UA 2V1CC 2XRCA 1BMOA 2CJSC 3HH2C 3BJIA 2YUUA 3OVOA 1V1IA 2OZUA 2P6AC 3TOAA 5CCLA 2QPOA 3VDPA 2ELIA 1SGQI 4FKDA 1OMUA 3QAHA 1DS3I 2JYYA 3TOBA 2NU3I 2DKVA 2KMRA 2E5RA 3CXLA 1WKXA 2ORWA 4B6DA 1PCEA 2SGQI 2BUSA 4AMLA 1X74A 2WVJA
chains in the Genus database with same CATH topology
3QWPA 1CT0I 2KMOA 1CGJI 2KMPA 1PTRA 3OL0A 5FUWA 1TURA 1AN1I 1PPFI 2WCYA 4UXJA 2B8TA 1U5KA 2ENZA 3UFFA 1SGPI 2B0UC 3SEKC 5HQ8A 1RFHA 1HDLA 2N1AB 1TUSA 1OVOA 2J9RA 1UVFA 1CGII 2GKTI 2LUYA 2OD1A 2ODDA 1R79A 4SGBI 5FUXA 2KMQA 2SGDI 3SGBI 1DS2I 1SGEI 1SGRI 4GI3C 1CHOI 2OVOA 2QQCA 1XBTA 1N13A 2F3CI 3OXGA 4A24A 2QQDA 3UEYA 2QQ0A 5DAEA 1KBEA 1Y1BA 2JA1A 1LR8A 1YTPA 1SGNI 1LR9A 2NU0I 2ERWA 2ORVA 2GVIA 2LEOA 3TJQA 2ARPF 2J87A 2SGPI 1TOTA 1W4RA 2JZMA 2L8EA 1FARA 3B4VC 2QQEA 1Y8FA 5EX0A 1PTQA 2ROWA 1Y1CA 1XA6A 2UZ3A 1VDDA 3UGDA 1TBQR 1XX6A 1MT1A 1IW4A 1OMTA 4OVOA 2GKRI 2K9HA 1TBRR 4L9MA 1M8BA 1SGDI 5EX3A 1V1HA 1TBOA 2L7XA 2N52A 1CT4I 3FC3A 1IY5A 2E73A 4JCVE 3UGLA 1TGSI 1NUBA 1CT2I 1KBFA 2GKVA 1HPTA 1M8CA 4E1RA 5JHWC 2JXDA 3OXFA 2NU1I 4HGUA 3RU0A 2JW6A 5FUVA 1LR7A 3SGQI 1BUSA 2A20A 5FUYA 1Z7KB 2VRWB 1X4SA 1OYVI 4UXHA 1UUCA 2N71A 3QTLD 1TBNA 1FYBA 3UGIA 3OXLA 3MEKA 2YQPA 1CSOI 2NU4I 1UVGA 2DIPA 2SGFI 2V53A 1FAQA 1H0ZA 5HI7A 3PDNA 2ENNA 1R0RI 2NU2I 1W3SA 3UEJA 1YU6C 3KY9A 2N17A 3VE5A 1IY6A 1KMAA 1TIHA 4E1PA 3VDUA 5CCMA 3D00A 1HJAI 2FNFX 1CE3A 3E59A 3E2IA 2M5XA 2SGEI 2V1CA 4UXIA 1SGYI 3GOXA 2DB6A 2W0TA 2KCXA 1PJUA 2V1CC 2XRCA 1BMOA 2CJSC 3HH2C 3BJIA 2YUUA 3OVOA 1V1IA 2P6AC 5CCLA 2QPOA 3VDPA 2ELIA 1SGQI 4FKDA 1OMUA 1DS3I 2JYYA 2NU3I 2KMRA 2E5RA 3CXLA 2ORWA 4B6DA 1PCEA 2SGQI 2BUSA 1X74A 2WVJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CT0 I;  2KMO A;  1CGJ I;  2KMP A;  1TUR A;  1AN1 I;  1PPF I;  2WCY A;  1SGP I;  2B0U C;  3SEK C;  1HDL A;  1TUS A;  1OVO A;  1UVF A;  1CGI I;  2GKT I;  4SGB I;  2KMQ A;  2SGD I;  3SGB I;  1DS2 I;  1SGE I;  1SGR I;  4GI3 C;  1CHO I;  2OVO A;  2QQC A;  1N13 A;  2F3C I;  2QQD A;  5DAE A;  1Y1B A;  1LR8 A;  1YTP A;  1SGN I;  1LR9 A;  2NU0 I;  2ERW A;  2LEO A;  3TJQ A;  2ARP F;  2SGP I;  2JZM A;  3B4V C;  1Y1C A;  1TBQ R;  1MT1 A;  1IW4 A;  1OMT A;  4OVO A;  2GKR I;  1TBR R;  1M8B A;  1SGD I;  2N52 A;  1CT4 I;  1IY5 A;  1TGS I;  1NUB A;  1CT2 I;  2GKV A;  1HPT A;  1M8C A;  5JHW C;  2JXD A;  2NU1 I;  4HGU A;  1LR7 A;  3SGQ I;  1BUS A;  1Z7K B;  1OYV I;  1UUC A;  2N71 A;  3QTL D;  1FYB A;  1CSO I;  2NU4 I;  1UVG A;  2SGF I;  2V53 A;  1H0Z A;  1R0R I;  2NU2 I;  1YU6 C;  2N17 A;  1IY6 A;  1KMA A;  1TIH A;  1HJA I;  1CE3 A;  2M5X A;  2SGE I;  1SGY I;  2XRC A;  2KCX A;  1PJU A;  1BMO A;  3HH2 C;  3OVO A;  2P6A C;  1SGQ I;  1OMU A;  1DS3 I;  2JYY A;  2NU3 I;  2KMR A;  1PCE A;  2SGQ I;  2BUS A; 
#chains in the Genus database with same CATH topology
 3QWP A;  1CT0 I;  2KMO A;  1CGJ I;  2KMP A;  1PTR A;  3OL0 A;  5FUW A;  9WGA A;  1TUR A;  1AN1 I;  1PPF I;  1K7T A;  2WCY A;  2B8T A;  1U5K A;  2ENZ A;  4UXJ A;  3UFF A;  1SGP I;  3FSX A;  2B0U C;  3SEK C;  5HQ8 A;  4MPI A;  1RFH A;  1HDL A;  2N1A B;  1TUS A;  1OVO A;  2J9R A;  1UVF A;  1CGI I;  2GKT I;  2CWH A;  2LUY A;  2ODD A;  1R79 A;  2OD1 A;  2OU2 A;  4SGB I;  2KMQ A;  2SGD I;  3R5D A;  3SGB I;  1DS2 I;  1SGE I;  1SGR I;  4GI3 C;  5FUX A;  1CHO I;  2OVO A;  5J8F A;  2QQC A;  1XBT A;  1N13 A;  2Y0M A;  2F3C I;  3OXG A;  4A24 A;  5E3P A;  2QQD A;  3UEY A;  2QQ0 A;  5DAE A;  1KBE A;  1WGC A;  1Y1B A;  2JA1 A;  1LR8 A;  1YTP A;  2RIJ A;  1SGN I;  1LR9 A;  2NU0 I;  2ERW A;  2ORV A;  1ULM A;  2GVI A;  2LEO A;  3UOE A;  3TJQ A;  2ARP F;  2J87 A;  2SGP I;  1TOT A;  1W4R A;  2JZM A;  2L8E A;  1FAR A;  3B4V C;  2QQE A;  1Y8F A;  1HEV A;  5EX0 A;  1PTQ A;  2ROW A;  1Y1C A;  1XA6 A;  1MJB A;  2UZ3 A;  1VDD A;  3UGD A;  1TBQ R;  1XX6 A;  1MT1 A;  2LB7 A;  1IW4 A;  1OMT A;  4OVO A;  1ULN A;  2GKR I;  1K7V A;  2K9H A;  3R5A A;  1TBR R;  4L9M A;  1M8B A;  1SGD I;  5EX3 A;  1V1H A;  1TBO A;  2L7X A;  2N52 A;  1CT4 I;  2RC4 A;  2WGC A;  3FC3 A;  2E73 A;  4JCV E;  1IY5 A;  3UGL A;  1TGS I;  1NUB A;  1CT2 I;  1MJ9 A;  1S20 A;  2GKV A;  1KBF A;  3R5B A;  1HPT A;  3TO9 A;  1M8C A;  2X52 A;  1UHA A;  4E1R A;  4DNC A;  5JHW C;  2JXD A;  3OXF A;  2NU1 I;  4HGU A;  3RU0 A;  2JW6 A;  5FUV A;  1MJA A;  2CWG A;  1LR7 A;  3SGQ I;  1BUS A;  1P9G A;  1WGT A;  2A20 A;  1NXU A;  5FUY A;  1Z7K B;  2VRW B;  2PQ8 A;  3TO7 A;  1X4S A;  1OYV I;  4UXH A;  1UUC A;  2N71 A;  4WP4 A;  3QTL D;  5J8C A;  1TBN A;  1Z2I A;  1FYB A;  1P9Z A;  3UGI A;  3OXL A;  1FY7 A;  3MEK A;  2YQP A;  1CSO I;  2NU4 I;  2GIV A;  7WGA A;  1UVG A;  2DIP A;  2SGF I;  2V53 A;  1FAQ A;  1H0Z A;  5HI7 A;  1ULK A;  3PDN A;  2ENN A;  1R0R I;  2NU2 I;  1W3S A;  5E3R A;  3UEJ A;  2CWF A;  1YU6 C;  2X3T A;  3KY9 A;  2N17 A;  3VE5 A;  1IY6 A;  1KMA A;  1TIH A;  3R5C A;  4E1P A;  3VDU A;  5CCM A;  5E3Q A;  2UVO A;  3D00 A;  3FSY A;  1HJA I;  2FNF X;  3TO6 A;  1CE3 A;  3E59 A;  3E2I A;  2M5X A;  1Q9B A;  1WTJ A;  2SGE I;  2V1C A;  4UXI A;  1SGY I;  3GOX A;  2DB6 A;  2W0T A;  2KCX A;  1PJU A;  1K7U A;  2V1C C;  2XRC A;  1BMO A;  2CJS C;  3HH2 C;  3BJI A;  2YUU A;  3OVO A;  1V1I A;  2OZU A;  2P6A C;  3TOA A;  5CCL A;  2QPO A;  3VDP A;  2ELI A;  1SGQ I;  4FKD A;  1OMU A;  3QAH A;  1DS3 I;  2JYY A;  3TOB A;  2NU3 I;  2DKV A;  2KMR A;  2E5R A;  3CXL A;  1WKX A;  2ORW A;  4B6D A;  1PCE A;  2SGQ I;  2BUS A;  4AML A;  1X74 A;  2WVJ A; 
#chains in the Genus database with same CATH homology
 3QWP A;  1CT0 I;  2KMO A;  1CGJ I;  2KMP A;  1PTR A;  3OL0 A;  5FUW A;  1TUR A;  1AN1 I;  1PPF I;  2WCY A;  4UXJ A;  2B8T A;  1U5K A;  2ENZ A;  3UFF A;  1SGP I;  2B0U C;  3SEK C;  5HQ8 A;  1RFH A;  1HDL A;  2N1A B;  1TUS A;  1OVO A;  2J9R A;  1UVF A;  1CGI I;  2GKT I;  2LUY A;  2OD1 A;  2ODD A;  1R79 A;  4SGB I;  5FUX A;  2KMQ A;  2SGD I;  3SGB I;  1DS2 I;  1SGE I;  1SGR I;  4GI3 C;  1CHO I;  2OVO A;  2QQC A;  1XBT A;  1N13 A;  2F3C I;  3OXG A;  4A24 A;  2QQD A;  3UEY A;  2QQ0 A;  5DAE A;  1KBE A;  1Y1B A;  2JA1 A;  1LR8 A;  1YTP A;  1SGN I;  1LR9 A;  2NU0 I;  2ERW A;  2ORV A;  2GVI A;  2LEO A;  3TJQ A;  2ARP F;  2J87 A;  2SGP I;  1TOT A;  1W4R A;  2JZM A;  2L8E A;  1FAR A;  3B4V C;  2QQE A;  1Y8F A;  5EX0 A;  1PTQ A;  2ROW A;  1Y1C A;  1XA6 A;  2UZ3 A;  1VDD A;  3UGD A;  1TBQ R;  1XX6 A;  1MT1 A;  1IW4 A;  1OMT A;  4OVO A;  2GKR I;  2K9H A;  1TBR R;  4L9M A;  1M8B A;  1SGD I;  5EX3 A;  1V1H A;  1TBO A;  2L7X A;  2N52 A;  1CT4 I;  3FC3 A;  1IY5 A;  2E73 A;  4JCV E;  3UGL A;  1TGS I;  1NUB A;  1CT2 I;  1KBF A;  2GKV A;  1HPT A;  1M8C A;  4E1R A;  5JHW C;  2JXD A;  3OXF A;  2NU1 I;  4HGU A;  3RU0 A;  2JW6 A;  5FUV A;  1LR7 A;  3SGQ I;  1BUS A;  2A20 A;  5FUY A;  1Z7K B;  2VRW B;  1X4S A;  1OYV I;  4UXH A;  1UUC A;  2N71 A;  3QTL D;  1TBN A;  1FYB A;  3UGI A;  3OXL A;  3MEK A;  2YQP A;  1CSO I;  2NU4 I;  1UVG A;  2DIP A;  2SGF I;  2V53 A;  1FAQ A;  1H0Z A;  5HI7 A;  3PDN A;  2ENN A;  1R0R I;  2NU2 I;  1W3S A;  3UEJ A;  1YU6 C;  3KY9 A;  2N17 A;  3VE5 A;  1IY6 A;  1KMA A;  1TIH A;  4E1P A;  3VDU A;  5CCM A;  3D00 A;  1HJA I;  2FNF X;  1CE3 A;  3E59 A;  3E2I A;  2M5X A;  2SGE I;  2V1C A;  4UXI A;  1SGY I;  3GOX A;  2DB6 A;  2W0T A;  2KCX A;  1PJU A;  2V1C C;  2XRC A;  1BMO A;  2CJS C;  3HH2 C;  3BJI A;  2YUU A;  3OVO A;  1V1I A;  2P6A C;  5CCL A;  2QPO A;  3VDP A;  2ELI A;  1SGQ I;  4FKD A;  1OMU A;  1DS3 I;  2JYY A;  2NU3 I;  2KMR A;  2E5R A;  3CXL A;  2ORW A;  4B6D A;  1PCE A;  2SGQ I;  2BUS A;  1X74 A;  2WVJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...