1HPTA

Three-dimensional structure of a recombinant variant of human pancreatic secretory trypsin inhibitor (kazal type)
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
56
structure length
56
Chain Sequence
DSLGREAKCYNELNGCTYEYRPVCGTDGDTYPNECVLCFENRKRQTSILIQKSGPC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three-dimensional structure of a recombinant variant of human pancreatic secretory trypsin inhibitor (Kazal type).
pubmed doi rcsb
molecule keywords PANCREATIC SECRETORY TRYPSIN INHIBITOR (KAZAL TYPE) VARIANT
molecule tags Serine protease inhibitor
source organism Homo sapiens
total genus 13
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 1992-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00050 Kazal_1 Kazal-type serine protease inhibitor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1hptA00
1IW4A 4SGBI 2NU1I 1SGQI 1CGJI 3SGBI 2NU4I 2QQDA 2JZMA 2NU0I 1CHOI 3SEKC 4OVOA 1SGPI 5JHWC 1LR9A 2M5XA 1TBQR 2NU2I 1HPTA 1TGSI 2KMQA 2KMPA 1KMAA 3TJQA 1M8CA 1CGII 4GI3C 2N17A 1Z7KB 1OMUA 1Y1CA 1UVGA 1BUSA 1UUCA 2JXDA 1IY5A 2N71A 2LEOA 2SGPI 1CT0I 1AN1I 1SGYI 1PPFI 2XRCA 1LR8A 1CT4I 1N13A 1SGNI 1SGEI 2ARPF 2ERWA 1MT1A 1YTPA 1CT2I 1DS2I 2SGEI 1CSOI 2QQCA 3B4VC 2NU3I 2GKTI 1TUSA 3OVOA 2BUSA 1R0RI 1TBRR 1DS3I 2KMOA 1M8BA 1OVOA 2P6AC 1TIHA 1LR7A 2WCYA 5DAEA 1BMOA 3QTLD 1YU6C 1HDLA 1PJUA 2SGFI 3SGQI 1H0ZA 1SGDI 1OYVI 2JYYA 2V53A 2KCXA 1PCEA 1OMTA 3HH2C 1SGRI 2GKVA 1NUBA 2KMRA 1Y1BA 2SGQI 2B0UC 4HGUA 1HJAI 2N52A 1IY6A 2OVOA 1CE3A 1UVFA 2SGDI 1TURA 2GKRI 2F3CI 1FYBA
chains in the Genus database with same CATH superfamily
2DIPA 5EX0A 1IW4A 1UHAA 4SGBI 3VDUA 2NU1I 1SGQI 1V1HA 5FUYA 1CGJI 1K7TA 7WGAA 3SGBI 3TOAA 2NU4I 1WGTA 9WGAA 5HQ8A 1Q9BA 2QQDA 2JZMA 2E5RA 3QAHA 3UEYA 2NU0I 5FUWA 1W3SA 1CHOI 3SEKC 4OVOA 3TO9A 1PTQA 1X74A 1SGPI 5JHWC 5HI7A 1LR9A 4L9MA 2OU2A 3D00A 2V1CA 1WTJA 2UVOA 4UXJA 3OXGA 4WP4A 1ULNA 2ROWA 1W4RA 2M5XA 1TBQR 2NU2I 1HPTA 3MEKA 1TGSI 4FKDA 1FYBA 2KMQA 2KMPA 3UOEA 1KMAA 1NXUA 3TJQA 3BJIA 1M8CA 1CGII 4GI3C 3R5CA 2ORVA 5J8FA 2N17A 2LB7A 1VDDA 3FSXA 1Z7KB 1OMUA 2CWGA 1Y1CA 3R5DA 1UVGA 1BUSA 2JW6A 1UUCA 2WVJA 1R79A 1FAQA 2JXDA 2LUYA 3CXLA 2RC4A 3QWPA 5EX3A 1TBNA 2N71A 4A24A 2LEOA 2SGPI 1IY5A 2A20A 1CT0I 1HEVA 2DB6A 1AN1I 1SGYI 1PPFI 2ODDA 3RU0A 2K9HA 4DNCA 2XRCA 1LR8A 2QQEA 2GIVA 1MJ9A 1CT4I 4E1PA 1N13A 1PTRA 1SGEI 1SGNI 3OXLA 1KBFA 2ARPF 1K7VA 2CWFA 3OL0A 3R5AA 3UGLA 3TO7A 1WGCA 3PDNA 2ERWA 1MT1A 2X52A 5FUXA 3FSYA 1YTPA 3FC3A 1CT2I 1DS2I 1V1IA 2SGEI 3UGDA 1CSOI 2QQCA 3B4VC 2NU3I 2Y0MA 2GKTI 1TUSA 2CWHA 1P9ZA 2GVIA 3OVOA 2BUSA 2N1AB 1XBTA 1R0RI 1TBRR 1U5KA 2QQ0A 5J8CA 4E1RA 5CCMA 1DS3I 2KMOA 1M8BA 2B8TA 2ENNA 1XA6A 2J9RA 1OVOA 2E73A 2P6AC 2L7XA 5E3PA 1TIHA 1LR7A 1MJBA 2WCYA 2YQPA 4JCVE 2L8EA 1BMOA 2OZUA 4MPIA 5DAEA 1WKXA 1S20A 1MJAA 1TBOA 3VDPA 3QTLD 1YU6C 2DKVA 3TOBA 1HDLA 1PJUA 2SGFI 4UXHA 2OD1A 1FY7A 1SGDI 3SGQI 1OYVI 2JYYA 5CCLA 1H0ZA 3GOXA 2V53A 2KCXA 1PCEA 3UEJA 3UFFA 1OMTA 2J87A 2V1CC 2VRWB 3HH2C 3TO6A 1SGRI 1Z2IA 1P9GA 1KBEA 2GKVA 1FARA 1Y8FA 1NUBA 2X3TA 2KMRA 1RFHA 1TOTA 1XX6A 1Y1BA 5E3QA 3E2IA 3VE5A 2UZ3A 2SGQI 2B0UC 2W0TA 3OXFA 4UXIA 2PQ8A 3R5BA 2FNFX 2ORWA 2ELIA 4HGUA 4B6DA 1HJAI 2WGCA 1K7UA 2N52A 2QPOA 3E59A 1IY6A 2JA1A 2OVOA 2ENZA 2YUUA 1UVFA 1ULMA 3KY9A 1CE3A 5FUVA 4AMLA 2SGDI 1TURA 1X4SA 2CJSC 2GKRI 2RIJA 2F3CI 3UGIA 1ULKA 5E3RA
chains in the Genus database with same CATH topology
2DIPA 5EX0A 1IW4A 4SGBI 3VDUA 2NU1I 1SGQI 1V1HA 5FUYA 1CGJI 3SGBI 2NU4I 5HQ8A 2QQDA 2JZMA 2E5RA 3UEYA 2NU0I 5FUWA 1W3SA 1CHOI 3SEKC 4OVOA 1PTQA 1X74A 1SGPI 5JHWC 5HI7A 1LR9A 4L9MA 3D00A 2V1CA 4UXJA 3OXGA 2ROWA 1W4RA 2M5XA 1TBQR 2NU2I 1HPTA 3MEKA 1TGSI 4FKDA 1FYBA 2KMQA 2KMPA 1KMAA 3TJQA 3BJIA 1M8CA 1CGII 4GI3C 2ORVA 2N17A 1VDDA 1Z7KB 1OMUA 1Y1CA 1UVGA 1BUSA 2JW6A 1UUCA 2WVJA 1R79A 1FAQA 2JXDA 2LUYA 3CXLA 3QWPA 5EX3A 4A24A 1TBNA 2N71A 1IY5A 2LEOA 2SGPI 2A20A 1CT0I 2DB6A 1AN1I 1SGYI 1PPFI 2ODDA 3RU0A 2K9HA 2XRCA 1LR8A 2QQEA 1CT4I 4E1PA 1N13A 1PTRA 1SGEI 1SGNI 3OXLA 1KBFA 2ARPF 3OL0A 3UGLA 3PDNA 2ERWA 1MT1A 5FUXA 1YTPA 3FC3A 1CT2I 1DS2I 1V1IA 2SGEI 3UGDA 1CSOI 2QQCA 3B4VC 2NU3I 2GKTI 1TUSA 2GVIA 3OVOA 2BUSA 2N1AB 1XBTA 1R0RI 1TBRR 1U5KA 2QQ0A 4E1RA 5CCMA 1DS3I 2KMOA 1M8BA 2B8TA 2ENNA 1XA6A 2J9RA 1OVOA 2E73A 2P6AC 2L7XA 1TIHA 1LR7A 2WCYA 2YQPA 4JCVE 2L8EA 1BMOA 5DAEA 3VDPA 1TBOA 3QTLD 1YU6C 1HDLA 1PJUA 2SGFI 4UXHA 2OD1A 3SGQI 1SGDI 5CCLA 1OYVI 2JYYA 1H0ZA 3GOXA 2V53A 2KCXA 1PCEA 3UEJA 3UFFA 1OMTA 2J87A 2V1CC 2VRWB 3HH2C 1SGRI 1KBEA 2GKVA 1FARA 1Y8FA 1NUBA 2KMRA 1RFHA 1Y1BA 1XX6A 3E2IA 3VE5A 2UZ3A 2SGQI 2B0UC 2W0TA 3OXFA 4UXIA 2FNFX 2ORWA 2ELIA 4HGUA 4B6DA 1HJAI 3E59A 2N52A 2QPOA 1IY6A 2JA1A 2OVOA 2ENZA 2YUUA 1UVFA 3KY9A 1CE3A 5FUVA 2SGDI 1TURA 2CJSC 1X4SA 2GKRI 2F3CI 3UGIA 1TOTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IW4 A;  4SGB I;  2NU1 I;  1SGQ I;  1CGJ I;  3SGB I;  2NU4 I;  2QQD A;  2JZM A;  2NU0 I;  1CHO I;  3SEK C;  4OVO A;  1SGP I;  5JHW C;  1LR9 A;  2M5X A;  1TBQ R;  2NU2 I;  1HPT A;  1TGS I;  2KMQ A;  2KMP A;  1KMA A;  3TJQ A;  1M8C A;  1CGI I;  4GI3 C;  2N17 A;  1Z7K B;  1OMU A;  1Y1C A;  1UVG A;  1BUS A;  1UUC A;  2JXD A;  1IY5 A;  2N71 A;  2LEO A;  2SGP I;  1CT0 I;  1AN1 I;  1SGY I;  1PPF I;  2XRC A;  1LR8 A;  1CT4 I;  1N13 A;  1SGN I;  1SGE I;  2ARP F;  2ERW A;  1MT1 A;  1YTP A;  1CT2 I;  1DS2 I;  2SGE I;  1CSO I;  2QQC A;  3B4V C;  2NU3 I;  2GKT I;  1TUS A;  3OVO A;  2BUS A;  1R0R I;  1TBR R;  1DS3 I;  2KMO A;  1M8B A;  1OVO A;  2P6A C;  1TIH A;  1LR7 A;  2WCY A;  5DAE A;  1BMO A;  3QTL D;  1YU6 C;  1HDL A;  1PJU A;  2SGF I;  3SGQ I;  1H0Z A;  1SGD I;  1OYV I;  2JYY A;  2V53 A;  2KCX A;  1PCE A;  1OMT A;  3HH2 C;  1SGR I;  2GKV A;  1NUB A;  2KMR A;  1Y1B A;  2SGQ I;  2B0U C;  4HGU A;  1HJA I;  2N52 A;  1IY6 A;  2OVO A;  1CE3 A;  1UVF A;  2SGD I;  1TUR A;  2GKR I;  2F3C I;  1FYB A; 
#chains in the Genus database with same CATH topology
 2DIP A;  5EX0 A;  1IW4 A;  1UHA A;  4SGB I;  3VDU A;  2NU1 I;  1SGQ I;  1V1H A;  5FUY A;  1CGJ I;  1K7T A;  7WGA A;  3SGB I;  3TOA A;  2NU4 I;  1WGT A;  9WGA A;  5HQ8 A;  1Q9B A;  2QQD A;  2JZM A;  2E5R A;  3QAH A;  3UEY A;  2NU0 I;  5FUW A;  1W3S A;  1CHO I;  3SEK C;  4OVO A;  3TO9 A;  1PTQ A;  1X74 A;  1SGP I;  5JHW C;  5HI7 A;  1LR9 A;  4L9M A;  2OU2 A;  3D00 A;  2V1C A;  1WTJ A;  2UVO A;  4UXJ A;  3OXG A;  4WP4 A;  1ULN A;  2ROW A;  1W4R A;  2M5X A;  1TBQ R;  2NU2 I;  1HPT A;  3MEK A;  1TGS I;  4FKD A;  1FYB A;  2KMQ A;  2KMP A;  3UOE A;  1KMA A;  1NXU A;  3TJQ A;  3BJI A;  1M8C A;  1CGI I;  4GI3 C;  3R5C A;  2ORV A;  5J8F A;  2N17 A;  2LB7 A;  1VDD A;  3FSX A;  1Z7K B;  1OMU A;  2CWG A;  1Y1C A;  3R5D A;  1UVG A;  1BUS A;  2JW6 A;  1UUC A;  2WVJ A;  1R79 A;  1FAQ A;  2JXD A;  2LUY A;  3CXL A;  2RC4 A;  3QWP A;  5EX3 A;  1TBN A;  2N71 A;  4A24 A;  2LEO A;  2SGP I;  1IY5 A;  2A20 A;  1CT0 I;  1HEV A;  2DB6 A;  1AN1 I;  1SGY I;  1PPF I;  2ODD A;  3RU0 A;  2K9H A;  4DNC A;  2XRC A;  1LR8 A;  2QQE A;  2GIV A;  1MJ9 A;  1CT4 I;  4E1P A;  1N13 A;  1PTR A;  1SGE I;  1SGN I;  3OXL A;  1KBF A;  2ARP F;  1K7V A;  2CWF A;  3OL0 A;  3R5A A;  3UGL A;  3TO7 A;  1WGC A;  3PDN A;  2ERW A;  1MT1 A;  2X52 A;  5FUX A;  3FSY A;  1YTP A;  3FC3 A;  1CT2 I;  1DS2 I;  1V1I A;  2SGE I;  3UGD A;  1CSO I;  2QQC A;  3B4V C;  2NU3 I;  2Y0M A;  2GKT I;  1TUS A;  2CWH A;  1P9Z A;  2GVI A;  3OVO A;  2BUS A;  2N1A B;  1XBT A;  1R0R I;  1TBR R;  1U5K A;  2QQ0 A;  5J8C A;  4E1R A;  5CCM A;  1DS3 I;  2KMO A;  1M8B A;  2B8T A;  2ENN A;  1XA6 A;  2J9R A;  1OVO A;  2E73 A;  2P6A C;  2L7X A;  5E3P A;  1TIH A;  1LR7 A;  1MJB A;  2WCY A;  2YQP A;  4JCV E;  2L8E A;  1BMO A;  2OZU A;  4MPI A;  5DAE A;  1WKX A;  1S20 A;  1MJA A;  1TBO A;  3VDP A;  3QTL D;  1YU6 C;  2DKV A;  3TOB A;  1HDL A;  1PJU A;  2SGF I;  4UXH A;  2OD1 A;  1FY7 A;  1SGD I;  3SGQ I;  1OYV I;  2JYY A;  5CCL A;  1H0Z A;  3GOX A;  2V53 A;  2KCX A;  1PCE A;  3UEJ A;  3UFF A;  1OMT A;  2J87 A;  2V1C C;  2VRW B;  3HH2 C;  3TO6 A;  1SGR I;  1Z2I A;  1P9G A;  1KBE A;  2GKV A;  1FAR A;  1Y8F A;  1NUB A;  2X3T A;  2KMR A;  1RFH A;  1TOT A;  1XX6 A;  1Y1B A;  5E3Q A;  3E2I A;  3VE5 A;  2UZ3 A;  2SGQ I;  2B0U C;  2W0T A;  3OXF A;  4UXI A;  2PQ8 A;  3R5B A;  2FNF X;  2ORW A;  2ELI A;  4HGU A;  4B6D A;  1HJA I;  2WGC A;  1K7U A;  2N52 A;  2QPO A;  3E59 A;  1IY6 A;  2JA1 A;  2OVO A;  2ENZ A;  2YUU A;  1UVF A;  1ULM A;  3KY9 A;  1CE3 A;  5FUV A;  4AML A;  2SGD I;  1TUR A;  1X4S A;  2CJS C;  2GKR I;  2RIJ A;  2F3C I;  3UGI A;  1ULK A;  5E3R A; 
#chains in the Genus database with same CATH homology
 2DIP A;  5EX0 A;  1IW4 A;  4SGB I;  3VDU A;  2NU1 I;  1SGQ I;  1V1H A;  5FUY A;  1CGJ I;  3SGB I;  2NU4 I;  5HQ8 A;  2QQD A;  2JZM A;  2E5R A;  3UEY A;  2NU0 I;  5FUW A;  1W3S A;  1CHO I;  3SEK C;  4OVO A;  1PTQ A;  1X74 A;  1SGP I;  5JHW C;  5HI7 A;  1LR9 A;  4L9M A;  3D00 A;  2V1C A;  4UXJ A;  3OXG A;  2ROW A;  1W4R A;  2M5X A;  1TBQ R;  2NU2 I;  1HPT A;  3MEK A;  1TGS I;  4FKD A;  1FYB A;  2KMQ A;  2KMP A;  1KMA A;  3TJQ A;  3BJI A;  1M8C A;  1CGI I;  4GI3 C;  2ORV A;  2N17 A;  1VDD A;  1Z7K B;  1OMU A;  1Y1C A;  1UVG A;  1BUS A;  2JW6 A;  1UUC A;  2WVJ A;  1R79 A;  1FAQ A;  2JXD A;  2LUY A;  3CXL A;  3QWP A;  5EX3 A;  4A24 A;  1TBN A;  2N71 A;  1IY5 A;  2LEO A;  2SGP I;  2A20 A;  1CT0 I;  2DB6 A;  1AN1 I;  1SGY I;  1PPF I;  2ODD A;  3RU0 A;  2K9H A;  2XRC A;  1LR8 A;  2QQE A;  1CT4 I;  4E1P A;  1N13 A;  1PTR A;  1SGE I;  1SGN I;  3OXL A;  1KBF A;  2ARP F;  3OL0 A;  3UGL A;  3PDN A;  2ERW A;  1MT1 A;  5FUX A;  1YTP A;  3FC3 A;  1CT2 I;  1DS2 I;  1V1I A;  2SGE I;  3UGD A;  1CSO I;  2QQC A;  3B4V C;  2NU3 I;  2GKT I;  1TUS A;  2GVI A;  3OVO A;  2BUS A;  2N1A B;  1XBT A;  1R0R I;  1TBR R;  1U5K A;  2QQ0 A;  4E1R A;  5CCM A;  1DS3 I;  2KMO A;  1M8B A;  2B8T A;  2ENN A;  1XA6 A;  2J9R A;  1OVO A;  2E73 A;  2P6A C;  2L7X A;  1TIH A;  1LR7 A;  2WCY A;  2YQP A;  4JCV E;  2L8E A;  1BMO A;  5DAE A;  3VDP A;  1TBO A;  3QTL D;  1YU6 C;  1HDL A;  1PJU A;  2SGF I;  4UXH A;  2OD1 A;  3SGQ I;  1SGD I;  5CCL A;  1OYV I;  2JYY A;  1H0Z A;  3GOX A;  2V53 A;  2KCX A;  1PCE A;  3UEJ A;  3UFF A;  1OMT A;  2J87 A;  2V1C C;  2VRW B;  3HH2 C;  1SGR I;  1KBE A;  2GKV A;  1FAR A;  1Y8F A;  1NUB A;  2KMR A;  1RFH A;  1Y1B A;  1XX6 A;  3E2I A;  3VE5 A;  2UZ3 A;  2SGQ I;  2B0U C;  2W0T A;  3OXF A;  4UXI A;  2FNF X;  2ORW A;  2ELI A;  4HGU A;  4B6D A;  1HJA I;  3E59 A;  2N52 A;  2QPO A;  1IY6 A;  2JA1 A;  2OVO A;  2ENZ A;  2YUU A;  1UVF A;  3KY9 A;  1CE3 A;  5FUV A;  2SGD I;  1TUR A;  2CJS C;  1X4S A;  2GKR I;  2F3C I;  3UGI A;  1TOT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...