1HPUA

5'-nucleotidase (closed form), complex with ampcp
Total Genus 174
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
174
sequence length
525
structure length
525
Chain Sequence
YEQDKTYKITVLHTNDHHGHFWRNEYGEYGLAAQKTLVDGIRKEVAAEGGSVLLLSGGDINTGVPESDLQDAEPDFRGMNLVGYDAMAIGNHEFDNPLTVLRQQEKWAKFPLLSANIYQKSTGERLFKPWALFKRQDLKIAVIGLTTDDTAKIGNPEYFTDIEFRKPADEAKLVIQELQQTEKPDIIIAATHMGHYDNGEHGSNAPGDVEMARALPAGSLAMIVGGHSQDPVCMAAENKKQVDYVPGTPCKPDQQNGIWIVQAHEWGKYVGRADFEFRNGEMKMVNYQLIPVNLKKKVTWEDGKSERVLYTPEIAENQQMISLLSPFQNKGKAQLEVKIGETNGRLEGDRDKVRFVQTNMGRLILAAQMDRTGADFAVMSGGGIRDSIEAGDISYKNVLKVQPFGNVVVYADMTGKEVIDYLTAVAQMKPDSGAYPQFANVSFVAKDGKLNDLKIKGEPVDPAKTYRMATLNFNATGGDGYPRLDNKPGYVNTGFIDAEVLKAYIQKSSPLDVSVYEPKGEVSWQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Mechanism of hydrolysis of phosphate esters by the dimetal center of 5'-nucleotidase based on crystal structures.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords 5'-NUCLEOTIDASE
total genus 174
structure length 525
sequence length 525
chains with identical sequence B, C, D
ec nomenclature ec 3.1.3.5: 5'-nucleotidase.
pdb deposition date 2000-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
A PF02872 5_nucleotid_C 5'-nucleotidase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 1hpuA01
3.90.780.10 Alpha Beta Alpha-Beta Complex 5'-nucleotidase; domain 2 5'-Nucleotidase, C-terminal domain 1hpuA02
2NYMC 2YVTA 4ORAA 4MOVA 4WWLA 2QJCA 2HYPA 3T1IA 4HD0A 1XM7A 3DW8C 3H68A 4G9JA 3H62B 5GTUA 3H69A 4DHLA 5HPEA 2WDEA 3ZU0A 5DNYA 3ICFA 4V0VA 1QFCA 3HVQA 4V0XA 4H1YP 4MOYA 3EGGA 4KBPA 2KKNA 2NPPC 4V0WA 5EQVA 4B2OA 1T70A 1Z2XA 3RQZA 4FBKA 4UWQA 3H61A 5C1VA 1UF3A 4LTYA 2Z72A 3V4YA 1SU1A 1S95A 3H63A 1OI8A 4O24A 2XMOA 1IT6A 1UTEA 3RL3A 3JYFA 3IVEA 4DSYA 1V73A 3KBPA 1OIEA 2QFPA 2WDDA 3PSNA 1FJMA 2WDFA 3H64A 4OR9A 1TCOA 3GVEA 4IL1A 3RL4A 3FGAC 2R17A 2O8AA 1HO5A 4UT2A 5B8IA 1S8EA 3H67A 2NYLC 1S3LA 3P71C 3THOB 1WAO1 3H60A 1HPUA 1W24A 4Q7FA 4LACC 2A22A 1T71A 4MP0A 3QFOA 3QFKA 1WARA 4FCXA 1S70A 3AUZA 2IAEC 2NXFA 2BQ8X 3DSCA 2Q8UA 3N5UA 2DFJA 4F0ZA 4XPNA 3E7BA 2USHA 2Z1AA 3H66A 3K7WC 1NNWA 3AV0A 2BCDA 1G5BA 3IVDA 4H2BA 4J6OA 3DSDA 4I5NC 1S3MA 3E7AA 3CK2A 2Z06A 3RL5A 1XZWA 2AHDA 3LL8A 4H2FA 2IE3C 3TGHA 5F3WA 4LU9A 1AUIA 2HYOA 4DT2A 4UT3A 5IOHA 3THNA 1M63A 3ZTVA 4IYPC 2JOGA 2CV9A 4UT3B 2HY1A 2GJUA 5INBA 1II7A 3IB7A 1QHWA 4TUIA 3IB8A 4O4KA 3QFMA 1S3NA 1Z2WA 1HP1A 3PSOA 1MF8A 4NZVA 5JPEA 4ZX2A 3C9FA 4M0VA 1USHA 1U32A 4JA9A 4H2GA 4ORBA 4YKEA 4I5LC 1KBPA 4ZVZA 3EGHA 1OIDA 1JK7A 2P6BA 2ZBMA 4ORCA 4FBQA 4TUGA 5JJTA 2WDCA 4KKZA 3K7VC 2IE4C 3QFNA 2QFRA 4O5GA 3QG5C 5J28A 4H2IA 4H1SA 5JPFA 3C5WC 4O43A 2BDXA 4JA7A 4FBWA 2O8GA
chains in the Genus database with same CATH superfamily
2NYMC 2YVTA 4ORAA 4MOVA 4WWLA 2QJCA 2HYPA 3T1IA 4HD0A 1XM7A 3DW8C 3H68A 4G9JA 3H62B 5GTUA 3H69A 4DHLA 5HPEA 2WDEA 3ZU0A 5DNYA 3ICFA 4V0VA 3E0JA 1QFCA 3HVQA 4V0XA 4H1YP 4MOYA 3EGGA 4KBPA 2KKNA 2NPPC 4V0WA 5EQVA 4B2OA 1T70A 1Z2XA 2DXNA 3RQZA 2ZOAA 4FBKA 4UWQA 3H61A 5C1VA 1UF3A 4LTYA 2Z72A 3V4YA 1SU1A 1S95A 3H63A 1OI8A 4O24A 2XMOA 1IT6A 1UTEA 3RL3A 3JYFA 3IVEA 4DSYA 1V73A 3KBPA 1OIEA 2QFPA 2WDDA 3PSNA 1FJMA 2WDFA 3H64A 4OR9A 1TCOA 3GVEA 4IL1A 3RL4A 3FGAC 2R17A 2O8AA 1HO5A 4UT2A 5B8IA 2ZO9B 1S8EA 3H67A 2NYLC 1S3LA 3P71C 3THOB 1WAO1 3H60A 1HPUA 1W24A 4Q7FA 4LACC 2A22A 1T71A 4MP0A 3QFOA 3QFKA 1WARA 4FCXA 1S70A 3AUZA 2IAEC 2NXFA 2BQ8X 3DSCA 2Q8UA 3N5UA 2DFJA 4F0ZA 4XPNA 3E7BA 2USHA 2Z1AA 3H66A 3K7WC 1NNWA 3AV0A 2BCDA 1G5BA 3IVDA 3D03A 4H2BA 4J6OA 4I5NC 3DSDA 1S3MA 3E7AA 2DXLA 2Z06A 3CK2A 3RL5A 1XZWA 2AHDA 3LL8A 4H2FA 2IE3C 3TGHA 5F3WA 4LU9A 1AUIA 2HYOA 4DT2A 4UT3A 5IOHA 2YEQA 3THNA 1M63A 3ZTVA 4IYPC 2JOGA 2CV9A 4UT3B 2HY1A 2GJUA 5INBA 1II7A 3IB7A 3FLOA 1QHWA 4TUIA 3IB8A 4O4KA 3QFMA 1S3NA 1Z2WA 1HP1A 3PSOA 1MF8A 4NZVA 5JPEA 4ZX2A 3C9FA 4M0VA 1USHA 1U32A 4JA9A 4H2GA 4ORBA 4YKEA 4I5LC 1KBPA 4ZVZA 3EGHA 1OIDA 1JK7A 2P6BA 2ZBMA 4ORCA 4FBQA 4TUGA 5JJTA 2WDCA 4KKZA 3K7VC 2IE4C 3QFNA 2QFRA 4O5GA 3QG5C 5J28A 4H2IA 4H1SA 5JPFA 3C5WC 4O43A 2BDXA 4JA7A 4FBWA 2O8GA
chains in the Genus database with same CATH topology
2NYMC 2YVTA 4ORAA 4MOVA 4WWLA 2QJCA 2HYPA 3T1IA 4HD0A 1XM7A 3DW8C 3H68A 4G9JA 3H62B 5GTUA 3H69A 4DHLA 5HPEA 2WDEA 3ZU0A 5DNYA 3ICFA 4V0VA 3E0JA 1QFCA 3HVQA 4V0XA 4H1YP 4MOYA 3EGGA 4KBPA 2KKNA 2NPPC 4V0WA 5EQVA 4B2OA 1T70A 1Z2XA 2DXNA 3RQZA 2ZOAA 4FBKA 4UWQA 3H61A 5C1VA 1UF3A 4LTYA 2Z72A 3V4YA 1SU1A 1S95A 3H63A 1OI8A 4O24A 2XMOA 1IT6A 1UTEA 3RL3A 3JYFA 3IVEA 4DSYA 1V73A 3KBPA 1OIEA 2QFPA 2WDDA 3PSNA 1FJMA 2WDFA 3H64A 4OR9A 1TCOA 3GVEA 4IL1A 3RL4A 3FGAC 2R17A 2O8AA 1HO5A 4UT2A 5B8IA 2ZO9B 1S8EA 3H67A 2NYLC 1S3LA 3P71C 3THOB 1WAO1 3H60A 1HPUA 1W24A 4Q7FA 4LACC 2A22A 1T71A 4MP0A 3QFOA 3QFKA 1WARA 4FCXA 1S70A 3AUZA 2IAEC 2NXFA 2BQ8X 3DSCA 2Q8UA 3N5UA 2DFJA 4F0ZA 4XPNA 3E7BA 2USHA 2Z1AA 3H66A 3K7WC 1NNWA 3AV0A 2BCDA 1G5BA 3IVDA 3D03A 4H2BA 4J6OA 4I5NC 3DSDA 1S3MA 3E7AA 2DXLA 2Z06A 3CK2A 3RL5A 1XZWA 2AHDA 3LL8A 4H2FA 2IE3C 3TGHA 5F3WA 4LU9A 1AUIA 2HYOA 4DT2A 4UT3A 5IOHA 2YEQA 3THNA 1M63A 3ZTVA 4IYPC 2JOGA 2CV9A 4UT3B 2HY1A 2GJUA 5INBA 1II7A 3IB7A 3FLOA 1QHWA 4TUIA 3IB8A 4O4KA 3QFMA 1S3NA 1Z2WA 1HP1A 3PSOA 1MF8A 4NZVA 5JPEA 4ZX2A 3C9FA 4M0VA 1USHA 1U32A 4JA9A 4H2GA 4ORBA 4YKEA 4I5LC 1KBPA 4ZVZA 3EGHA 1OIDA 1JK7A 2P6BA 2ZBMA 4ORCA 4FBQA 4TUGA 5JJTA 2WDCA 4KKZA 3K7VC 2IE4C 3QFNA 2QFRA 4O5GA 3QG5C 5J28A 4H2IA 4H1SA 5JPFA 3C5WC 4O43A 2BDXA 4JA7A 4FBWA 2O8GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NYM C;  2YVT A;  4ORA A;  4MOV A;  4WWL A;  2QJC A;  2HYP A;  3T1I A;  4HD0 A;  1XM7 A;  3DW8 C;  3H68 A;  4G9J A;  3H62 B;  5GTU A;  3H69 A;  4DHL A;  5HPE A;  2WDE A;  3ZU0 A;  5DNY A;  3ICF A;  4V0V A;  1QFC A;  3HVQ A;  4V0X A;  4H1Y P;  4MOY A;  3EGG A;  4KBP A;  2KKN A;  2NPP C;  4V0W A;  5EQV A;  4B2O A;  1T70 A;  1Z2X A;  3RQZ A;  4FBK A;  4UWQ A;  3H61 A;  5C1V A;  1UF3 A;  4LTY A;  2Z72 A;  3V4Y A;  1SU1 A;  1S95 A;  3H63 A;  1OI8 A;  4O24 A;  2XMO A;  1IT6 A;  1UTE A;  3RL3 A;  3JYF A;  3IVE A;  4DSY A;  1V73 A;  3KBP A;  1OIE A;  2QFP A;  2WDD A;  3PSN A;  1FJM A;  2WDF A;  3H64 A;  4OR9 A;  1TCO A;  3GVE A;  4IL1 A;  3RL4 A;  3FGA C;  2R17 A;  2O8A A;  1HO5 A;  4UT2 A;  5B8I A;  1S8E A;  3H67 A;  2NYL C;  1S3L A;  3P71 C;  3THO B;  1WAO 1;  3H60 A;  1HPU A;  1W24 A;  4Q7F A;  4LAC C;  2A22 A;  1T71 A;  4MP0 A;  3QFO A;  3QFK A;  1WAR A;  4FCX A;  1S70 A;  3AUZ A;  2IAE C;  2NXF A;  2BQ8 X;  3DSC A;  2Q8U A;  3N5U A;  2DFJ A;  4F0Z A;  4XPN A;  3E7B A;  2USH A;  2Z1A A;  3H66 A;  3K7W C;  1NNW A;  3AV0 A;  2BCD A;  1G5B A;  3IVD A;  4H2B A;  4J6O A;  3DSD A;  4I5N C;  1S3M A;  3E7A A;  3CK2 A;  2Z06 A;  3RL5 A;  1XZW A;  2AHD A;  3LL8 A;  4H2F A;  2IE3 C;  3TGH A;  5F3W A;  4LU9 A;  1AUI A;  2HYO A;  4DT2 A;  4UT3 A;  5IOH A;  3THN A;  1M63 A;  3ZTV A;  4IYP C;  2JOG A;  2CV9 A;  4UT3 B;  2HY1 A;  2GJU A;  5INB A;  1II7 A;  3IB7 A;  1QHW A;  4TUI A;  3IB8 A;  4O4K A;  3QFM A;  1S3N A;  1Z2W A;  1HP1 A;  3PSO A;  1MF8 A;  4NZV A;  5JPE A;  4ZX2 A;  3C9F A;  4M0V A;  1USH A;  1U32 A;  4JA9 A;  4H2G A;  4ORB A;  4YKE A;  4I5L C;  1KBP A;  4ZVZ A;  3EGH A;  1OID A;  1JK7 A;  2P6B A;  2ZBM A;  4ORC A;  4FBQ A;  4TUG A;  5JJT A;  2WDC A;  4KKZ A;  3K7V C;  2IE4 C;  3QFN A;  2QFR A;  4O5G A;  3QG5 C;  5J28 A;  4H2I A;  4H1S A;  5JPF A;  3C5W C;  4O43 A;  2BDX A;  4JA7 A;  4FBW A;  2O8G A; 
#chains in the Genus database with same CATH topology
 2NYM C;  2YVT A;  4ORA A;  4MOV A;  4WWL A;  2QJC A;  2HYP A;  3T1I A;  4HD0 A;  1XM7 A;  3DW8 C;  3H68 A;  4G9J A;  3H62 B;  5GTU A;  3H69 A;  4DHL A;  5HPE A;  2WDE A;  3ZU0 A;  5DNY A;  3ICF A;  4V0V A;  3E0J A;  1QFC A;  3HVQ A;  4V0X A;  4H1Y P;  4MOY A;  3EGG A;  4KBP A;  2KKN A;  2NPP C;  4V0W A;  5EQV A;  4B2O A;  1T70 A;  1Z2X A;  2DXN A;  3RQZ A;  2ZOA A;  4FBK A;  4UWQ A;  3H61 A;  5C1V A;  1UF3 A;  4LTY A;  2Z72 A;  3V4Y A;  1SU1 A;  1S95 A;  3H63 A;  1OI8 A;  4O24 A;  2XMO A;  1IT6 A;  1UTE A;  3RL3 A;  3JYF A;  3IVE A;  4DSY A;  1V73 A;  3KBP A;  1OIE A;  2QFP A;  2WDD A;  3PSN A;  1FJM A;  2WDF A;  3H64 A;  4OR9 A;  1TCO A;  3GVE A;  4IL1 A;  3RL4 A;  3FGA C;  2R17 A;  2O8A A;  1HO5 A;  4UT2 A;  5B8I A;  2ZO9 B;  1S8E A;  3H67 A;  2NYL C;  1S3L A;  3P71 C;  3THO B;  1WAO 1;  3H60 A;  1HPU A;  1W24 A;  4Q7F A;  4LAC C;  2A22 A;  1T71 A;  4MP0 A;  3QFO A;  3QFK A;  1WAR A;  4FCX A;  1S70 A;  3AUZ A;  2IAE C;  2NXF A;  2BQ8 X;  3DSC A;  2Q8U A;  3N5U A;  2DFJ A;  4F0Z A;  4XPN A;  3E7B A;  2USH A;  2Z1A A;  3H66 A;  3K7W C;  1NNW A;  3AV0 A;  2BCD A;  1G5B A;  3IVD A;  3D03 A;  4H2B A;  4J6O A;  4I5N C;  3DSD A;  1S3M A;  3E7A A;  2DXL A;  2Z06 A;  3CK2 A;  3RL5 A;  1XZW A;  2AHD A;  3LL8 A;  4H2F A;  2IE3 C;  3TGH A;  5F3W A;  4LU9 A;  1AUI A;  2HYO A;  4DT2 A;  4UT3 A;  5IOH A;  2YEQ A;  3THN A;  1M63 A;  3ZTV A;  4IYP C;  2JOG A;  2CV9 A;  4UT3 B;  2HY1 A;  2GJU A;  5INB A;  1II7 A;  3IB7 A;  3FLO A;  1QHW A;  4TUI A;  3IB8 A;  4O4K A;  3QFM A;  1S3N A;  1Z2W A;  1HP1 A;  3PSO A;  1MF8 A;  4NZV A;  5JPE A;  4ZX2 A;  3C9F A;  4M0V A;  1USH A;  1U32 A;  4JA9 A;  4H2G A;  4ORB A;  4YKE A;  4I5L C;  1KBP A;  4ZVZ A;  3EGH A;  1OID A;  1JK7 A;  2P6B A;  2ZBM A;  4ORC A;  4FBQ A;  4TUG A;  5JJT A;  2WDC A;  4KKZ A;  3K7V C;  2IE4 C;  3QFN A;  2QFR A;  4O5G A;  3QG5 C;  5J28 A;  4H2I A;  4H1S A;  5JPF A;  3C5W C;  4O43 A;  2BDX A;  4JA7 A;  4FBW A;  2O8G A; 
#chains in the Genus database with same CATH homology
 2NYM C;  2YVT A;  4ORA A;  4MOV A;  4WWL A;  2QJC A;  2HYP A;  3T1I A;  4HD0 A;  1XM7 A;  3DW8 C;  3H68 A;  4G9J A;  3H62 B;  5GTU A;  3H69 A;  4DHL A;  5HPE A;  2WDE A;  3ZU0 A;  5DNY A;  3ICF A;  4V0V A;  3E0J A;  1QFC A;  3HVQ A;  4V0X A;  4H1Y P;  4MOY A;  3EGG A;  4KBP A;  2KKN A;  2NPP C;  4V0W A;  5EQV A;  4B2O A;  1T70 A;  1Z2X A;  2DXN A;  3RQZ A;  2ZOA A;  4FBK A;  4UWQ A;  3H61 A;  5C1V A;  1UF3 A;  4LTY A;  2Z72 A;  3V4Y A;  1SU1 A;  1S95 A;  3H63 A;  1OI8 A;  4O24 A;  2XMO A;  1IT6 A;  1UTE A;  3RL3 A;  3JYF A;  3IVE A;  4DSY A;  1V73 A;  3KBP A;  1OIE A;  2QFP A;  2WDD A;  3PSN A;  1FJM A;  2WDF A;  3H64 A;  4OR9 A;  1TCO A;  3GVE A;  4IL1 A;  3RL4 A;  3FGA C;  2R17 A;  2O8A A;  1HO5 A;  4UT2 A;  5B8I A;  2ZO9 B;  1S8E A;  3H67 A;  2NYL C;  1S3L A;  3P71 C;  3THO B;  1WAO 1;  3H60 A;  1HPU A;  1W24 A;  4Q7F A;  4LAC C;  2A22 A;  1T71 A;  4MP0 A;  3QFO A;  3QFK A;  1WAR A;  4FCX A;  1S70 A;  3AUZ A;  2IAE C;  2NXF A;  2BQ8 X;  3DSC A;  2Q8U A;  3N5U A;  2DFJ A;  4F0Z A;  4XPN A;  3E7B A;  2USH A;  2Z1A A;  3H66 A;  3K7W C;  1NNW A;  3AV0 A;  2BCD A;  1G5B A;  3IVD A;  3D03 A;  4H2B A;  4J6O A;  4I5N C;  3DSD A;  1S3M A;  3E7A A;  2DXL A;  2Z06 A;  3CK2 A;  3RL5 A;  1XZW A;  2AHD A;  3LL8 A;  4H2F A;  2IE3 C;  3TGH A;  5F3W A;  4LU9 A;  1AUI A;  2HYO A;  4DT2 A;  4UT3 A;  5IOH A;  2YEQ A;  3THN A;  1M63 A;  3ZTV A;  4IYP C;  2JOG A;  2CV9 A;  4UT3 B;  2HY1 A;  2GJU A;  5INB A;  1II7 A;  3IB7 A;  3FLO A;  1QHW A;  4TUI A;  3IB8 A;  4O4K A;  3QFM A;  1S3N A;  1Z2W A;  1HP1 A;  3PSO A;  1MF8 A;  4NZV A;  5JPE A;  4ZX2 A;  3C9F A;  4M0V A;  1USH A;  1U32 A;  4JA9 A;  4H2G A;  4ORB A;  4YKE A;  4I5L C;  1KBP A;  4ZVZ A;  3EGH A;  1OID A;  1JK7 A;  2P6B A;  2ZBM A;  4ORC A;  4FBQ A;  4TUG A;  5JJT A;  2WDC A;  4KKZ A;  3K7V C;  2IE4 C;  3QFN A;  2QFR A;  4O5G A;  3QG5 C;  5J28 A;  4H2I A;  4H1S A;  5JPF A;  3C5W C;  4O43 A;  2BDX A;  4JA7 A;  4FBW A;  2O8G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...