1HQ2A

Crystal structure of a ternary complex of e.coli hppk(r82a) with mgampcpp and 6-hydroxymethyl-7,8-dihydropterin at 1.25 angstrom resolution
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
158
structure length
158
Chain Sequence
TVAYIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQPDYLNAAVALETSLAPEELLNHTQRIELQQGAVRKAERWGPRTLDLDIMLFGNEVINTERLTVPHYDMKNRGFMLWPLFEIAPELVFPDGEMLRQILHTRAFDKLNKW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Dynamic Roles of Arginine Residues 82 and 92 of Escherichia coli 6-Hydroxymethyl-7,8-dihydropterin Pyrophosphokinase: Crystallographic Studies
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords 6-HYDROXYMETHYL-7,8-DIHYDROPTERIN PYROPHOSPHOKINASE
total genus 45
structure length 158
sequence length 158
ec nomenclature ec 2.7.6.3: 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase.
pdb deposition date 2000-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01288 HPPK 7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase (HPPK)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.560 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits 7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK 1hq2A00
5ETOA 1TMJA 2QX0A 1G4CA 3MCMA 3HT0A 3MCOA 5ETNA 1RTZA 4M5JA 2BMBA 3ILIA 1RAOA 2F65A 3IP0A 5ETPA 4M5NA 5ETKA 4AD6A 1EQMA 1EQ0A 3HSZA 3KUHA 4CRJA 3MCNA 1F9HA 1IM6A 3UDVA 5ETTA 3ILLA 4CYUB 5ETQA 4M5LA 4F7VA 4M5MA 5ETSA 1RU1A 1TMMA 1Q0NA 1KBRA 3QBCA 1CBKA 4M5IA 3HSDA 5ETRA 3HCXA 3KUGA 4M5GA 3KUEA 5ETVA 5ETMA 1RB0A 3HSJA 3HSGA 1HQ2A 3HD2A 3UDEA 2F63A 4CWBA 1RU2A 1DY3A 3HD1A 5ETLA 4PZVA 3UD5A 1EX8A 4CYUA 4M5KA 3ILJA 3ILOA 4M5HA 2CG8A 1HKAA
chains in the Genus database with same CATH superfamily
2G1DA 2J7UA 1YJWS 3CGIA 3EVWA 3Q83A 1GXTA 3RTVA 2Q43A 2HVDA 1VQ7S 1HW9A 5CABA 3D0GE 4PUOA 3V4IA 3ZZTA 2EVZA 4NOHA 3K5MA 3OXFA 1F9HA 4FZVA 3T3FA 4DFPA 2WRMA 1PAEX 4KHPF 2VG7B 2KM8C 4PABA 3UO0A 3CXCR 4BC9A 3I0RB 5F8MA 3LO3A 5HROB 2RKIB 1UJ5A 3MMBA 1Q81T 1JLQB 2AYMA 2GX8A 4F4WA 4CWBA 3LOUA 2ZKTA 1GMVA 2YQ0A 3E01A 4LSNB 4C7QA 3LP0A 4QR0A 5HO4A 1VQNS 4PRFA 1IBCB 3CJ2A 2HBQB 4ZP9A 3TANA 1KS2A 3KNGA 1WOOA 1S49A 2HURA 3NLCA 3H25A 4KGXB 4DL0C 3KK1A 3SCLE 1UA1A 2E1PA 3MD1A 3H5XA 1T0TV 3I96A 5ETPA 3M30A 3WIUA 1K47A 3MPVA 4M5DB 4Y0FA 3KLVA 3EVMA 1HARA 2ZHOA 5IC4B 3SMZA 3OUYA 1WDTA 3CCJS 2D41A 2MJUA 2FC8A 2JZ5A 3H2VE 3E2EA 4GKKF 1JLCB 3RG6A 5GMKa 4OHYA 1ZM4A 1S79A 1VQYA 3V81A 1AXQA 1Q1KA 2BKOA 1VIXA 2RF2B 3DC2A 3IA0A 2F8EX 2KFYA 5EX0A 2EG2A 1VQ9S 2Z4PA 2OELA 2ADCA 2E9ZA 2R7TA 3GIIA 2E5LF 5J2PB 2V4RA 1WDDA 2IPOB 2FVCA 4DDFA 3JTNA 5KT4A 2W9BB 1F60B 1RB0A 3G6ES 2LEAA 1IBMF 3P5TL 4NXMJ 2J76E 3BSOA 5E3PA 1HNIB 2QC3A 3HD1A 3TX0A 2QYCA 1TK8A 1N5SA 2R4FA 3H2LA 4F04B 3V6KA 2RQKA 2ZITA 4LQ9A 2N82B 2K7JA 3BBBA 4IFYA 1RK8A 4MIAA 1C0TB 2YNGA 3HMJG 1ICEB 1ZAXA 4A8KA 2AJ2A 4NLTA 1OSCA 2DNRA 4IUFA 5DQIA 2Z2ZA 1S7IA 2YWWA 1JLBA 1S1UA 4LF1A 3W64A 3DRPB 4DFJA 5KAKA 3TQ1A 1SJ4P 1WHYA 1KC8T 1ZAWA 2FLOA 3MCNA 4NA1A 3UD4P 1IKVB 4L72B 3MM7B 3OL7A 2MY7A 1H2TZ 4BBYA 2YNFB 2MQLA 2YKQA 3LP2B 5GADI 3OVAA 4IRDA 2XNQA 5I3UB 2GAGC 2QMUB 4NZ7A 4ZJQA 2BE9B 2VDIA 4U7CA 2WVDA 5B7WA 3HLUA 3CIZA 4WE1A 2Y3YA 3MUTP 1L3TA 3FCHA 2V2ZA 4AYBD 3ETOA 4DQSA 3GG1A 4R25A 2DR8A 1VBKA 2HNDB 3H40A 1QLNA 2J9CA 2AEFA 2XBPA 3HDSA 1LXJA 2UUAF 1SC4B 5HN0A 3SCKE 3CJ0A 4BLGA 4CM0A 2CPDA 1YIJS 3UPFA 2RD5C 5B09A 4ENOA 1U49A 3EJMA 4HHHA 4K4TA 4KTQA 2NQPA 3TARA 3G4SS 1EETB 4MK8A 3TOQA 1HHSA 2KVIA 3OVBA 3FC9A 3FEYB 4O4GA 1KLMA 2GO9A 3TP2A 4ELTA 3DHWC 2CPZA 4ECRA 2DB1A 4JYAJ 3M8SA 4J9SA 1BXNA 2YH1A 4YFUA 3M6XA 1X9WA 3ZNJ1 4U7UK 2OMLA 4D3HA 3QAEA 2CPFA 1C4CA 4Q0BA 5B08A 3R7NB 1YJVA 4WYLA 3ITHB 3JSYA 4F3OA 7AT1B 1SJFA 1FTCA 3TAPA 2ZJPQ 3EDQB 4NPOA 2E1RA 4MFBB 5IM0A 2BVZA 3JXOA 2MKCA 1FI4A 1FNXH 1HHQA 4WYWA 2OFHX 3HZEA 2B7BB 2XYPB 2YX1A 2YWEA 1BD6A 3N5BA 4OZLA 3W65A 4DPUA 1S1WA 1VISA 1H74A 3DRYA 3IP0A 4DR2J 3RR7A 2B4OA 1HLWA 2DRAA 4O44A 3CW2C 2C2EA 3DN9A 2XEXA 2FY8A 3GJSB 3PRDA 4MFBA 5IM0B 3LH2S 5BR8J 4DV1J 4DLEA 1U45A 2J7KA 1ZM9A 3ITHA 4F0KA 5HMXA 4DN9A 1HYSB 4LFBF 2DGQA 1K0VA 3DU6A 3MTJA 1RT3A 1ZPVA 1M5KC 2KZMA 3A13A 4QIFA 3D28A 2ADBA 4P2SA 4DUTA 2ZE2A 2G0IA 2C3UA 2OEKA 1NO8A 4HKQA 2XSJA 3PR4A 5HMYA 4LF8J 4EYIB 4DEZA 3P8BB 3B6BA 2HHQA 1RWUA 2IM3A 3I6PA 1U1RA 1U1LA 4ID5A 4ILRA 4CTAB 4O4GB 3AB2B 4F2RA 1RYRA 4LREA 2R2TA 1SJRA 4OX8A 3MCOA 2YWKA 3MM9B 1Y7PA 5ETNA 1UPPA 2Y1RI 1WELA 2MZQA 2C2NA 4JI2J 3SXLA 2DH9A 2VG6B 1GT8A 4IR1A 2YQ3A 4TVAB 4OX9J 5KT5A 5CZVA 4YB6A 3ZNUA 2ZUGA 3PIPQ 1QAJA 1BQMA 4WE1B 1KBRA 1QAIA 1OO0B 2HHHJ 2ZWPA 1XNQF 3MPUB 3QATA 4DCJB 2E9RX 1VBXA 4X4VA 4LR8A 1WG1A 2IC3B 1FDDA 3FDSA 3HX9A 3P45B 3TZWA 3B54A 3LP2A 2P9EA 3VCDA 3I0SA 1OIAA 4NA2A 4LBIA 2MGZA 2RH3A 4DV3F 2F4VJ 3ZZUA 2VQEF 5HK4A 1FEEA 3R1HA 3KG4A 1TK5A 3PRBA 3JB9k 3GU0A 2FJDB 1S1UB 1MU2A 4ED5A 4B3TF 1U09A 2ZOFA 2RJZA 2VC0A 3I4PA 5KG4A 4ZIVA 3KLFB 3IR7B 2QZ8A 2V9WA 4Y2MA 3NMRA 4J90A 4K4WA 5D0EA 3SIPB 1TFWA 3KUHA 3PHTA 1X4AA 3D4JA 5GAHI 3IWXA 1BY9A 5IC6B 2ZBIA 4DV5J 4TQSA 3FRYA 3H98A 3O44A 4P72A 5FDLB 4ZMMA 1B0VA 4CQ1A 1N33J 3I9V9 3JTPA 1M5PC 2AYGA 1TL5A 1FRKA 1GQEA 1H72C 5IZHA 4CT9A 3OJSA 2JEGA 4PG7A 2BXJA 3QT7A 4IQMA 3K5NA 3H7HB 3HSJA 4C8YA 5CCLA 5KG0A 1CSJA 4JV0A 3VAIA 1JLCA 1MW7A 1P9YA 5E33A 1PG5B 4I68A 2YPYA 1MMDA 3NG8A 2PFFB 3EZ5A 2X51A 3IWNC 3KLFA 4OYIA 1YJUA 4RW9A 3JQJA 4I2QB 1PYSB 1RT7B 1MU2B 1WC6A 2IYIA 2BJ9A 3HI9A 4NEZA 4ZPCA 3MR6A 2W8LA 3BQ0A 3BGRB 3CCRS 3NCQA 3NNHA 1NJXA 2IVYA 4QIVA 3ENVA 3LP0B 5D4PA 5E2QA 3E01B 2DGUA 2VIHA 2IC3A 1S0MA 3CJ3A 1JLQA 3DLKA 1RAIB 2WW8A 3FMWA 2RKIA 4OJ3A 1U47A 1PCAA 1NDKA 3KFWX 1RAGB 4NMLA 3ZO7A 3UW1A 2W4DA 3W2WB 2F63A 2QYGA 3IGVA 5F3TA 4CP5A 2PE8A 1NLKL 1S1XB 3MM5B 4DS4A 2JVOA 4MJKA 3W7BA 3LQVA 4J91A 3TUPA 4PUOB 1T11A 4OIXA 4JBCA 3FBBA 2RS2A 3NWRA 4I6WA 5F3ZA 1KHWA 4LUBA 2YTCA 2IRUA 5AE3A 3MHYA 3GIJA 1J5EJ 4O3SA 1NUEA 3DXSX 4UZCA 2HNZA 1U0HA 4KYZA 3W9IA 4ID5B 4DUZJ 3CB4A 5BYSA 5EGYA 1M5OC 3DRRA 4QW8A 1NHKL 4L75A 5CHCB 1UVNA 3RW7A 2K7KA 4DPYA 5A8RA 5T41A 4C0OC 1RTJA 3IGNA 5CQGA 3RAXA 1IBKJ 2OIHA 4BS2A 5ETRA 5EUHA 3DLLQ 1RT3B 4ZKAA 1T9WA 2G0JA 3HHNB 5L9XA 2R8KA 3T1HF 2DH7A 1X4GA 2DYAA 3IG1A 4LVOP 2VBYA 3D0IE 3BDEA 5IT9Y 1Z2ZA 2XC9A 4JI5J 2J0SD 1RP5A 1RQ0A 1VFJA 1J2VA 1HI1A 4FP9A 4ANEA 2OUGA 3Q8YA 1RHRB 4K5RA 2A18A 3VZIA 2ZOMA 4WFZA 3UDVA 1WOPA 1F2HA 3GE9A 3ZZRA 4RW6B 4TU8A 3PW5A 1FD2A 1QM9A 2M0GB 5KT7A 4UZBA 1U6BA 4B9TA 3BB5A 4M1KA 1YG0A 1RA6A 5KG7A 1H7XA 5KFLA 3LWLA 1O0PA 2OTLS 4H4OA 3J7ZT 3VAHA 4AL7A 1YBAA 2O01C 4EU0A 3M9MB 1RAAB 3PX6A 5KG3A 3E3XA 5KFOA 4Y00A 2ZH8A 4ED1A 3UD5A 1U1OA 4QPXA 3S8SA 2HWHA 4P7TA 2HWIA 2QE5A 3W62A 1YLXA 1Q78A 5K8MA 4K59A 2HHUA 4DU8A 3TQEA 1EETA 4B3MJ 1IKXB 5KG2A 1RADB 5L9NA 4ZVFA 1MSWD 3B4DA 2KO1A 3H5UA 4JUZA 1LWEB 3C6TB 3ILLA 5I42A 2Y9HA 3PO5A 4X2BA 4U67Q 3CEDA 2V67A 3NCPA 2LCWA 4WFYA 3JAMU 5FIIA 5KFYA 1N5VA 2H54B 2NXJA 2UUWA 3TJ8A 1R8BA 1PJ7A 2ILYA 4FPIA 4YN3B 3DFEA 3HSDA 4WU3A 2V50A 4USIA 4WFAQ 5HVHA 4HYKA 2H3EB 4OZNA 1CULB 1WHXA 3OTEA 2JX2A 4DV7J 2QEXS 2OPQB 2XZTB 4IG3B 1UVIA 2HSEB 4K0KJ 4G1IA 2XZWA 1IJFB 1HQEA 2M52A 4MH8A 1FDBA 1NXIA 3DOKB 2DIVA 3J7AN 4PR6A 1JLBB 4K4VA 1N32F 5MAOA 1JWWA 5IT9U 1WC4A 1PC4A 3FNNA 4A4JA 5G4DA 2CPJA 2IRYA 4O3OA 2DGXA 2HQIA 1C0TA 2YNGB 1M5HA 1XWLA 3CJQA 5H9FJ 5KFMA 4IFYB 3OSNA 3EGVA 2RAQA 1F3VA 1NJWA 3UNYA 3QSYB 5KFKA 3S01A 3D67A 1R6VA 1C4AA 2W01A 2ZDOA 4LF6J 3THVA 4UUXA 1DAXA 5GAEI 1F5CA 3M6WA 3MEEA 1T9XA 3FEZA 4RZRA 2HQGA 2VZ9A 4ZVEA 1RTHA 4ZCKA 5K14B 3HHLD 1B64A 3RBDA 1ZBTA 4M5GA 8AT1B 1BE4A 2RF2A 1BC6A 2DGWA 1RAHB 3UCZP 3V81B 4JV5J 2KYXA 3TZXA 4UW2A 4PZVA 2E66A 3NGDA 3BEGB 3OUYB 1B3TA 5LOQA 2IBOA 2MKIA 4M5DA 5L1LA 5HBMA 3WX8A 2QLBB 1WG5A 1WC1A 2G2ZA 1ZPWX 2VBZA 3NAIA 3HKWA 4NWBA 3WC0A 4C8MA 2JLGA 4FS1A 2FLPA 4JI4F 4FPRA 4XK8C 1C1CA 2ROPA 2HVEA 3D2WA 4WFXA 4HT7A 2ZBCA 4LFAJ 4LSNA 1OY9A 2GNKA 5L1JA 3FBCA 5C42A 4TLRA 1OQ3A 5F8JA 2VUGA 4ILLA 4WP9A 4AL5A 1N34F 2M5YA 3AA8A 1S0OA 1UFLA 1IWAA 5HROA 2FLLA 1NU4A 1H2VZ 2V63A 2L9NA 4EBEA 3CC2S 2ALYB 2CZ9A 2DXEA 3N9UC 2Y1IA 3KLIA 1J5OA 1UMJA 1URNA 2G13A 2EFPA 4ID8A 5EDWA 3N6MA 1T94A 1Z1ZA 5DM6Q 1S9EB 2IM1A 4MT1A 4DL5A 3H8YA 1X60A 2FPHX 2MKYA 1GXUA 1EJ7L 2FHJA 3AAWB 3GFHA 1N36F 3NBPA 1B7FA 1JLFA 3UE2A 2QSFA 5KFHA 3FSYA 1NB7A 4LFAF 1X4CA 3NOCA 2Y1JA 1OMSA 3BN7A 1VGYA 4H54A 4J9OA 2IY5B 4KV8A 2BJ1A 5HANA 2HQFA 1FWKA 1RTIA 1VHIA 2FTRA 4JI4J 4IOBA 1CBKA 1MWYA 1U8WA 4X65F 2ZD1A 5J2NA 1SUQB 2CKWA 1FD8A 2QL5B 2MSTA 3OFEA 1D8ZA 1G2EA 1EB0A 1WC5A 1JMTA 3QLHB 3HP6A 1WEYA 2CA9A 1KFSA 4DMZA 5GAEU 4DR3J 3IBFB 2C3YA 2GQQA 1H0HB 1WI6A 3MEDB 3PG9A 3CT9A 1IN0A 1ZA2B 2X3GA 3ZFVA 4X62F 1QSLA 1HHTP 4Y2CA 2IYGA 3ICLA 3MEGB 4ECQA 4LF6F 4CLTA 1REVA 1PGZA 1C1BB 2BJ3A 4NLUA 2ASDA 2OEMA 2UUTA 2W2OP 5HP1B 4A8WA 1FX2A 3E8OA 4M8LA 1VK3A 2P6SA 3MGJA 4B3RJ 2VBWA 5L46A 5FJ4A 2XWYA 4FYDA 4RW7A 2Y1LB 3TVZA 5HQMA 5J2MB 2VKZG 4ERDA 3F44A 1N32J 3RYLA 3EGZA 2IMOA 2XO6A 2LP4A 2L9WA 4CLZA 3EDRB 4K0KF 1RT6B 2R8JA 1S9GB 2VOPA 2Z2LA 3ILJA 4GMKA 5AXKA 4TYAA 1SKUB 1W2IA 4EMDA 1DTQA 2BE2B 2MKKA 3EUNA 2V9KA 4TY9A 3HT0A 4KO0B 2RILA 4OJ1A 5EWFA 3BO4A 1NK9A 2ASYA 2YY3A 4DR5J 1LFPA 1XQIA 2MLXA 4OZ5A 4RBTA 1VQKS 1OJ4A 2V8DA 1IBLF 4YHHJ 2NSCA 3AQOA 2CIMA 4BC7A 3HJFA 4B3MF 3X1LB 4RW8A 5A0YA 2H51B 5T7LB 2KXFA 3TZYA 3AHPA 4TN2A 1SC6A 1UL3A 2HZAA 1TKXA 1APSA 4YY3F 3MFHA 4Y3CA 2XSFA 4PQAA 3KUEA 3DKDA 5F0UA 3X3UA 3QIDA 1YDLA 3M8PA 2DNYA 2HFVA 4NX9A 5CYQB 1KDNA 1UJ6A 3I5CA 2RU9A 3GP9A 5D77A 3RB3A 4YB5A 2AV5A 5IOLA 4P52A 3GR1A 1BQNA 1S6PB 1UEVA 2DGOA 2BYCA 4ZVOB 4IDKB 5L38A 1C0UB 2WTFA 1KTQA 5ETSA 2CNNB 4J9MA 3PX0A 2UUBJ 3KLEB 4E2FB 1RWMB 1OQ6A 1Q79A 1MWZA 1XIQA 2X1FA 1X8DA 4M5JA 3JTOA 3IM9A 5ETKA 2CPIA 2F65A 2Q3PA 3OTDA 5JMNA 4TY8A 4X4RA 3UCUP 2F4FA 4WK1A 3W2VB 2EEYA 1IM6A 1FNOA 5K8OA 4LF2A 4Z37A 1FRLA 2HIQA 3MEKA 3R9LA 3VGVA 5F9NA 1FT8A 2V6AA 4ED2A 2HQ3A 4PEOA 5DG7A 4OI6A 5SZTA 1ZETA 2HVIA 2OJ3A 1FF2A 2EFQA 2O1PA 3MAHA 3MI7X 4URQU 4FBTA 4LF9J 3Q89A 4OX6A 3QFHA 4B08A 4ETXA 4DHVA 3T1HJ 4KH0B 2OPSB 4NLRA 3MM6A 1YHQS 1WUUA 2CAJA 2OEJA 3A3OB 4RU9A 2GV1A 2PMZD 2XI3A 5ETOA 4DPWA 3PW0A 4WFNQ 3ZTPA 4PWUA 3RRGA 2UUCJ 5F8HA 5KG5A 2LXUA 2CWXA 2KI2A 2LVWA 3D1OA 1SJQA 4NLQA 4M94A 1VRUA 1HW8A 1YJTA 3KJNB 2DGVA 1FERA 1TR0A 3ISNC 3GR0A 3M9NB 4DUZF 3BBCA 2HK3A 2KFZA 3DDIA 3UDLA 3QRQA 2ZHBA 1XTZA 2MHNA 4ELVA 4Y2KA 4DR7F 4PPZA 4JI0J 2MLYA 1RA7A 4DR6F 4ELUA 1RZMA 3V6DA 1FJGJ 4NEYA 4R0EA 1R6YA 1FRXA 2D74B 2NYHA 1ZM2A 2V4JA 1VLYA 3A12A 3W8PA 4F4ZA 3AA9A 1FVQA 3LAKA 2CJQA 2LECA 3PNIA 2GJ2A 2QO3A 3ZTQA 1Q8LA 1S97A 1DLOA 2EPIA 4OJHA 1L3KA 3QGPA 2BZ2A 1IKWA 1OWXA 2NUUG 2IM2A 2MJNA 4LRAA 3QGIA 1VQPS 1B7YB 3KLHA 5B0GA 1U7LA 5DZ6A 3CJKB 4UOGA 1KOOA 1U8SA 2XMTA 1YJNS 1GMWD 2Q79A 3CSKA 5B0CA 3SI8A 1ITPA 1R8PA 4RL1A 3NEKA 2GGPB 5ETQA 2R2SA 4NXNF 3R3TA 1L3UA 1AZSB 2WHOA 5L8RC 4EBDA 1FESA 2IA0A 3P96A 2QLJB 3C6UB 5KFNA 2D3O1 3D3BJ 3J7Z5 2DR9A 2CNLB 1TUWA 3R6LB 4H4KC 5A8WB 1FVSA 3EGNA 4YMEA 1NRKA 4YB1P 3HVAA 1IJEB 2G9OA 2V2VA 1SKWA 1U0SA 2UVUA 1FWLA 4ED4A 5LMNF 1AFJA 3Q2SC 4OZ3A 3CJKA 3PW7A 2FVSA 3OTBA 3TUZC 1VLOA 3KLHB 1N33F 1HBMB 2DD8S 2CVIA 2WB1D 2AJFE 2P5VA 3R27A 4ZJOA 1NSKL 1WF0A 3P6YC 5F0WA 1RCXB 2QMWA 3R5DA 1YX2A 1PJ5A 2PN6A 2B4VA 3FCVA 4J37A 1VS3A 2MQOA 2B6AB 2PT0A 5DDOC 4OYXA 4O4RA 3BGFA 2ROEA 1VJWA 4PG8A 3OTOJ 3Q8QB 4JI1F 1SBRA 4NE9C 2CQ3A 4RNFA 4U6PA 4B3TJ 3GJQB 3V6DB 2KHDA 2KHCA 1JLAA 2R7UA 1FJCA 2OH2A 2XLKA 3FUYA 2YKOA 1R43A 2A1BA 2E44A 1B70B 3R5GA 3QAUA 4USJC 4U96A 3TVKA 2L3MA 4OV1A 2VQEJ 4J9KA 2F4VF 2FIUA 2Q66A 3CCLS 3J7YU 2AGOA 2VV5A 2XULA 1X4HA 1AT1B 3A4TA 2C1EB 1VRUB 2X7IA 3I31A 1F5BA 4G3IA 3MURP 1RHJB 2HHHF 4PXDA 1XNQJ 2IFXA 2UV8G 2XY5A 1UW4A 2CQ1A 1X0FA 2PSZA 1LWXA 1XR7A 1I1GA 4YP3A 4DCOB 1I6JA 1R8HA 4DL6A 3MPDA 1CQNA 2DGSA 5IS2A 3KKFA 5CZXA 3CDWA 3A8IA 4ZITA 1TL4A 2B43A 3CJTA 1VRTB 4XIUA 2MB0B 3TVYA 4X84A 1UFKA 1F1BB 2BACA 2O3DA 4C0HA 1N8RT 2MQPA 2J6TA 4UQTA 4LIWA 1T03A 2ZC3A 2E29A 2N4DA 4RUCA 2YQ1A 3I4HX 3SEOA 3PV8A 1GEHA 3BH7B 4GO7X 3W2VA 4ZCIA 5KFBA 5D0GA 3N5FA 3J80U 4F4XA 2PA8D 3ET6A 4FXVA 2DVIA 1E6YB 1NBEB 4FXDA 3L7UA 1NK7A 2E5IA 1Y00A 5GAHU 1SKRA 3ENQA 3M6UA 1D9DA 4IDKA 1OY8A 1DRZA 2KN4A 4DZ6A 2WSEC 4G1QA 1NH8A 3ZTSA 3TEHB 1CJVA 3CDBA 4HEA9 3DLEA 1XMBA 1VQSA 1Q8KA 2BQ3A 3CCWA 1K1QA 4X66J 4ZP6A 4ZVTB 4DWIA 3OFFA 1YITS 4MKVA 5HVGA 1BLUA 3KJFB 3M2UB 4RW8B 5A0YB 1S7HA 7FD1A 3J7A1 2YBVA 1FKOB 2J9EA 2WOMA 3C15A 4I6AA 5EWEA 3CCVS 4LVNP 3EMTA 5MLCV 4K4UA 2ZEJA 3ULHA 3IAM9 2Q6CA 1VQ4S 4LRBA 3EWGA 1PBAA 4ATNA 1RLDA 4RNNA 2EW9A 2O66A 2FZGB 3U7JA 2O67A 2ZH7A 5LJ5Y 3MECA 5L39A 1TL1A 4ES1A 3Q24A 5HLFA 2VODA 4CYUB 4FVMA 1N52B 1XN9A 1RISA 2RMLA 2WVFA 4RR5A 3TW0A 4WZMA 1NKBA 1LWFB 1IR2A 2EFNA 3CDAA 1SC3B 3PXGa 3S1TA 3VAGA 3DOLA 8ATCB 4Q44A 2Y0SD 1Q4RA 2NPFA 3AJDA 4RW7B 3H90A 1QDUB 2B8PA 3FK4A 4M5IA 1UP1A 2QGFB 2YWFA 2YWHA 4DQQA 2Z58B 2OP5A 4B02A 4DF8A 3SQOP 3D0HE 3C66A 5RUBA 4ECZA 2KJWA 4DU7A 3O3LA 3S7RA 4Q8EA 1KN6A 3IMQJ 4QIWD 5T14A 1ZTWA 4B3OB 1RTDB 3BBFA 1YKWA 2A2CA 1VJQA 4C8KA 4HI1A 3DMJA 3HM9A 1U48A 5KFGA 5IV4A 5F9LA 2WONA 3TNVA 3PTWA 4ZN3A 1TV6A 2W2PP 4FXWA 4M5LA 2FC9A 3N0VA 1LOUA 4QPTA 2RT3A 2WSFC 5E41A 1QVFR 1FDNA 4X4PA 4NRUA 1T95A 2LKZA 3IAS9 2RS8A 3DLGA 3MF5A 5C2CA 3V6JA 4S0MA 4CLSA 3R2CJ 1VMBA 1WOSA 5M2PA 1S0NA 3GLJA 4ZVRB 4KPCA 2GMJA 5C5JA 1N48A 3FSXA 2GIRA 3BO2A 2WZ1A 3WQPA 3ILOA 1KRPA 3M2VA 5CH7B 2E5GA 2CG8A 3G6VA 3FQKA 4A48A 2UZAA 4LRFA 1M1KT 1H3DA 1RHMB 4Q2LA 2AJQA 5CYMB 3K0JA 4YUDA 4ED8A 3R5BA 3CDUA 4ECXA 3DLBA 3M2VB 1WTFA 2FJAB 3AB4B 3BR8A 2F9JA 3G82A 3MDFA 3PJ9A 3UN3A 4GKKJ 5J2QB 1QTNB 3R97A 2Q6BA 3K89A 5DDRC 1LKZA 1JX4A 1ZM3A 2ZWOA 2HW3A 1J5OB 3QZ8A 5GVQA 3C3LA 2WVBA 3THTA 5H9FK 2MPUA 1YJRA 2E5JA 4Q43A 3F73A 4X64J 1X31C 3QRPA 1WD6A 2K3IA 2PGCA 2OO4A 2ZBQA 3GJTB 2W1BA 3QT8A 3TO8A 4HHJA 3VTIA 1V5IB 4EUVA 3PRVA 1NCLA 2XNRA 5A6PA 3OR2A 2JDJA 3HD2A 4OZ2A 4WTYA 4CLPA 4CO2A 2MXYA 4YHHF 2V34A 3OVSA 4MKAA 1UAWA 2NSBA 2I0XA 4F0HA 2RQCA 3M2RA 5DRKA 4DR1F 4A8YA 1M5VC 2VPWB 3AXKA 5GAGU 4M5MA 4NCGB 5CAAA 3DMJB 1VQ8S 1B0PA 1MN9A 3BM7A 2CQ2A 4LR7A 4UF4A 3BPDA 3KTQA 4RUAA 3OL8A 1KHVA 1RTZA 2ZVSA 4FKXA 2EXUA 3KG0A 4UY85 1HL6A 2MQMA 1D3WA 1JXVA 5HBMB 1CJTA 3IS9B 4KHPJ 1QY7A 3UN2A 3DXBA 2OAUA 1OYEA 2KDOA 1YRUA 4ICLB 3GTYX 1HBOB 2APOA 4OYOA 1K8AT 2KM8B 4ZVSB 4QWAA 2QA2A 3BF4A 4I56A 4I69A 1K0TA 1G7CB 3QMQA 3OQ2A 1RTHB 2FGOA 5K14A 3NOGA 5LXYA 2XMVA 5HL7Q 4NLGA 3K5LA 1T9TA 2PIIA 3MEEB 1SL2A 5AE2A 4WP8A 1LWFA 4Z7CA 1UKUA 2OKQA 1WTBA 2E9TA 4JV2A 3IN5A 4RUBA 4CYUA 4WIQA 3FVYA 2CPYA 2FHKA 3T5KA 1FE4A 2DNOA 2J5AA 1VI7A 2XMWA 3D6HB 3F41A 3MM8B 2VG5A 5KFZA 3MAAA 5IXUA 1FRMA 3RRKA 4A8QA 1ZH5A 2BMBA 5BXIA 4AE5A 4DR3F 3GZ7A 1WWHA 1EQMA 2XWXA 1OSDA 2PI4A 3HVWA 1D1UA 5CXTA 3C46A 3HPOA 5IQQA 1HQEB 1NHUA 3PIOQ 3OJUA 5LMNJ 4IG3A 2DTJA 1CULA 2HAIA 4K2XA 2D7SA 4X65J 2VPXB 2VL1A 1CJKA 5EHHA 2VICA 1SL0A 3U1MA 1KEKA 2NR0A 3PFOA 3SDEB 1IQZA 4KFBA 2AX0A 4UT4A 4QWEA 3IRXA 4JOUA 2N7CA 3LPEA 3DLEB 1REGX 2JRSA 1UWAA 3CVKA 1CJVB 3I55S 3GQCA 4DUYJ 2XY6A 4I0WA 2Y8YA 3C6TA 4G1QB 4QCLA 3MOZA 1KFDA 4NXNJ 2C2DA 2JSXA 3UFCX 1LW2B 2CPHA 3NMAA 1UW9A 2GJIA 4MTPA 4HLBA 3JSMB 1N36J 1JJCB 1H98A 3ZZOA 3NRBA 5KFFA 3CPWR 1EP4A 1HNVB 3A8KA 1D9FA 1UEKA 3C16A 2CNKB 3KJVB 3Q0AA 2R8HA 1SQEA 3RGIA 3CMES 3QT5A 1S1TB 2DNZA 2J7WA 3JYTA 2ZH5A 1T03B 3PX4A 3J81U 2DT9A 3CD0A 1NJIT 1BUXA 2DH8A 1ZZNA 3EXYA 4R8UB 2CJXB 4PG6A 2LLZA 4DR6J 3NNCA 1VC0A 1KVJA 4PYDA 2HVHA 1P27B 2NPIA 3HHKA 4FNIA 2YWGA 4ZOSA 4QWDA 1VYAA 4L74A 3M7VA 4I7FB 4IR9A 4RNHA 2R7QA 4OYWA 1ZTTA 3BH6B 1RYSA 2DNMA 2HBZB 2EWHA 4DG1A 3QZ7A 1WKKA 3TA2A 3UI3A 2UVWA 2QX0A 1WC3A 1OYDA 2DGTA 2DNNA 2RQMA 3VGTA 1JJ4A 1ACMB 2BOPA 2UXDJ 2M4MA 2ZH4A 2QMXA 1AUDA 3VALA 1WSVA 3H42A 1UA0A 2IIHA 3HULA 4R0JA 2R7VA 4FYVB 3K7RA 4NLYA 1Z4UA 3IG1B 2Z2YB 3PEHA 5HAOA 2W9CB 3OSPA 2C2RA 1EZZB 3MXHP 3WIVA 4IOAQ 3GV8B 3KK2A 2DXDA 1P9QC 2FDNA 3ENAA 4KIAA 3CCMS 1S10A 1N4LA 4L73A 1PC5A 3WC2A 1T9YA 1WEXA 2J9DE 1HBUA 4CH1A 1JJHA 4WZQA 4XAKA 5A8RB 2R42A 4URSA 2Z57B 3OW2R 3SSQA 3TEGA 1WF2A 2BJ8A 3QJJA 1MROB 3VVUA 2JJ4D 3MMAA 2AP6A 3CD7A 2HNZB 2H4WB 3CCZA 3HKZD 3T5LA 2Q1LA 4K4ZA 2GVDB 3PZPA 3I5BA 1N56A 2OPPB 4FF1A 4QU6A 1CJUB 1JKHB 2MZTA 3L09A 4JB8B 4F50A 3BSAA 4EYHB 1PBUA 3FGVA 4DXLA 2YNIA 3MM5A 2KXHA 5K9FA 1S1XA 3R7SB 5DG8A 2GS8A 3OLAA 1RWXB 3M8RA 2HLTA 4V19X 5E3AA 1TKTA 2YNHA 2W25A 1UZHA 4ZIWA 3OV7A 1O6XA 2ZDPA 5K20B 3QNWB 3BKUA 4YY3J 5M2UA 2VQFJ 1UTAA 2CDRB 4OLOA 1DZ5A 2FVPA 5DS7A 2QRRA 1RT4A 3CD5A 3CO9A 1RXOB 1M1GA 3CCES 2POKA 2H4YB 2GQ2A 2PMHA 2ZH1A 1FXRA 3BGRA 1KWMA 4ZP8A 1AYEA 2LU2A 4OI3A 1ROFA 3VHQA 1NAQA 4TU9A 1P6TA 4J9RA 4EO6A 2VQFF 2V0NA 1U6ZA 4RW9B 5KT3A 1RT5B 2IM0A 1IKWB 1JLEB 1RLCL 3HSZA 1K44A 5DGBA 1A0OB 2VBXA 3M8QA 5HJYA 2VFVA 3OXLA 2JC1A 2KL8A 2U2FA 3R5JB 4RBVA 1IXKA 5J1EA 2CQGA 3B8HA 1D0EA 3KJQB 4MAKA 2E5HA 4EBCA 4E98A 1RHKB 1WEZA 3H59A 3IBCB 3N79A 1GX6A 4NI2B 4C11B 4QJVA 1LK7A 5FDLA 4CLFA 4P2FA 4O3RA 1ZAVA 2BUNA 3CJSA 2HBRB 2YX7A 4J9VA 4ANDA 2HYIB 2R7RA 9ATCB 3VZHA 2ZVIA 4FVCA 3CNQP 5SUHA 2QLWA 4DSLA 4KGKA 2J9DA 4WF9Q 5KT2A 2I5JA 3W63A 4ITSA 4X62J 1DQ8A 5I3QA 5AXMA 4PG4A 2XLIA 4UOFA 2QSWA 3K5OA 4L6V3 2CQ0A 2NS1B 3VAJA 2OPRB 4E8UA 2RDIA 3PCOB 2LA6A 4KQZA 3ZTOA 3ONQA 1YRXA 2GAHC 3F0NA 3M1VB 3QO9A 1SV5A 2B4PA 4YR0A 2QLFB 3LGMA 4HR2A 4A8FA 3W9HA 2GC8A 3D3CJ 1JK9B 1HFEL 3FBEA 3FRZA 2GJFA 5KFWA 4W90B 2UXDF 1YRTA 3EZOA 4QWBA 1BQMB 1RI7A 1NPPA 2RRNA 2CRLA 2R7OA 2JC0A 1RDRA 1A9NB 1SH0A 1RWKB 4OZ1A 4RNMA 2JEIA 2V2KA 3PYGA 5KOXA 3BR9A 1J5EF 2NXCA 5KFUA 1X4EA 4OX7A 1UVJA 1LXNA 3BGUA 3AY0A 3T9NA 2I6WA 1FJ7A 4X4SA 3M4XA 3BDPA 1FFWB 3MPWA 2M9KA 2WK4A 4HH1A 3MFIA 2JFDA 3BKFA 3KG1A 1KVKA 3R5AA 1Q16B 3BGLA 3RAQA 1BQNB 1S6PA 4USUA 2XZDB 1CLFA 2IAJB 3KNAA 1PIEA 4TLQA 5CYQA 5ITHA 3M8PB 3NGKA 1RU1A 2YH0A 2DHHA 2HS3A 2ZE2B 3N6NA 4ZLPA 4QW9A 1NJYA 1XNRF 5D4NA 1HI0P 2FJEB 1R89A 1Y3JA 4C8LA 5U47A 3VQTA 1E6VA 3EYZA 2DISA 1Y10A 3HK2A 2D1CA 5D78A 3RU0A 3H4DA 4B9UA 4W92B 3FBFA 2W8KA 2YVSA 2XGQA 2VD3A 2WW4A 1U1NA 1R0AA 2RSQA 5J1PA 4OHWA 2DJWA 1NEEA 3IO1A 4A47A 4OI1A 3H5YA 1VQOS 1NJZA 4LQ3A 2HHXA 2HAFA 2I1RA 4ZPBA 4N8NA 4Y2AA 3V2UC 4OZ0A 4KO0A 3ZZYA 1X7VA 4IRKA 2VKRA 4DN0A 1FHTA 1RSCA 2BJEA 2I9SA 5CA5A 2RQ4A 6AT1B 3G6YA 2ACYA 2C28A 4KSEB 4FS2A 2VDHA 2WSCC 4ZLLA 3BV8A 4C48A 4ES2A 4USVA 2R8GA 4C9DA 4Q0BB 1U6FA 4R5PA 2HFUA 2E1CA 3GWCA 4ZK7M 5J2MA 1QUVA 4LJMA 2WCXA 2RHSB 2GMLA 1QSSA 3SBMA 1SL1A 3AODA 3H5SA 1AROP 1FO1A 2A6MA 2HFZA 3CC7S 2WAQD 3KHGA 1LQ9A 1TU0B 3DDKA 1NH7A 2XGPA 2ALZA 4P9SA 1H38A 2EG1A 1WHVA 2GZOA 2JEJA 1HMVB 4N76A 2B9WA 1DQAA 1LW0A 3QSIA 5AXNA 4USKA 2HZVA 3DRSA 3OL9A 2LA4A 1MN7A 3ZZPA 3MEDA 4DS5A 2B56A 2RE1A 3RBZA 4B9NA 3GMGA 1WORA 3PKMA 4Y6IA 3QLHA 2BOAA 3CCQS 2EFGA 3HHDA 4IO1A 2HWTA 5D4OA 2HNDA 1WSRA 4O3NA 3BO3A 2LQJA 3VAMA 1PO6A 1Q5VA 5I3PA 1WI8A 2K8GA 2V4QA 3QGGA 4DV7F 4DSFA 1GMWA 1VRQC 3HXMA 4QIGA 4F4AA 1U26A 1NM2A 2LQ8A 1SH3A 3CUNA 3PY8A 2FJWA 4U9RA 1AB8A 3GPAA 2AJ4A 2FJBB 3P3DA 4OX9F 4KV8B 3EVOA 4AFFA 3PKYA 1GK8A 3FJ2A 1IKVA 4L3KA 2C3PA 4DR1J 3TI0A 2LQBA 2AMCB 4RWWA 3DRPA 4WWSA 3A3PB 4QQBA 3DM2B 3K2YA 2CYYA 3QRRA 3B78A 3PVXA 2F8HA 4ZPTR 3MUVP 3W1YC 3DU5A 3HT3A 2FB0A 2HNYB 2Y0BB 3BYRA 4K2JA 4USTA 4TKTA 4X64F 1XMQJ 1S9EA 2Z0GA 3KWMA 4X4QA 5ETTA 1V3RA 1IR1A 4DL7A 5H9EJ 3KLIB 2AEJA 3D9BA 2BRKA 3G96A 2W9BA 2GIFA 5DJBA 3L9ZA 1R8CA 3OHAA 2BQUA 1CS4A 3MMCB 2J8SA 1Q5YA 3NS7B 3V4MA 1EKSA 4XPCA 4NYOA 4ZVHA 3UCGA 4CLKA 4O23A 4JV1A 2W2QP 3ENWA 3ZZ0A 3DI6A 2DR7A 1WF1A 4ED0A 4MYUA 5KT6A 2KYZA 1DJ0A 3RRHA 3M30B 5JVHQ 4NLWA 4KC5A 4GC6A 1V3SA 5DQHA 5DM7Q 3RB6A 1WG4A 3NGRA 2V8VA 4IOCQ 4A8OA 4F36A 1GX5A 1DURA 1NNDA 1GNKA 4PXCA 2AU0A 4ZN1A 4FYYB 1FNMA 2CJYB 2KT5A 2QL7B 3NY0A 4XDCA 3TAMA 2BA9A 1ELOA 2X1GA 3MWBA 3NXZA 3FZBA 1P1TA 4JP8A 1TK0A 1RHUB 3Q86A 2XHWA 4DOZA 4YDDB 1NK5A 2QFIA 4OQJA 1H73A 2ZH2A 2AQ4A 4KHMA 3I0RA 4FF4A 4BWJA 1Q8IA 3PYFA 2NUHA 4RLEA 3RR8A 4O0NA 4JYAF 1NSAA 2AIRB 3H2UB 3LW5C 5ETLA 3PYDA 4OJGA 2HNYA 1V9OA 1VR6A 4C3LA 4DV4F 4LF4J 4P10A 4OYPA 1SJ1A 1M0SA 1CC7A 1RWWB 2B51A 4KGVB 4F8RA 3KDOA 5BYQA 1VK8A 4J5OA 3IM8A 2HHPA 3GIRA 3SSSA 1N6QA 4LT6A 2OPQA 4QBUA 2AHOB 1KP6A 3RAMA 1GH8A 3PEJA 4KRWA 5KFAA 2E1MC 4J9QA 4CO1A 2ZFHA 4G1PA 2F40A 4HACA 2AF6A 3C19A 4Q2MA 1HIYA 4Z7YA 5C24A 3TWZA 4CO4A 1XK8A 1I51B 1WACA 1XBWA 2XS7A 4XO0A 2R2RA 2CQBA 2DCLA 1MMNA 1LWEA 1SH2A 4KAIA 2M7SA 5I42B 2EK6A 4A8MP 4HT5A 4IRCA 5F8LA 1KD1T 1IKXA 5CCMA 1R7IA 4E0DA 1RT2B 4RWXA 1FKPB 2KT3A 2AZ3A 3CCTA 4AD6A 1F5AA 2CFXA 2AWZA 4X66F 1RCOB 1HMVA 1T8EA 5KFIA 2M2BA 1Q53A 2FVQA 1H7WA 2VU5A 1FA0A 6FD1A 1C2PA 4FF2A 2J0XA 2KU7A 3DGPA 2OLWA 3HHLA 3K57A 2VFUA 3V5RA 4H4OB 1R8AA 4N47A 2IJFA 1Q82T 1GTEA 4CNYA 3MR5A 4Z2XA 3HHLB 1RWPB 2PC6A 4LIRA 2D3OR 2MTLA 1OPIA 3R6GB 2VJUA 3IWLA 5LSRA 4DV5F 4ZCLA 1YGYA 1SQFA 4ZJLA 1W7WA 2W7AA 3ZTRA 3LUYA 5CYJA 2B9YA 4M63A 4UOHA 4PYAA 2R8IA 2L9DA 2AJ1A 3D6MB 1HPZB 4WXWA 3VR1A 3F56A 1RT2A 5KFDA 2LQ9A 1TAQA 1S6QB 2C2OB 2RDDA 3GYNA 3OR1B 3O2IA 1R0AB 2X1AA 1BWEA 5J1NA 4DQIA 1F0XA 4F2SA 4FN5A 1SC1B 1R31A 1Y5NB 4MKYA 1KR4A 2XM3A 3JSBA 4DV3J 1X9SA 1HD0A 1E6VB 4DPOA 1IQTA 3ZZZA 2HEKA 2P2CB 2LXIA 1SCJB 3BREA 2V8GA 3NKYA 4KB7A 5E0OA 3H4BA 5H1SV 1RTJB 2DEJA 2PI5A 2MQNA 4HACB 1HWKA 2YKPA 3CD6S 1RWNB 1FE0A 5ETMA 1QAXA 3W5XA 4C6AA 4A8SA 3BQ2A 3DRRB 2CJ9A 2FQQB 2NXEA 4KE5A 4DPXA 1N5YA 2ZZTA 1KSPA 1HYSA 1U0HB 3M8YA 1T9VA 1UVLA 2HPUA 3SFUA 3TUJC 1VQMS 3PHEA 3J81j 1ULRA 5AE1A 2BX6A 4OYAA 1K73T 5KG1A 3HFKA 2W9AA 2KZZA 4ZCMA 2H48B 4TU7A 2KG0A 5AXLA 4W98A 4X4TA 2M8HA 1OS5A 3NS6A 3DOMA 4DPTA 3GSIA 1T3OA 3OTOF 4JI1J 3MOJB 2OTJS 4NCAA 3KMQA 3T5HA 1WJ9A 2C2KB 1X4DA 1MLAA 2HZCA 4RNOA 3W2WA 3OBIA 2O5DA 4DI6A 3BPSP 4G65A 1JXEA 2N3OA 4LF8F 1X5TA 2DR6A 1B4SA 2CZVC 3NP5A 3ZXWA 4ECYA 3R2DJ 2UVRA 2OFGX 3DLKB 4O3PA 3M8WA 1TELA 4B17A 3K8VA 4K50A 1SV5B 3D6TB 3M1VA 3BN4A 5C7PA 5B0AA 3JQMA 2XY7A 1NK8A 1M5SA 2V94A 2LMIA 3TAMB 2DXFA 4F3QA 1G3OA 1U25A 1KQGB 1ZS6A 2JVRA 2YX4A 4M5HA 4WU2A 1F6TA 2BBEA 5BR8F 2HK2A 4CZCA 3EM1A 3DDNA 2COLA 2DY1A 4FF3A 1XEZA 4X4NA 1RT7A 4Q7AA 4I2QA 4J7CA 2ZH6A 3BQ1A 3D54A 3ILIA 4DR2F 4ZVQB 3L7PA 4IFVB 5KFTA 2BABA 1XMOF 1YZ6A 3DI6B 5LMUF 5HMWA 3FSIA 2AGQA 2UXCJ 2CQIA 4UUWA 1MNEA 1DFDA 2HLUA 1EKRA 2RB7A 4F7VA 2EC2A 2ZUAA 5L1IA 1CG2A 4B3RF 1PJ6A 1RAEB 1CS4B 3MMCA 3SQGA 2BV3A 1BGXT 4L3NA 4MIWA 4NI2A 4C11A 2ZM6F 2AYBA 2BJDA 1S4FA 1FRIA 1UWBB 2HVZA 4DJBA 2W24A 1JB0C 5K5MA 3CIMA 2CQPA 1U24A 4NZ6A 5LM7E 2XYHB 2BKPA 3W61A 4WCEQ 3WDOA 1NMEB 2VPYB 2XHCA 3M8QB 4NMXA 3EPGA 5GADU 2UU9J 1JLEA 1UVMA 1I3OB 5JXSA 2ZZMA 1NKEA 1PYTA 5LJ3Y 1FJGF 2VONA 1MG7A 2B7CB 3HVTA 2GA7A 3DM2A 3L95X 1SPBP 4FKYA 3U1NA 2JWNA 2BW2A 4JI0F 5B0BA 7FDRA 5B0DA 2K3KA 4DZDA 2MZSA 4KH1B 5D6GA 3PW2A 3N6LA 1IR0A 3GFXA 2UUAJ 2NXUA 3I0SB 5GMEA 2MGZB 3G6XA 3K58A 2N3LA 4DL3A 5GAGI 4NLOA 4BHQA 1S72S 2FJVA 2RHQB 3I32A 5HJXA 5DDQC 4O0IA 3PW4A 2IMWP 4DR4J 2UUCF 4F02A 3KUGA 2IHR1 3FEXB 5JUMA 4DV2J 1NKCA 1TKTB 2YNHB 3KYLA 2IVFB 3E51A 3O8WA 2E1AA 1ZZFA 3G86A 3K8WA 4LRCA 3MUMP 2KB2A 1TQLA 2H65B 2YKNA 5KOWA 4P6QA 2VG6A 2FY1A 4LF7J 4LR9A 1TUGB 1N5TA 1HNZJ 3GYGA 5D4LA 4LF9F 2W4PA 1UEUA 1JKHA 2EFVA 3UDEA 3MM9A 4OHVA 3R7BB 4MK7A 5A2QY 2G0CA 3DRSB 4N41A 1J27A 1LW0B 2GW8A 4WTOB 4CTAA 4EFAC 5DGAA 2IRXA 1XJWB 4FBUA 1G6BA 2M3DA 3MMAB 3U27A 4DCPB 1FJEB 5KFQA 1MROA 2VFRA 3WHIA 2R2UA 1XR5A 2HRUA 4F26A 4DX7A 4ILMA 3OT9A 3AOCA 2QLXA 2XSJB 1PKUA 1PAUB 2GO8A 1V5VA 2U1AA 4CLWA 3M9OB 3ELHA 1CC8A 3VAFA 2XS2A 4J9NA 4DSJA 2GHVC 3PJXA 4YDXA 2E5LJ 1VQ6S 4ED3A 3FZ2A 3KHLA 3T1YF 4GKJJ 4R5PB 4X4UA 1U2CA 4C98A 2UUBF 4IQXA 1WNEA 1YZ7A 2DY9A 2W9CA 3UNGC 3HZGA 4Y34A 5FLXU 1I5OB 1UZDA 4O44B 2ERRA 4Q8FA 2VFSA 3AJ1A 4NCBA 2QG9B 1S1WB 3MR7A 3QWPA 3C8YA 1S48A 3T5JA 1M90T 5CD4H 1SB6A 2JOQA 4DG1B 1KQSR 2HGMA 4C0BA 3LWMA 1FKAF 3SV3A 1HA1A 1JIHA 3A3NB 1GAOA 3M05A 2XMKA 1IBLJ 3G9CA 1R0CB 4IKAA 4NA3A 1FEHA 2XI2A 2W2NP 4DR5F 1DTTB 1S6UA 2QTWA 4R8UA 4TQRA 1JLGB 2FHMA 1W2BR 1WKLA 5I3UA 1BWVA 4OL8A 4KKOA 2B5JB 2DHXA 2WVCA 3D66A 4HTIA 2DK2A 2LEBA 3LP1A 1NK4A 3C2PA 1DY3A 2IAJA 2XTJP 3NL0A 1Y4ZB 1Q8BA 1I94J 2N4CA 1KLMB 2E7XA 4LFCF 3C16B 2D69A 3CJ5A 1EP4B 4HI2A 3BS9A 4OI2A 2X1BA 3JSMA 1N0VC 1LW2A 1N0UA 1TVRB 3MTKA 2BEFA 4CRJA 4C8NA 2CJBA 3G8QA 5LXRA 3D5MA 1S1VB 2KRRA 1VOMA 4ETZA 1QUPA 2GMHA 1U02A 2CVEA 1A7GE 3IFEA 1TTHB 4DV0J 2PEBA 4F67A 4KFBB 1W25A 3SDEA 1NSPA 4K5SA 3GILA 1K1SA 1CJKB 2P9GA 4OHXA 2D9OA 4JI6F 5DETA 5IT4A 2CJAA 1V6HA 3QO9B 1NZ8A 2YNFA 4KT0C 4NZ0A 1GTHA 1BMQB 2Z56B 3NCRA 1GFWB 3MM7A 3OXGA 2MZ1A 2FZKB 3SYZA 2DIUA 2YPZA 1T3NA 2J0QD 2OPRA 2AGPA 2PMWA 2VB6A 1V3ZA 3T1YJ 4GKJF 3G87A 1O5JA 3I87A 2NYIA 3ZC4A 1NK6A 1Y5LB 3OLBA 1YJ7A 1A6LA 3Q8UA 2VF3A 4HH0A 3MAAB 2BJ7A 2I5JB 1WC0A 2VG5B 3MM8A 4M5NA 2W4CA 2EBEA 4USMA 3I82A 3GCWP 1FRJA 2M70A 1L3SA 4N8OA 3R1LA 1HNIA 4DL4A 4YQWA 3U02A 2A6OA 5A8KB 3DLJA 3N4WA 1KTVA 1VHFA 3FKBA 1AFIA 5J2PA 3GONA 2RU3A 1RT1B 2HKEA 3CTRA 1FXLA 1UJ4A 4OV6A 1SQGA 1HNZF 4URGA 1RKJA 3A1YG 1RUSA 3VV2B 5J1EB 3LA0A 3M8ZA 2KXNB 4UY8T 3POTB 1FXDA 1HBOA 3S6EA 4ICLA 2DHSA 3MMJA 4DV2F 2KKHA 1CJTB 3IS9A 5HSPA 2DHAA 3C14B 4LRDA 5F41A 1RT5A 4RKUC 4EEYA 4NLXA 4WBFA 3JAMY 4OMFG 3KK1B 1U1KA 1N34J 1RAJA 2ROGA 4DBQA 2HQCA 4IYQA 4ED7A 3GB0A 4AXIA 3M2RB 3MR2A 1NSQA 2HIYA 2H9ZA 3EGWB 1AA1B 1Q95G 3WX4A 1RT4B 2VA2A 1CEZA 2ZJRQ 3O1LA 1QJHA 3MMBB 3TAQA 4N5SA 2MY8A 3BSCA 3MD3A 3R8YA 2AX1A 2FD2A 2RNEA 4H4MB 1FFGB 2YXLA 1S6OA 3CO0P 4FYWB 6FDRA 2UU9F 2VG7A 2NZ4A 3QJPA 2VOOA 4HDHA 5DZ7A 1SI9A 4XTTA 5KTQA 1RBAA 2EC0A 1FX4A 4G6VB 1IKYA 3UWTA 5J2QA 1EX8A 2OD6A 3RJMB 2YNIB 4U7UD 4JV5F 2MLZA 4NLDA 3V4IB 1TMJA 5CYMA 4U8VA 1CJUA 1RBLA 2MKSA 4QYRA 2ZM6J 2OPPA 3CC4S 4MIBA 3UR0A 3BJYA 3KOAA 2GVDA 3G2XA 4I1TA 1TKZB 3AJ2A 1S57A 4NYPA 5M2RA 5LMUJ 1U1QA 2UXCF 1WKJA 3HFVA 4USWA 3CCSS 5K8PA 2HS0A 4TXSA 3CCUS 1KLNA 3W5ZA 1VBYA 1VQLS 3KK3A 2HHSA 1TMMA 1G1XA 1DHMA 1FK9A 1HQUA 2DITA 1OPZA 1HBUB 3DLGB 3QIPB 2BKNA 2EKYA 4GO5X 4WXOA 3TJ9A 2HGNA 5FLXY 3MAQA 2PDAA 3KK2B 2X3DA 3T19A 4WKYA 2L41A 2AZ1A 4HHUA 3PO4A 1TV6B 3M32B 3VVTA 4X4OA 5D3GB 2L08A 5CD4A 1JJ2R 4PG5A 2FHJD 3HVRA 1VBZA 1QE1B 2UXBJ 2MDAA 2XMMA 1R3NA 3DNCA 1T05A 2NCKL 1T9UA 1RTDA 1QTMA 1OY6A 3CWJA 4F25A 3QT6A 2FLNA 2HBYB 4HVZA 1QAYA 5LT5A 4ZA1A 2OSRA 4HTJA 3EX7B 4I7FA 5BYRA 4GRSA 5B0EA 4ES3A 2DNKA 3T1AA 2XYGB 2LU1A 3LANA 5IV3A 4CI0B 2QV6A 4OFZA 3O5TB 1HBNB 1F2GA 2GVZA 3LAMA 5B0FA 1L3VA 1HWIA 5IWAF 5A2QU 4QZVB 4YS2A 5KFVA 2XLJA 1S1TA 4CT8A 3JYTB 2HMIA 2ZKUA 2KJVA 1GXLA 3UDCA 1S76D 3AOAA 4JI7J 3KJVA 1HNVA 1ZYQA 3ISND 5L1KA 3RZAA 2JHEA 1EQ0A 4NYZA 2MSSA 2Z2MA 4Q5VA 4CIOA 3CMAS 1TL3B 5JVGQ 1HWJA 2C3MA 1S9FA 2W7PA 1X0PA 2I2YA 2F5GA 4B9MA 2QL9B 2F7VA 3KLGA 1FKOA 1NHVA 3GV7B 2R7WA 5KFSA 2BM0A 1HR0J 2IJRA 3IRXB 4DLGA 3NGTA 4M95A 1MMLA 5F8NA 1UCNA 1CQMA 3DCAA 3TA1A 5FD1A 4QYZJ 4CLYA 1CPZA 1JNZB 1MWQA 2GCFA 4JI5F 2DPIA 2RDJA 3BYPA 3AD9C 3UVJA 1N5QA 5K8NA 3KLGB 3DYAB 3HFZB 4ZVPB 4PWDB 1NPKA 4EWTA 2F3JA 3KHRA 3TR5A 4RW4A 4CCHA 2CQCA 4RX6A 1HWUA 1X4BA 1TL7B 2FGCA 1IBKF 2ZH3A 3ET6B 3OFGA 4NL5A 2P8IA 3VAKA 3NNAA 2C42A 2HMIB 2DEIA 4JI3J 3AT1B 2H5IB 2YKMA 2JEFA 2G1HA 1HI8A 4UTGA 5KFJA 2Z8QA 3UR3C 3AOBA 1KVIA 2AKWB 1AW0A 3NWGA 1VRTA 1RGVA 3BSNA 5E5NA 4WP3A 4PCQA 1P8GA 2VASA 3HHEA 3L3CA 2HHWA 3L7OA 1DBDA 4DV1F 2DNGA 2RVJA 2H1YA 1IUJA 1Z2LA 2CXEA 2H5EA 1S77D 1D09B 4OHZA 2CPEA 5HI7A 4C4WA 3KDNA 2ZBPA 3PJWA 5GMDA 1T05B 4ANCA 4F3MA 1QE1A 1RAOA 1AUSL 2P9CA 4ZPAA 2B4UA 2V5HG 1YBUA 4NCGA 3AFGA 4DQRA 2JL9A 2DBBA 4P75A 1Q7LB 5BJRA 5C2GA 3WZ0A 4EI2A 4LFBJ 5HQLA 3NGSA 4C8OA 2QT7A 3OHBA 1U1MA 1DARA 3ADAC 3OR2B 3UQSA 2B9XA 4ALZA 4J9PA 1Q0NA 3SZ2A 2E7VA 4OI4A 1VC6A 3TUIC 2V69A 1JLAB 4DV4J 4LF4F 2LXFA 3AD7C 2J0WA 4GVBB 3QIPA 2OI2A 2CDQA 2M88A 2D3UA 2BRLA 2EBGA 3CMQA 3IXQA 2VFTA 4WPAA 1S59A 3GFYA 5A76A 4JI3F 1XR6A 2JNJA 3US5A 3HO1A 1TKZA 3G82B 2MMYA 2BANB 4AQYJ 2AT1B 1RAFB 2BM1A 5AJ3J 4ECUA 3BKTA 1GMUA 3W66A 2QJ3A 4ECTA 2A0FB 2NXNA 4FNHA 3I9ZA 3VF0B 5KFXA 5E3RA 5DLGA 4CO0A 2MKJA 2AD9A 2V2QA 4CNZA 1YBTA 3GIKA 1IKYB 2XCAA 4ZP7A 3ISZA 4IH6A 3N01A 1K9MT 3QJLA 2K1RB 1LV5A 5A8WA 4H4MA 2QFJA 4PAAA 1IWGA 1KQFB 1SKSA 3C6UA 1HNXJ 4LBPA 2YKAA 3RB0A 1AZSA 1CVJA 4Y28C 3Q2TC 1DQ9A 4KGZB 4ZVGA 1XC9A 1RABB 3MPYA 3QWUA 3JSRA 1S12A 3O6QA 2IJNA 2CWKA 2WONB 2J6UA 4C97A 2KRBA 2ATCB 1EAYC 5G0RA 5EWGA 1YWXA 4MMOA 2XMAA 2MYFA 4NLPA 4PXEA 3KXDA 2RRAA 4QOTA 2W7OA 4B3OA 4J9UE 4TYBA 2J6SA 2EKNA 2CQDA 1RBOB 3C14A 2OHDA 4L76A 4PXBA 1Y3KA 2AYEA 2HRYA 4OLPA 4F4KA 2DO4A 3Q23A 3SV4A 2MKHA 1DLOB 2KH9A 4ECWA 4WKRA 4RPFA 1O8BA 1Y5IB 3POTA 4CLUA 1XMQF 4JI8J 2A10A 4P2XA 3GV5B 5IWAJ 1TUVA 3GG0A 4DX8H 2OGUA 4JI2F 3IRWP 2CQ4A 4CM2A 1SVDA 5AT1B 1RT1A 3VGSA 5JJBA 3GCXP 1KOHA 4DX5A 4B3SJ 2G2OA 4B3SF 2JFKA 3DOLB 4C8ZA 1P1LA 5A6WA 1PSDA 1HQ2A 1IVZA 2V68A 4ZHRB 5A8KA 2XO7A 4MKBA 4JI8F 4CH0S 1TL1B 5HLFB 3MECB 1S99A 2MZJA 4QU7A 1TKDA 5HMZA 1O51A 1RWOB 2UXBF 1HD1A 4QYZK 1UFWA 2FUG9 3VQSA 2MQ8A 2DKOB 4FYXB 5F8IA 5F8GA 1KQKA 4FDFA 3T9ZA 3BGOP 3MM6B 2XS5A 4IG0A 3FFIB 4LSLA 4HDGA 2OPSA 1LEOA 3T41A 4PQUB 2WBMA 2WOMB 3C15B 2QA4G 2ZJQQ 3TX8A 4I67A 3M2UA 2LDIA 5THWA 4WJBA 5IQ6A 3V6HA 1U4BA 1F9FA 1HNXF 4OZJA 1RHQB 1LWCA 1TAUA 2I8EA 4ZDNA 5C25B 3FCWA 4I2PA 5D0HA 2KFNA 3CDEA 2ZNYA 1S1VA 3W3SA 1YTYA 2HFNA 2LQ5A 4N56A 3R5CA 3CJRA 4KY3A 1NPRA 2FJXA 1Y11A 1Y9OA 2PA3A 2W2MP 4TNOA 5IFMA 2QIFA 3QPIA 1TVRA 4TY8B 5E3CA 3Q8RB 2P6TA 3FQLA 3MCMA 4KBIA 4QIEA 1QVGR 1BQXA 4B9SA 1E6YA 3K17A 3MCSA 2DNPA 4LSZB 3SSRA 2V8PA 5AJ3F 1C0UA 1URRA 1SIZA 2MEWA 2B8QA 3H20A 4AQYF 4ECSA 3RBEA 4DF4A 4MYTA 2ZZNA 4K4XA 1H6KX 1FFSB 3LP1B 1N88A 2B5JA 4I2PB 4KKOB 4PQUA 5C25A 3J7YI 1LWCB 1JLGA 4KPYA 1S4EA 2AJ0A 4YB7A 5LSLA 1DTTA 1FTRA 1YVFA 4NASA 3P49B 5T7LA 2B3TB 3HSGA 1LK5A 4ZS6A 3FMBA 4EZ9A 3CF5Q 4AT1B 2R9LA 2R3VA 3FFIA 3LALA 4IG0B 1RKIA 2FYXA 2HFSA 4LSLB 4M5KA 4RO0A 2VH7A 1HKAA 3PFEA 8RUCA 4C3KA 3D7SB 4EGLA 1G4CA 1RWVB 2XMUA 4PWWA 4XPEA 1X9MA 1XNRJ 1ZOTA 2DHGA 4V1Ak 2BE7D 4KHRA 3A8JA 4YR3A 1SIWB 3PR5B 1VIOA 3GIMA 1LNQA 4LMZA 1F9EB 3LPYA 1S9GA 2LEPA 4P7VA 1RT6A 2GIQA 4U8YA 3THPA 2BDPA 5LL6d 2WB4A 4ZHRA 4DSKA 1JNRB 1VDHA 3UD3P 4CH7A 3QYYA 2CZ4A 3N28A 2WVEA 1FRHA 2OMOA 3I5AA 3W60A 4EK2A 4ER8A 2ZH9A 3RW6A 3TYTA 3Q8VA 3EPIA 2DRBA 4YOEA 4RBUA 2LYVA 3OD2A 2MZRA 2JLFA 4QR1A 2GHWA 1RU2A 3D1HA 5I4MA 1KNZA 4GC7A 2B6AA 2EFOA 3AH6A 3AQPA 4DFKA 5HP1A 3QFWA 1REVB 2EK1A 2IDEA 1D9AA 3MEGA 1IBMJ 4NXMF 5E7OB 4EO8A 1HBMA 4ZPDA 5DQGA 1X5SA 5LSOA 1S0VA 4IH5A 4AUKA 2MQQA 5G0RB 1QD1A 2JH3A 1T02A 3NGUA 5KFEA 3K59A 4NRTA 5HATA 3A8EA 3SCJE 2YKNB 5KFRA 2FZCB 4DFMA 2DNLA 3P4UB 4JI6J 2A2DA 4U95A 3GSDA 5EN1A 1NZAA 4ECVA 5DG9A 4DV0F 3HJVA 2HRTA 4ZPVR 3Q8SB 2E7WA 3NS5A 4ED6A 2BW7A 1EIYB 2K1RA 1EHWA 3EZUA 3VGUA 2N7YA 4WIIA 4Q45A 1HR0F 5KFCA 2GGPA 1FWPA 3GYXB 2DNHA 4GVLA 5IT0A 1RE1B 3HHLC 2ZBRA 1FCAA 2XG8A 4F0MA 5H9EK 4OI0A 2VC1A 5DO2A 2AW0A 2HGLA 2F1FA 1RJJA 2DO0A 2V8HA 1JLFB 2ACMA 3HVTB 3NBPB 1UVKA 3AD8C 9RUBA 1L5UA 1B99A 4OYBA 2ZC4A 2I38A 3U1LA 4LFCJ 2IDLA 1I94F 2BANA 4PKDB 2OD4A 4JI7F 2KG1A 1NK0A 3GFZA 4K8RA 5HVFA 3HF5A 1HWLA 3L4BC 4ZPWR 2F8MA 5KFPA 1VC5A 3K5PA 3TJAA 2V4JB 2LFVA 2ILZA 4RU2A 4B9LA 1F3FA 3M6VA 3EICA 2Y8WA 4GVBA 4UQGA 1UWBA 3LF0A 4AXJA 3D68A 3Q22A 2M8DB 1TFYA 3DHXA 3SQGB 4P73A 2VHGA 5C42B 1WHWA 4DR7J 1XERA 4C2MA 2VA3A 2DNQA 3IR5B 3KHHA 2CJKA 3PDNA 4P2MA 1NDLA 1B0TA 2DRDA 1BHNA 1X5OA 4I64A 4ZLNA 4QWCA 1C1CB 1S5ZA 3B82A 3ETMA 4IFVA 3GJRB 3G8SA 4YEAA 3G71S 1TZ0A 1U2RA 2JLEA 1JQGA 3I56S 4B9VA 1NB2A 3B4MA 3IR6B 3DRXA 2HG4A 2UP1A 1SXLA 2KVQE 3OPKA 2RIJA 3VWSA 1UPMB 1M1HA 1ZA1B 3G8TA 2ZHAA 4DSIA 4IH7A 4WFBQ 4N77A 2B0GA 3SCIE 2B9EA 2R7SA 2HHTA 2ASLA 4K4YA 3TA0A 3J80Y 1T7PA 3Q8PB 3PM9A 1YK9A 4OYZA 3WBZA 2EI5A 2SXLA 3DGVA 4OYMA 4IO9Q 4RJVA 2IBKA 1NDCA 4CLLA 2QN6B 2YKMB 2HHVA 1X5PA 2C3OA 1R27B 4DX6A 4J9LA 2GFFA 2HFOA 3DOMB 3MR3A 1SJ3P 4UOCA 3MZIA 4A8XA 4DSEA 2IVMA 2L48A 1U1PA 4V19J 4BWMA 2KT2A 3SFGA 3LTOA 1TL7A 2ASJA 2G4BA 2OSQA 3T6BA 1PILA 2FHOB 4WK3A 3KLEA 1W26A 3IBWA 3OTCA 4RW4B 4YR2A 3DOKA 4LF7F 2FVRA 2R7XA 4PWDA 1Y0HA 1X4FA 2VPZB 3DYAA 4Y2IA 4QR2A 2NLWA 2K06A 3UVJB 1N5YB 2C22A 5KG6A 2D3ZA 2RUGA 4DV6J 5D8HB 4MK9A 5DDPC 2VJVA 4AL6A 2PO4A 1VQ5S 4BDPA 4N7TA 4DR4F 2XB2D 2CPXA 2XQCA 1TKXB 4A46A 3HCXA 2D9PA 4LF5F 5EX3A 3H0PA 5ETVA 3T6JA 3TRGA 4K4SA 2DR5A 3EXCX 1U2FA 1QSYA 1YSJA 2MHEA 4I6YA 2F9DA 2AEMA 4NLSA 1LFWA 3CJ4A 5D0RA 1S6QA 3OR1A 3W8GA 1TL3A 4D3GA 3AXMA 3KMSA 1FDAA 4USHA 3BZQA 1HPZA 4LF5J 5HQ8A 1D8YA 2C2ZB 4NLVA 1YJ9S 4KR0B 1DTQB 2BE2A 1NDPA 3JQKA 2CQHA 3W9JA 3IC1A 5E3QA 4DV6F 1KONA 2RUSA 4XDDA 2PEHA 3CULA 1Q7YT 4Y65A 2WBRA 4ZVUB 4EZ6A 1EARA 1PYOB 1RACB 2GQCA 2QA4S 2K2PA 2GVZB 3QGHA 4HL9A 1HNWJ 4I4BA 4P74A 1HBNA 3J81Y 2RRBA 2IA6A 3P5BP 1R0BG 2ABYA 4KJIA 2HQDA 5DLFA 3DGPB 4RW6A 4F4YA 3QQCD 4O3QA 4DUYF 1C1BA 3D6FB 3LGNA 3UN5A 1YI2S 1XMOJ 1VCTA 2H5JB 4CO5A 2J8AA 3EE3A 2C2MB 1Q86T 4W4MA 1UETA 1H2UX 2GHPA 5ADZA 3OL6A 4BCAA 2QA1A 1TP7A 1FKPA 2XMJA 2Z30B 3JS9A 2G2YA 2A3JA 3LGHA 2CG4A 2CUYA 3CE8A 2ZOGA 5D15A 1KKHA 3NAHA 2UV8A 2NREA 3DLHA 5D3GA 2UVVA 3M32A 2DCUB 3PACA 3W5YA 4P71A 4ZLJA 4H4KA 2NZCA 4KGMA 4RUHA 1YQHA 1SUQA 2ZD1B 5J2NB 3QBCA 2BR0A 4CO3A 2CADA 1N54B 2BQRA 4K7QA 4CDIA 2PFDA 3PYEA 4LBHA 5C24B 2KTQA 1IM4A 1FK9B 1HQUB 4C3MA 1HNWF 2ATLA 2ZNZA 1RTIB 2HS4A 3CJ8A 3D1QA 3KK3B 4DL2A 3TZZA 3RBXA 4DQPA 2LDYA 3RUBL 1N6QB 2DPJA 2PD1A 3OFHA 4PPDA 3RB4A 1JXLA 2XCPA 2CNOB
chains in the Genus database with same CATH topology
5ETOA 1TMJA 2QX0A 1G4CA 3MCMA 3HT0A 3MCOA 5ETNA 1RTZA 4M5JA 2BMBA 3ILIA 1RAOA 2F65A 3IP0A 5ETPA 4M5NA 5ETKA 4AD6A 1EQMA 1EQ0A 3HSZA 3KUHA 4CRJA 3MCNA 1F9HA 1IM6A 3UDVA 5ETTA 3ILLA 4CYUB 5ETQA 4M5LA 4F7VA 4M5MA 5ETSA 1RU1A 1TMMA 1Q0NA 1KBRA 3QBCA 1CBKA 4M5IA 3HSDA 5ETRA 3HCXA 3KUGA 4M5GA 3KUEA 5ETVA 5ETMA 1RB0A 3HSJA 3HSGA 1HQ2A 3HD2A 3UDEA 2F63A 4CWBA 1RU2A 1DY3A 3HD1A 5ETLA 4PZVA 3UD5A 1EX8A 4CYUA 4M5KA 3ILJA 3ILOA 4M5HA 2CG8A 1HKAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ETO A;  1TMJ A;  2QX0 A;  1G4C A;  3MCM A;  3HT0 A;  3MCO A;  5ETN A;  1RTZ A;  4M5J A;  2BMB A;  3ILI A;  1RAO A;  2F65 A;  3IP0 A;  5ETP A;  4M5N A;  5ETK A;  4AD6 A;  1EQM A;  1EQ0 A;  3HSZ A;  3KUH A;  4CRJ A;  3MCN A;  1F9H A;  1IM6 A;  3UDV A;  5ETT A;  3ILL A;  4CYU B;  5ETQ A;  4M5L A;  4F7V A;  4M5M A;  5ETS A;  1RU1 A;  1TMM A;  1Q0N A;  1KBR A;  3QBC A;  1CBK A;  4M5I A;  3HSD A;  5ETR A;  3HCX A;  3KUG A;  4M5G A;  3KUE A;  5ETV A;  5ETM A;  1RB0 A;  3HSJ A;  3HSG A;  1HQ2 A;  3HD2 A;  3UDE A;  2F63 A;  4CWB A;  1RU2 A;  1DY3 A;  3HD1 A;  5ETL A;  4PZV A;  3UD5 A;  1EX8 A;  4CYU A;  4M5K A;  3ILJ A;  3ILO A;  4M5H A;  2CG8 A;  1HKA A; 
#chains in the Genus database with same CATH topology
 2G1D A;  2J7U A;  1YJW S;  3CGI A;  3EVW A;  3Q83 A;  1GXT A;  3RTV A;  2Q43 A;  2HVD A;  1VQ7 S;  1HW9 A;  5CAB A;  3D0G E;  4PUO A;  3V4I A;  3ZZT A;  2EVZ A;  4NOH A;  3K5M A;  3OXF A;  1F9H A;  4FZV A;  3T3F A;  4DFP A;  2WRM A;  1PAE X;  4KHP F;  2VG7 B;  2KM8 C;  4PAB A;  3UO0 A;  3CXC R;  4BC9 A;  3I0R B;  5F8M A;  3LO3 A;  5HRO B;  2RKI B;  1UJ5 A;  3MMB A;  1Q81 T;  1JLQ B;  2AYM A;  2GX8 A;  4F4W A;  4CWB A;  3LOU A;  2ZKT A;  1GMV A;  2YQ0 A;  3E01 A;  4LSN B;  4C7Q A;  3LP0 A;  4QR0 A;  5HO4 A;  1VQN S;  4PRF A;  1IBC B;  3CJ2 A;  2HBQ B;  4ZP9 A;  3TAN A;  1KS2 A;  3KNG A;  1WOO A;  1S49 A;  2HUR A;  3NLC A;  3H25 A;  4KGX B;  4DL0 C;  3KK1 A;  3SCL E;  1UA1 A;  2E1P A;  3MD1 A;  3H5X A;  1T0T V;  3I96 A;  5ETP A;  3M30 A;  3WIU A;  1K47 A;  3MPV A;  4M5D B;  4Y0F A;  3KLV A;  3EVM A;  1HAR A;  2ZHO A;  5IC4 B;  3SMZ A;  3OUY A;  1WDT A;  3CCJ S;  2D41 A;  2MJU A;  2FC8 A;  2JZ5 A;  3H2V E;  3E2E A;  4GKK F;  1JLC B;  3RG6 A;  5GMK a;  4OHY A;  1ZM4 A;  1S79 A;  1VQY A;  3V81 A;  1AXQ A;  1Q1K A;  2BKO A;  1VIX A;  2RF2 B;  3DC2 A;  3IA0 A;  2F8E X;  2KFY A;  5EX0 A;  2EG2 A;  1VQ9 S;  2Z4P A;  2OEL A;  2ADC A;  2E9Z A;  2R7T A;  3GII A;  2E5L F;  5J2P B;  2V4R A;  1WDD A;  2IPO B;  2FVC A;  4DDF A;  3JTN A;  5KT4 A;  2W9B B;  1F60 B;  1RB0 A;  3G6E S;  2LEA A;  1IBM F;  3P5T L;  4NXM J;  2J76 E;  3BSO A;  5E3P A;  1HNI B;  2QC3 A;  3HD1 A;  3TX0 A;  2QYC A;  1TK8 A;  1N5S A;  2R4F A;  3H2L A;  4F04 B;  3V6K A;  2RQK A;  2ZIT A;  4LQ9 A;  2N82 B;  2K7J A;  3BBB A;  4IFY A;  1RK8 A;  4MIA A;  1C0T B;  2YNG A;  3HMJ G;  1ICE B;  1ZAX A;  4A8K A;  2AJ2 A;  4NLT A;  1OSC A;  2DNR A;  4IUF A;  5DQI A;  2Z2Z A;  1S7I A;  2YWW A;  1JLB A;  1S1U A;  4LF1 A;  3W64 A;  3DRP B;  4DFJ A;  5KAK A;  3TQ1 A;  1SJ4 P;  1WHY A;  1KC8 T;  1ZAW A;  2FLO A;  3MCN A;  4NA1 A;  3UD4 P;  1IKV B;  4L72 B;  3MM7 B;  3OL7 A;  2MY7 A;  1H2T Z;  4BBY A;  2YNF B;  2MQL A;  2YKQ A;  3LP2 B;  5GAD I;  3OVA A;  4IRD A;  2XNQ A;  5I3U B;  2GAG C;  2QMU B;  4NZ7 A;  4ZJQ A;  2BE9 B;  2VDI A;  4U7C A;  2WVD A;  5B7W A;  3HLU A;  3CIZ A;  4WE1 A;  2Y3Y A;  3MUT P;  1L3T A;  3FCH A;  2V2Z A;  4AYB D;  3ETO A;  4DQS A;  3GG1 A;  4R25 A;  2DR8 A;  1VBK A;  2HND B;  3H40 A;  1QLN A;  2J9C A;  2AEF A;  2XBP A;  3HDS A;  1LXJ A;  2UUA F;  1SC4 B;  5HN0 A;  3SCK E;  3CJ0 A;  4BLG A;  4CM0 A;  2CPD A;  1YIJ S;  3UPF A;  2RD5 C;  5B09 A;  4ENO A;  1U49 A;  3EJM A;  4HHH A;  4K4T A;  4KTQ A;  2NQP A;  3TAR A;  3G4S S;  1EET B;  4MK8 A;  3TOQ A;  1HHS A;  2KVI A;  3OVB A;  3FC9 A;  3FEY B;  4O4G A;  1KLM A;  2GO9 A;  3TP2 A;  4ELT A;  3DHW C;  2CPZ A;  4ECR A;  2DB1 A;  4JYA J;  3M8S A;  4J9S A;  1BXN A;  2YH1 A;  4YFU A;  3M6X A;  1X9W A;  3ZNJ 1;  4U7U K;  2OML A;  4D3H A;  3QAE A;  2CPF A;  1C4C A;  4Q0B A;  5B08 A;  3R7N B;  1YJV A;  4WYL A;  3ITH B;  3JSY A;  4F3O A;  7AT1 B;  1SJF A;  1FTC A;  3TAP A;  2ZJP Q;  3EDQ B;  4NPO A;  2E1R A;  4MFB B;  5IM0 A;  2BVZ A;  3JXO A;  2MKC A;  1FI4 A;  1FNX H;  1HHQ A;  4WYW A;  2OFH X;  3HZE A;  2B7B B;  2XYP B;  2YX1 A;  2YWE A;  1BD6 A;  3N5B A;  4OZL A;  3W65 A;  4DPU A;  1S1W A;  1VIS A;  1H74 A;  3DRY A;  3IP0 A;  4DR2 J;  3RR7 A;  2B4O A;  1HLW A;  2DRA A;  4O44 A;  3CW2 C;  2C2E A;  3DN9 A;  2XEX A;  2FY8 A;  3GJS B;  3PRD A;  4MFB A;  5IM0 B;  3LH2 S;  5BR8 J;  4DV1 J;  4DLE A;  1U45 A;  2J7K A;  1ZM9 A;  3ITH A;  4F0K A;  5HMX A;  4DN9 A;  1HYS B;  4LFB F;  2DGQ A;  1K0V A;  3DU6 A;  3MTJ A;  1RT3 A;  1ZPV A;  1M5K C;  2KZM A;  3A13 A;  4QIF A;  3D28 A;  2ADB A;  4P2S A;  4DUT A;  2ZE2 A;  2G0I A;  2C3U A;  2OEK A;  1NO8 A;  4HKQ A;  2XSJ A;  3PR4 A;  5HMY A;  4LF8 J;  4EYI B;  4DEZ A;  3P8B B;  3B6B A;  2HHQ A;  1RWU A;  2IM3 A;  3I6P A;  1U1R A;  1U1L A;  4ID5 A;  4ILR A;  4CTA B;  4O4G B;  3AB2 B;  4F2R A;  1RYR A;  4LRE A;  2R2T A;  1SJR A;  4OX8 A;  3MCO A;  2YWK A;  3MM9 B;  1Y7P A;  5ETN A;  1UPP A;  2Y1R I;  1WEL A;  2MZQ A;  2C2N A;  4JI2 J;  3SXL A;  2DH9 A;  2VG6 B;  1GT8 A;  4IR1 A;  2YQ3 A;  4TVA B;  4OX9 J;  5KT5 A;  5CZV A;  4YB6 A;  3ZNU A;  2ZUG A;  3PIP Q;  1QAJ A;  1BQM A;  4WE1 B;  1KBR A;  1QAI A;  1OO0 B;  2HHH J;  2ZWP A;  1XNQ F;  3MPU B;  3QAT A;  4DCJ B;  2E9R X;  1VBX A;  4X4V A;  4LR8 A;  1WG1 A;  2IC3 B;  1FDD A;  3FDS A;  3HX9 A;  3P45 B;  3TZW A;  3B54 A;  3LP2 A;  2P9E A;  3VCD A;  3I0S A;  1OIA A;  4NA2 A;  4LBI A;  2MGZ A;  2RH3 A;  4DV3 F;  2F4V J;  3ZZU A;  2VQE F;  5HK4 A;  1FEE A;  3R1H A;  3KG4 A;  1TK5 A;  3PRB A;  3JB9 k;  3GU0 A;  2FJD B;  1S1U B;  1MU2 A;  4ED5 A;  4B3T F;  1U09 A;  2ZOF A;  2RJZ A;  2VC0 A;  3I4P A;  5KG4 A;  4ZIV A;  3KLF B;  3IR7 B;  2QZ8 A;  2V9W A;  4Y2M A;  3NMR A;  4J90 A;  4K4W A;  5D0E A;  3SIP B;  1TFW A;  3KUH A;  3PHT A;  1X4A A;  3D4J A;  5GAH I;  3IWX A;  1BY9 A;  5IC6 B;  2ZBI A;  4DV5 J;  4TQS A;  3FRY A;  3H98 A;  3O44 A;  4P72 A;  5FDL B;  4ZMM A;  1B0V A;  4CQ1 A;  1N33 J;  3I9V 9;  3JTP A;  1M5P C;  2AYG A;  1TL5 A;  1FRK A;  1GQE A;  1H72 C;  5IZH A;  4CT9 A;  3OJS A;  2JEG A;  4PG7 A;  2BXJ A;  3QT7 A;  4IQM A;  3K5N A;  3H7H B;  3HSJ A;  4C8Y A;  5CCL A;  5KG0 A;  1CSJ A;  4JV0 A;  3VAI A;  1JLC A;  1MW7 A;  1P9Y A;  5E33 A;  1PG5 B;  4I68 A;  2YPY A;  1MMD A;  3NG8 A;  2PFF B;  3EZ5 A;  2X51 A;  3IWN C;  3KLF A;  4OYI A;  1YJU A;  4RW9 A;  3JQJ A;  4I2Q B;  1PYS B;  1RT7 B;  1MU2 B;  1WC6 A;  2IYI A;  2BJ9 A;  3HI9 A;  4NEZ A;  4ZPC A;  3MR6 A;  2W8L A;  3BQ0 A;  3BGR B;  3CCR S;  3NCQ A;  3NNH A;  1NJX A;  2IVY A;  4QIV A;  3ENV A;  3LP0 B;  5D4P A;  5E2Q A;  3E01 B;  2DGU A;  2VIH A;  2IC3 A;  1S0M A;  3CJ3 A;  1JLQ A;  3DLK A;  1RAI B;  2WW8 A;  3FMW A;  2RKI A;  4OJ3 A;  1U47 A;  1PCA A;  1NDK A;  3KFW X;  1RAG B;  4NML A;  3ZO7 A;  3UW1 A;  2W4D A;  3W2W B;  2F63 A;  2QYG A;  3IGV A;  5F3T A;  4CP5 A;  2PE8 A;  1NLK L;  1S1X B;  3MM5 B;  4DS4 A;  2JVO A;  4MJK A;  3W7B A;  3LQV A;  4J91 A;  3TUP A;  4PUO B;  1T11 A;  4OIX A;  4JBC A;  3FBB A;  2RS2 A;  3NWR A;  4I6W A;  5F3Z A;  1KHW A;  4LUB A;  2YTC A;  2IRU A;  5AE3 A;  3MHY A;  3GIJ A;  1J5E J;  4O3S A;  1NUE A;  3DXS X;  4UZC A;  2HNZ A;  1U0H A;  4KYZ A;  3W9I A;  4ID5 B;  4DUZ J;  3CB4 A;  5BYS A;  5EGY A;  1M5O C;  3DRR A;  4QW8 A;  1NHK L;  4L75 A;  5CHC B;  1UVN A;  3RW7 A;  2K7K A;  4DPY A;  5A8R A;  5T41 A;  4C0O C;  1RTJ A;  3IGN A;  5CQG A;  3RAX A;  1IBK J;  2OIH A;  4BS2 A;  5ETR A;  5EUH A;  3DLL Q;  1RT3 B;  4ZKA A;  1T9W A;  2G0J A;  3HHN B;  5L9X A;  2R8K A;  3T1H F;  2DH7 A;  1X4G A;  2DYA A;  3IG1 A;  4LVO P;  2VBY A;  3D0I E;  3BDE A;  5IT9 Y;  1Z2Z A;  2XC9 A;  4JI5 J;  2J0S D;  1RP5 A;  1RQ0 A;  1VFJ A;  1J2V A;  1HI1 A;  4FP9 A;  4ANE A;  2OUG A;  3Q8Y A;  1RHR B;  4K5R A;  2A18 A;  3VZI A;  2ZOM A;  4WFZ A;  3UDV A;  1WOP A;  1F2H A;  3GE9 A;  3ZZR A;  4RW6 B;  4TU8 A;  3PW5 A;  1FD2 A;  1QM9 A;  2M0G B;  5KT7 A;  4UZB A;  1U6B A;  4B9T A;  3BB5 A;  4M1K A;  1YG0 A;  1RA6 A;  5KG7 A;  1H7X A;  5KFL A;  3LWL A;  1O0P A;  2OTL S;  4H4O A;  3J7Z T;  3VAH A;  4AL7 A;  1YBA A;  2O01 C;  4EU0 A;  3M9M B;  1RAA B;  3PX6 A;  5KG3 A;  3E3X A;  5KFO A;  4Y00 A;  2ZH8 A;  4ED1 A;  3UD5 A;  1U1O A;  4QPX A;  3S8S A;  2HWH A;  4P7T A;  2HWI A;  2QE5 A;  3W62 A;  1YLX A;  1Q78 A;  5K8M A;  4K59 A;  2HHU A;  4DU8 A;  3TQE A;  1EET A;  4B3M J;  1IKX B;  5KG2 A;  1RAD B;  5L9N A;  4ZVF A;  1MSW D;  3B4D A;  2KO1 A;  3H5U A;  4JUZ A;  1LWE B;  3C6T B;  3ILL A;  5I42 A;  2Y9H A;  3PO5 A;  4X2B A;  4U67 Q;  3CED A;  2V67 A;  3NCP A;  2LCW A;  4WFY A;  3JAM U;  5FII A;  5KFY A;  1N5V A;  2H54 B;  2NXJ A;  2UUW A;  3TJ8 A;  1R8B A;  1PJ7 A;  2ILY A;  4FPI A;  4YN3 B;  3DFE A;  3HSD A;  4WU3 A;  2V50 A;  4USI A;  4WFA Q;  5HVH A;  4HYK A;  2H3E B;  4OZN A;  1CUL B;  1WHX A;  3OTE A;  2JX2 A;  4DV7 J;  2QEX S;  2OPQ B;  2XZT B;  4IG3 B;  1UVI A;  2HSE B;  4K0K J;  4G1I A;  2XZW A;  1IJF B;  1HQE A;  2M52 A;  4MH8 A;  1FDB A;  1NXI A;  3DOK B;  2DIV A;  3J7A N;  4PR6 A;  1JLB B;  4K4V A;  1N32 F;  5MAO A;  1JWW A;  5IT9 U;  1WC4 A;  1PC4 A;  3FNN A;  4A4J A;  5G4D A;  2CPJ A;  2IRY A;  4O3O A;  2DGX A;  2HQI A;  1C0T A;  2YNG B;  1M5H A;  1XWL A;  3CJQ A;  5H9F J;  5KFM A;  4IFY B;  3OSN A;  3EGV A;  2RAQ A;  1F3V A;  1NJW A;  3UNY A;  3QSY B;  5KFK A;  3S01 A;  3D67 A;  1R6V A;  1C4A A;  2W01 A;  2ZDO A;  4LF6 J;  3THV A;  4UUX A;  1DAX A;  5GAE I;  1F5C A;  3M6W A;  3MEE A;  1T9X A;  3FEZ A;  4RZR A;  2HQG A;  2VZ9 A;  4ZVE A;  1RTH A;  4ZCK A;  5K14 B;  3HHL D;  1B64 A;  3RBD A;  1ZBT A;  4M5G A;  8AT1 B;  1BE4 A;  2RF2 A;  1BC6 A;  2DGW A;  1RAH B;  3UCZ P;  3V81 B;  4JV5 J;  2KYX A;  3TZX A;  4UW2 A;  4PZV A;  2E66 A;  3NGD A;  3BEG B;  3OUY B;  1B3T A;  5LOQ A;  2IBO A;  2MKI A;  4M5D A;  5L1L A;  5HBM A;  3WX8 A;  2QLB B;  1WG5 A;  1WC1 A;  2G2Z A;  1ZPW X;  2VBZ A;  3NAI A;  3HKW A;  4NWB A;  3WC0 A;  4C8M A;  2JLG A;  4FS1 A;  2FLP A;  4JI4 F;  4FPR A;  4XK8 C;  1C1C A;  2ROP A;  2HVE A;  3D2W A;  4WFX A;  4HT7 A;  2ZBC A;  4LFA J;  4LSN A;  1OY9 A;  2GNK A;  5L1J A;  3FBC A;  5C42 A;  4TLR A;  1OQ3 A;  5F8J A;  2VUG A;  4ILL A;  4WP9 A;  4AL5 A;  1N34 F;  2M5Y A;  3AA8 A;  1S0O A;  1UFL A;  1IWA A;  5HRO A;  2FLL A;  1NU4 A;  1H2V Z;  2V63 A;  2L9N A;  4EBE A;  3CC2 S;  2ALY B;  2CZ9 A;  2DXE A;  3N9U C;  2Y1I A;  3KLI A;  1J5O A;  1UMJ A;  1URN A;  2G13 A;  2EFP A;  4ID8 A;  5EDW A;  3N6M A;  1T94 A;  1Z1Z A;  5DM6 Q;  1S9E B;  2IM1 A;  4MT1 A;  4DL5 A;  3H8Y A;  1X60 A;  2FPH X;  2MKY A;  1GXU A;  1EJ7 L;  2FHJ A;  3AAW B;  3GFH A;  1N36 F;  3NBP A;  1B7F A;  1JLF A;  3UE2 A;  2QSF A;  5KFH A;  3FSY A;  1NB7 A;  4LFA F;  1X4C A;  3NOC A;  2Y1J A;  1OMS A;  3BN7 A;  1VGY A;  4H54 A;  4J9O A;  2IY5 B;  4KV8 A;  2BJ1 A;  5HAN A;  2HQF A;  1FWK A;  1RTI A;  1VHI A;  2FTR A;  4JI4 J;  4IOB A;  1CBK A;  1MWY A;  1U8W A;  4X65 F;  2ZD1 A;  5J2N A;  1SUQ B;  2CKW A;  1FD8 A;  2QL5 B;  2MST A;  3OFE A;  1D8Z A;  1G2E A;  1EB0 A;  1WC5 A;  1JMT A;  3QLH B;  3HP6 A;  1WEY A;  2CA9 A;  1KFS A;  4DMZ A;  5GAE U;  4DR3 J;  3IBF B;  2C3Y A;  2GQQ A;  1H0H B;  1WI6 A;  3MED B;  3PG9 A;  3CT9 A;  1IN0 A;  1ZA2 B;  2X3G A;  3ZFV A;  4X62 F;  1QSL A;  1HHT P;  4Y2C A;  2IYG A;  3ICL A;  3MEG B;  4ECQ A;  4LF6 F;  4CLT A;  1REV A;  1PGZ A;  1C1B B;  2BJ3 A;  4NLU A;  2ASD A;  2OEM A;  2UUT A;  2W2O P;  5HP1 B;  4A8W A;  1FX2 A;  3E8O A;  4M8L A;  1VK3 A;  2P6S A;  3MGJ A;  4B3R J;  2VBW A;  5L46 A;  5FJ4 A;  2XWY A;  4FYD A;  4RW7 A;  2Y1L B;  3TVZ A;  5HQM A;  5J2M B;  2VKZ G;  4ERD A;  3F44 A;  1N32 J;  3RYL A;  3EGZ A;  2IMO A;  2XO6 A;  2LP4 A;  2L9W A;  4CLZ A;  3EDR B;  4K0K F;  1RT6 B;  2R8J A;  1S9G B;  2VOP A;  2Z2L A;  3ILJ A;  4GMK A;  5AXK A;  4TYA A;  1SKU B;  1W2I A;  4EMD A;  1DTQ A;  2BE2 B;  2MKK A;  3EUN A;  2V9K A;  4TY9 A;  3HT0 A;  4KO0 B;  2RIL A;  4OJ1 A;  5EWF A;  3BO4 A;  1NK9 A;  2ASY A;  2YY3 A;  4DR5 J;  1LFP A;  1XQI A;  2MLX A;  4OZ5 A;  4RBT A;  1VQK S;  1OJ4 A;  2V8D A;  1IBL F;  4YHH J;  2NSC A;  3AQO A;  2CIM A;  4BC7 A;  3HJF A;  4B3M F;  3X1L B;  4RW8 A;  5A0Y A;  2H51 B;  5T7L B;  2KXF A;  3TZY A;  3AHP A;  4TN2 A;  1SC6 A;  1UL3 A;  2HZA A;  1TKX A;  1APS A;  4YY3 F;  3MFH A;  4Y3C A;  2XSF A;  4PQA A;  3KUE A;  3DKD A;  5F0U A;  3X3U A;  3QID A;  1YDL A;  3M8P A;  2DNY A;  2HFV A;  4NX9 A;  5CYQ B;  1KDN A;  1UJ6 A;  3I5C A;  2RU9 A;  3GP9 A;  5D77 A;  3RB3 A;  4YB5 A;  2AV5 A;  5IOL A;  4P52 A;  3GR1 A;  1BQN A;  1S6P B;  1UEV A;  2DGO A;  2BYC A;  4ZVO B;  4IDK B;  5L38 A;  1C0U B;  2WTF A;  1KTQ A;  5ETS A;  2CNN B;  4J9M A;  3PX0 A;  2UUB J;  3KLE B;  4E2F B;  1RWM B;  1OQ6 A;  1Q79 A;  1MWZ A;  1XIQ A;  2X1F A;  1X8D A;  4M5J A;  3JTO A;  3IM9 A;  5ETK A;  2CPI A;  2F65 A;  2Q3P A;  3OTD A;  5JMN A;  4TY8 A;  4X4R A;  3UCU P;  2F4F A;  4WK1 A;  3W2V B;  2EEY A;  1IM6 A;  1FNO A;  5K8O A;  4LF2 A;  4Z37 A;  1FRL A;  2HIQ A;  3MEK A;  3R9L A;  3VGV A;  5F9N A;  1FT8 A;  2V6A A;  4ED2 A;  2HQ3 A;  4PEO A;  5DG7 A;  4OI6 A;  5SZT A;  1ZET A;  2HVI A;  2OJ3 A;  1FF2 A;  2EFQ A;  2O1P A;  3MAH A;  3MI7 X;  4URQ U;  4FBT A;  4LF9 J;  3Q89 A;  4OX6 A;  3QFH A;  4B08 A;  4ETX A;  4DHV A;  3T1H J;  4KH0 B;  2OPS B;  4NLR A;  3MM6 A;  1YHQ S;  1WUU A;  2CAJ A;  2OEJ A;  3A3O B;  4RU9 A;  2GV1 A;  2PMZ D;  2XI3 A;  5ETO A;  4DPW A;  3PW0 A;  4WFN Q;  3ZTP A;  4PWU A;  3RRG A;  2UUC J;  5F8H A;  5KG5 A;  2LXU A;  2CWX A;  2KI2 A;  2LVW A;  3D1O A;  1SJQ A;  4NLQ A;  4M94 A;  1VRU A;  1HW8 A;  1YJT A;  3KJN B;  2DGV A;  1FER A;  1TR0 A;  3ISN C;  3GR0 A;  3M9N B;  4DUZ F;  3BBC A;  2HK3 A;  2KFZ A;  3DDI A;  3UDL A;  3QRQ A;  2ZHB A;  1XTZ A;  2MHN A;  4ELV A;  4Y2K A;  4DR7 F;  4PPZ A;  4JI0 J;  2MLY A;  1RA7 A;  4DR6 F;  4ELU A;  1RZM A;  3V6D A;  1FJG J;  4NEY A;  4R0E A;  1R6Y A;  1FRX A;  2D74 B;  2NYH A;  1ZM2 A;  2V4J A;  1VLY A;  3A12 A;  3W8P A;  4F4Z A;  3AA9 A;  1FVQ A;  3LAK A;  2CJQ A;  2LEC A;  3PNI A;  2GJ2 A;  2QO3 A;  3ZTQ A;  1Q8L A;  1S97 A;  1DLO A;  2EPI A;  4OJH A;  1L3K A;  3QGP A;  2BZ2 A;  1IKW A;  1OWX A;  2NUU G;  2IM2 A;  2MJN A;  4LRA A;  3QGI A;  1VQP S;  1B7Y B;  3KLH A;  5B0G A;  1U7L A;  5DZ6 A;  3CJK B;  4UOG A;  1KOO A;  1U8S A;  2XMT A;  1YJN S;  1GMW D;  2Q79 A;  3CSK A;  5B0C A;  3SI8 A;  1ITP A;  1R8P A;  4RL1 A;  3NEK A;  2GGP B;  5ETQ A;  2R2S A;  4NXN F;  3R3T A;  1L3U A;  1AZS B;  2WHO A;  5L8R C;  4EBD A;  1FES A;  2IA0 A;  3P96 A;  2QLJ B;  3C6U B;  5KFN A;  2D3O 1;  3D3B J;  3J7Z 5;  2DR9 A;  2CNL B;  1TUW A;  3R6L B;  4H4K C;  5A8W B;  1FVS A;  3EGN A;  4YME A;  1NRK A;  4YB1 P;  3HVA A;  1IJE B;  2G9O A;  2V2V A;  1SKW A;  1U0S A;  2UVU A;  1FWL A;  4ED4 A;  5LMN F;  1AFJ A;  3Q2S C;  4OZ3 A;  3CJK A;  3PW7 A;  2FVS A;  3OTB A;  3TUZ C;  1VLO A;  3KLH B;  1N33 F;  1HBM B;  2DD8 S;  2CVI A;  2WB1 D;  2AJF E;  2P5V A;  3R27 A;  4ZJO A;  1NSK L;  1WF0 A;  3P6Y C;  5F0W A;  1RCX B;  2QMW A;  3R5D A;  1YX2 A;  1PJ5 A;  2PN6 A;  2B4V A;  3FCV A;  4J37 A;  1VS3 A;  2MQO A;  2B6A B;  2PT0 A;  5DDO C;  4OYX A;  4O4R A;  3BGF A;  2ROE A;  1VJW A;  4PG8 A;  3OTO J;  3Q8Q B;  4JI1 F;  1SBR A;  4NE9 C;  2CQ3 A;  4RNF A;  4U6P A;  4B3T J;  3GJQ B;  3V6D B;  2KHD A;  2KHC A;  1JLA A;  2R7U A;  1FJC A;  2OH2 A;  2XLK A;  3FUY A;  2YKO A;  1R43 A;  2A1B A;  2E44 A;  1B70 B;  3R5G A;  3QAU A;  4USJ C;  4U96 A;  3TVK A;  2L3M A;  4OV1 A;  2VQE J;  4J9K A;  2F4V F;  2FIU A;  2Q66 A;  3CCL S;  3J7Y U;  2AGO A;  2VV5 A;  2XUL A;  1X4H A;  1AT1 B;  3A4T A;  2C1E B;  1VRU B;  2X7I A;  3I31 A;  1F5B A;  4G3I A;  3MUR P;  1RHJ B;  2HHH F;  4PXD A;  1XNQ J;  2IFX A;  2UV8 G;  2XY5 A;  1UW4 A;  2CQ1 A;  1X0F A;  2PSZ A;  1LWX A;  1XR7 A;  1I1G A;  4YP3 A;  4DCO B;  1I6J A;  1R8H A;  4DL6 A;  3MPD A;  1CQN A;  2DGS A;  5IS2 A;  3KKF A;  5CZX A;  3CDW A;  3A8I A;  4ZIT A;  1TL4 A;  2B43 A;  3CJT A;  1VRT B;  4XIU A;  2MB0 B;  3TVY A;  4X84 A;  1UFK A;  1F1B B;  2BAC A;  2O3D A;  4C0H A;  1N8R T;  2MQP A;  2J6T A;  4UQT A;  4LIW A;  1T03 A;  2ZC3 A;  2E29 A;  2N4D A;  4RUC A;  2YQ1 A;  3I4H X;  3SEO A;  3PV8 A;  1GEH A;  3BH7 B;  4GO7 X;  3W2V A;  4ZCI A;  5KFB A;  5D0G A;  3N5F A;  3J80 U;  4F4X A;  2PA8 D;  3ET6 A;  4FXV A;  2DVI A;  1E6Y B;  1NBE B;  4FXD A;  3L7U A;  1NK7 A;  2E5I A;  1Y00 A;  5GAH U;  1SKR A;  3ENQ A;  3M6U A;  1D9D A;  4IDK A;  1OY8 A;  1DRZ A;  2KN4 A;  4DZ6 A;  2WSE C;  4G1Q A;  1NH8 A;  3ZTS A;  3TEH B;  1CJV A;  3CDB A;  4HEA 9;  3DLE A;  1XMB A;  1VQS A;  1Q8K A;  2BQ3 A;  3CCW A;  1K1Q A;  4X66 J;  4ZP6 A;  4ZVT B;  4DWI A;  3OFF A;  1YIT S;  4MKV A;  5HVG A;  1BLU A;  3KJF B;  3M2U B;  4RW8 B;  5A0Y B;  1S7H A;  7FD1 A;  3J7A 1;  2YBV A;  1FKO B;  2J9E A;  2WOM A;  3C15 A;  4I6A A;  5EWE A;  3CCV S;  4LVN P;  3EMT A;  5MLC V;  4K4U A;  2ZEJ A;  3ULH A;  3IAM 9;  2Q6C A;  1VQ4 S;  4LRB A;  3EWG A;  1PBA A;  4ATN A;  1RLD A;  4RNN A;  2EW9 A;  2O66 A;  2FZG B;  3U7J A;  2O67 A;  2ZH7 A;  5LJ5 Y;  3MEC A;  5L39 A;  1TL1 A;  4ES1 A;  3Q24 A;  5HLF A;  2VOD A;  4CYU B;  4FVM A;  1N52 B;  1XN9 A;  1RIS A;  2RML A;  2WVF A;  4RR5 A;  3TW0 A;  4WZM A;  1NKB A;  1LWF B;  1IR2 A;  2EFN A;  3CDA A;  1SC3 B;  3PXG a;  3S1T A;  3VAG A;  3DOL A;  8ATC B;  4Q44 A;  2Y0S D;  1Q4R A;  2NPF A;  3AJD A;  4RW7 B;  3H90 A;  1QDU B;  2B8P A;  3FK4 A;  4M5I A;  1UP1 A;  2QGF B;  2YWF A;  2YWH A;  4DQQ A;  2Z58 B;  2OP5 A;  4B02 A;  4DF8 A;  3SQO P;  3D0H E;  3C66 A;  5RUB A;  4ECZ A;  2KJW A;  4DU7 A;  3O3L A;  3S7R A;  4Q8E A;  1KN6 A;  3IMQ J;  4QIW D;  5T14 A;  1ZTW A;  4B3O B;  1RTD B;  3BBF A;  1YKW A;  2A2C A;  1VJQ A;  4C8K A;  4HI1 A;  3DMJ A;  3HM9 A;  1U48 A;  5KFG A;  5IV4 A;  5F9L A;  2WON A;  3TNV A;  3PTW A;  4ZN3 A;  1TV6 A;  2W2P P;  4FXW A;  4M5L A;  2FC9 A;  3N0V A;  1LOU A;  4QPT A;  2RT3 A;  2WSF C;  5E41 A;  1QVF R;  1FDN A;  4X4P A;  4NRU A;  1T95 A;  2LKZ A;  3IAS 9;  2RS8 A;  3DLG A;  3MF5 A;  5C2C A;  3V6J A;  4S0M A;  4CLS A;  3R2C J;  1VMB A;  1WOS A;  5M2P A;  1S0N A;  3GLJ A;  4ZVR B;  4KPC A;  2GMJ A;  5C5J A;  1N48 A;  3FSX A;  2GIR A;  3BO2 A;  2WZ1 A;  3WQP A;  3ILO A;  1KRP A;  3M2V A;  5CH7 B;  2E5G A;  2CG8 A;  3G6V A;  3FQK A;  4A48 A;  2UZA A;  4LRF A;  1M1K T;  1H3D A;  1RHM B;  4Q2L A;  2AJQ A;  5CYM B;  3K0J A;  4YUD A;  4ED8 A;  3R5B A;  3CDU A;  4ECX A;  3DLB A;  3M2V B;  1WTF A;  2FJA B;  3AB4 B;  3BR8 A;  2F9J A;  3G82 A;  3MDF A;  3PJ9 A;  3UN3 A;  4GKK J;  5J2Q B;  1QTN B;  3R97 A;  2Q6B A;  3K89 A;  5DDR C;  1LKZ A;  1JX4 A;  1ZM3 A;  2ZWO A;  2HW3 A;  1J5O B;  3QZ8 A;  5GVQ A;  3C3L A;  2WVB A;  3THT A;  5H9F K;  2MPU A;  1YJR A;  2E5J A;  4Q43 A;  3F73 A;  4X64 J;  1X31 C;  3QRP A;  1WD6 A;  2K3I A;  2PGC A;  2OO4 A;  2ZBQ A;  3GJT B;  2W1B A;  3QT8 A;  3TO8 A;  4HHJ A;  3VTI A;  1V5I B;  4EUV A;  3PRV A;  1NCL A;  2XNR A;  5A6P A;  3OR2 A;  2JDJ A;  3HD2 A;  4OZ2 A;  4WTY A;  4CLP A;  4CO2 A;  2MXY A;  4YHH F;  2V34 A;  3OVS A;  4MKA A;  1UAW A;  2NSB A;  2I0X A;  4F0H A;  2RQC A;  3M2R A;  5DRK A;  4DR1 F;  4A8Y A;  1M5V C;  2VPW B;  3AXK A;  5GAG U;  4M5M A;  4NCG B;  5CAA A;  3DMJ B;  1VQ8 S;  1B0P A;  1MN9 A;  3BM7 A;  2CQ2 A;  4LR7 A;  4UF4 A;  3BPD A;  3KTQ A;  4RUA A;  3OL8 A;  1KHV A;  1RTZ A;  2ZVS A;  4FKX A;  2EXU A;  3KG0 A;  4UY8 5;  1HL6 A;  2MQM A;  1D3W A;  1JXV A;  5HBM B;  1CJT A;  3IS9 B;  4KHP J;  1QY7 A;  3UN2 A;  3DXB A;  2OAU A;  1OYE A;  2KDO A;  1YRU A;  4ICL B;  3GTY X;  1HBO B;  2APO A;  4OYO A;  1K8A T;  2KM8 B;  4ZVS B;  4QWA A;  2QA2 A;  3BF4 A;  4I56 A;  4I69 A;  1K0T A;  1G7C B;  3QMQ A;  3OQ2 A;  1RTH B;  2FGO A;  5K14 A;  3NOG A;  5LXY A;  2XMV A;  5HL7 Q;  4NLG A;  3K5L A;  1T9T A;  2PII A;  3MEE B;  1SL2 A;  5AE2 A;  4WP8 A;  1LWF A;  4Z7C A;  1UKU A;  2OKQ A;  1WTB A;  2E9T A;  4JV2 A;  3IN5 A;  4RUB A;  4CYU A;  4WIQ A;  3FVY A;  2CPY A;  2FHK A;  3T5K A;  1FE4 A;  2DNO A;  2J5A A;  1VI7 A;  2XMW A;  3D6H B;  3F41 A;  3MM8 B;  2VG5 A;  5KFZ A;  3MAA A;  5IXU A;  1FRM A;  3RRK A;  4A8Q A;  1ZH5 A;  2BMB A;  5BXI A;  4AE5 A;  4DR3 F;  3GZ7 A;  1WWH A;  1EQM A;  2XWX A;  1OSD A;  2PI4 A;  3HVW A;  1D1U A;  5CXT A;  3C46 A;  3HPO A;  5IQQ A;  1HQE B;  1NHU A;  3PIO Q;  3OJU A;  5LMN J;  4IG3 A;  2DTJ A;  1CUL A;  2HAI A;  4K2X A;  2D7S A;  4X65 J;  2VPX B;  2VL1 A;  1CJK A;  5EHH A;  2VIC A;  1SL0 A;  3U1M A;  1KEK A;  2NR0 A;  3PFO A;  3SDE B;  1IQZ A;  4KFB A;  2AX0 A;  4UT4 A;  4QWE A;  3IRX A;  4JOU A;  2N7C A;  3LPE A;  3DLE B;  1REG X;  2JRS A;  1UWA A;  3CVK A;  1CJV B;  3I55 S;  3GQC A;  4DUY J;  2XY6 A;  4I0W A;  2Y8Y A;  3C6T A;  4G1Q B;  4QCL A;  3MOZ A;  1KFD A;  4NXN J;  2C2D A;  2JSX A;  3UFC X;  1LW2 B;  2CPH A;  3NMA A;  1UW9 A;  2GJI A;  4MTP A;  4HLB A;  3JSM B;  1N36 J;  1JJC B;  1H98 A;  3ZZO A;  3NRB A;  5KFF A;  3CPW R;  1EP4 A;  1HNV B;  3A8K A;  1D9F A;  1UEK A;  3C16 A;  2CNK B;  3KJV B;  3Q0A A;  2R8H A;  1SQE A;  3RGI A;  3CME S;  3QT5 A;  1S1T B;  2DNZ A;  2J7W A;  3JYT A;  2ZH5 A;  1T03 B;  3PX4 A;  3J81 U;  2DT9 A;  3CD0 A;  1NJI T;  1BUX A;  2DH8 A;  1ZZN A;  3EXY A;  4R8U B;  2CJX B;  4PG6 A;  2LLZ A;  4DR6 J;  3NNC A;  1VC0 A;  1KVJ A;  4PYD A;  2HVH A;  1P27 B;  2NPI A;  3HHK A;  4FNI A;  2YWG A;  4ZOS A;  4QWD A;  1VYA A;  4L74 A;  3M7V A;  4I7F B;  4IR9 A;  4RNH A;  2R7Q A;  4OYW A;  1ZTT A;  3BH6 B;  1RYS A;  2DNM A;  2HBZ B;  2EWH A;  4DG1 A;  3QZ7 A;  1WKK A;  3TA2 A;  3UI3 A;  2UVW A;  2QX0 A;  1WC3 A;  1OYD A;  2DGT A;  2DNN A;  2RQM A;  3VGT A;  1JJ4 A;  1ACM B;  2BOP A;  2UXD J;  2M4M A;  2ZH4 A;  2QMX A;  1AUD A;  3VAL A;  1WSV A;  3H42 A;  1UA0 A;  2IIH A;  3HUL A;  4R0J A;  2R7V A;  4FYV B;  3K7R A;  4NLY A;  1Z4U A;  3IG1 B;  2Z2Y B;  3PEH A;  5HAO A;  2W9C B;  3OSP A;  2C2R A;  1EZZ B;  3MXH P;  3WIV A;  4IOA Q;  3GV8 B;  3KK2 A;  2DXD A;  1P9Q C;  2FDN A;  3ENA A;  4KIA A;  3CCM S;  1S10 A;  1N4L A;  4L73 A;  1PC5 A;  3WC2 A;  1T9Y A;  1WEX A;  2J9D E;  1HBU A;  4CH1 A;  1JJH A;  4WZQ A;  4XAK A;  5A8R B;  2R42 A;  4URS A;  2Z57 B;  3OW2 R;  3SSQ A;  3TEG A;  1WF2 A;  2BJ8 A;  3QJJ A;  1MRO B;  3VVU A;  2JJ4 D;  3MMA A;  2AP6 A;  3CD7 A;  2HNZ B;  2H4W B;  3CCZ A;  3HKZ D;  3T5L A;  2Q1L A;  4K4Z A;  2GVD B;  3PZP A;  3I5B A;  1N56 A;  2OPP B;  4FF1 A;  4QU6 A;  1CJU B;  1JKH B;  2MZT A;  3L09 A;  4JB8 B;  4F50 A;  3BSA A;  4EYH B;  1PBU A;  3FGV A;  4DXL A;  2YNI A;  3MM5 A;  2KXH A;  5K9F A;  1S1X A;  3R7S B;  5DG8 A;  2GS8 A;  3OLA A;  1RWX B;  3M8R A;  2HLT A;  4V19 X;  5E3A A;  1TKT A;  2YNH A;  2W25 A;  1UZH A;  4ZIW A;  3OV7 A;  1O6X A;  2ZDP A;  5K20 B;  3QNW B;  3BKU A;  4YY3 J;  5M2U A;  2VQF J;  1UTA A;  2CDR B;  4OLO A;  1DZ5 A;  2FVP A;  5DS7 A;  2QRR A;  1RT4 A;  3CD5 A;  3CO9 A;  1RXO B;  1M1G A;  3CCE S;  2POK A;  2H4Y B;  2GQ2 A;  2PMH A;  2ZH1 A;  1FXR A;  3BGR A;  1KWM A;  4ZP8 A;  1AYE A;  2LU2 A;  4OI3 A;  1ROF A;  3VHQ A;  1NAQ A;  4TU9 A;  1P6T A;  4J9R A;  4EO6 A;  2VQF F;  2V0N A;  1U6Z A;  4RW9 B;  5KT3 A;  1RT5 B;  2IM0 A;  1IKW B;  1JLE B;  1RLC L;  3HSZ A;  1K44 A;  5DGB A;  1A0O B;  2VBX A;  3M8Q A;  5HJY A;  2VFV A;  3OXL A;  2JC1 A;  2KL8 A;  2U2F A;  3R5J B;  4RBV A;  1IXK A;  5J1E A;  2CQG A;  3B8H A;  1D0E A;  3KJQ B;  4MAK A;  2E5H A;  4EBC A;  4E98 A;  1RHK B;  1WEZ A;  3H59 A;  3IBC B;  3N79 A;  1GX6 A;  4NI2 B;  4C11 B;  4QJV A;  1LK7 A;  5FDL A;  4CLF A;  4P2F A;  4O3R A;  1ZAV A;  2BUN A;  3CJS A;  2HBR B;  2YX7 A;  4J9V A;  4AND A;  2HYI B;  2R7R A;  9ATC B;  3VZH A;  2ZVI A;  4FVC A;  3CNQ P;  5SUH A;  2QLW A;  4DSL A;  4KGK A;  2J9D A;  4WF9 Q;  5KT2 A;  2I5J A;  3W63 A;  4ITS A;  4X62 J;  1DQ8 A;  5I3Q A;  5AXM A;  4PG4 A;  2XLI A;  4UOF A;  2QSW A;  3K5O A;  4L6V 3;  2CQ0 A;  2NS1 B;  3VAJ A;  2OPR B;  4E8U A;  2RDI A;  3PCO B;  2LA6 A;  4KQZ A;  3ZTO A;  3ONQ A;  1YRX A;  2GAH C;  3F0N A;  3M1V B;  3QO9 A;  1SV5 A;  2B4P A;  4YR0 A;  2QLF B;  3LGM A;  4HR2 A;  4A8F A;  3W9H A;  2GC8 A;  3D3C J;  1JK9 B;  1HFE L;  3FBE A;  3FRZ A;  2GJF A;  5KFW A;  4W90 B;  2UXD F;  1YRT A;  3EZO A;  4QWB A;  1BQM B;  1RI7 A;  1NPP A;  2RRN A;  2CRL A;  2R7O A;  2JC0 A;  1RDR A;  1A9N B;  1SH0 A;  1RWK B;  4OZ1 A;  4RNM A;  2JEI A;  2V2K A;  3PYG A;  5KOX A;  3BR9 A;  1J5E F;  2NXC A;  5KFU A;  1X4E A;  4OX7 A;  1UVJ A;  1LXN A;  3BGU A;  3AY0 A;  3T9N A;  2I6W A;  1FJ7 A;  4X4S A;  3M4X A;  3BDP A;  1FFW B;  3MPW A;  2M9K A;  2WK4 A;  4HH1 A;  3MFI A;  2JFD A;  3BKF A;  3KG1 A;  1KVK A;  3R5A A;  1Q16 B;  3BGL A;  3RAQ A;  1BQN B;  1S6P A;  4USU A;  2XZD B;  1CLF A;  2IAJ B;  3KNA A;  1PIE A;  4TLQ A;  5CYQ A;  5ITH A;  3M8P B;  3NGK A;  1RU1 A;  2YH0 A;  2DHH A;  2HS3 A;  2ZE2 B;  3N6N A;  4ZLP A;  4QW9 A;  1NJY A;  1XNR F;  5D4N A;  1HI0 P;  2FJE B;  1R89 A;  1Y3J A;  4C8L A;  5U47 A;  3VQT A;  1E6V A;  3EYZ A;  2DIS A;  1Y10 A;  3HK2 A;  2D1C A;  5D78 A;  3RU0 A;  3H4D A;  4B9U A;  4W92 B;  3FBF A;  2W8K A;  2YVS A;  2XGQ A;  2VD3 A;  2WW4 A;  1U1N A;  1R0A A;  2RSQ A;  5J1P A;  4OHW A;  2DJW A;  1NEE A;  3IO1 A;  4A47 A;  4OI1 A;  3H5Y A;  1VQO S;  1NJZ A;  4LQ3 A;  2HHX A;  2HAF A;  2I1R A;  4ZPB A;  4N8N A;  4Y2A A;  3V2U C;  4OZ0 A;  4KO0 A;  3ZZY A;  1X7V A;  4IRK A;  2VKR A;  4DN0 A;  1FHT A;  1RSC A;  2BJE A;  2I9S A;  5CA5 A;  2RQ4 A;  6AT1 B;  3G6Y A;  2ACY A;  2C28 A;  4KSE B;  4FS2 A;  2VDH A;  2WSC C;  4ZLL A;  3BV8 A;  4C48 A;  4ES2 A;  4USV A;  2R8G A;  4C9D A;  4Q0B B;  1U6F A;  4R5P A;  2HFU A;  2E1C A;  3GWC A;  4ZK7 M;  5J2M A;  1QUV A;  4LJM A;  2WCX A;  2RHS B;  2GML A;  1QSS A;  3SBM A;  1SL1 A;  3AOD A;  3H5S A;  1ARO P;  1FO1 A;  2A6M A;  2HFZ A;  3CC7 S;  2WAQ D;  3KHG A;  1LQ9 A;  1TU0 B;  3DDK A;  1NH7 A;  2XGP A;  2ALZ A;  4P9S A;  1H38 A;  2EG1 A;  1WHV A;  2GZO A;  2JEJ A;  1HMV B;  4N76 A;  2B9W A;  1DQA A;  1LW0 A;  3QSI A;  5AXN A;  4USK A;  2HZV A;  3DRS A;  3OL9 A;  2LA4 A;  1MN7 A;  3ZZP A;  3MED A;  4DS5 A;  2B56 A;  2RE1 A;  3RBZ A;  4B9N A;  3GMG A;  1WOR A;  3PKM A;  4Y6I A;  3QLH A;  2BOA A;  3CCQ S;  2EFG A;  3HHD A;  4IO1 A;  2HWT A;  5D4O A;  2HND A;  1WSR A;  4O3N A;  3BO3 A;  2LQJ A;  3VAM A;  1PO6 A;  1Q5V A;  5I3P A;  1WI8 A;  2K8G A;  2V4Q A;  3QGG A;  4DV7 F;  4DSF A;  1GMW A;  1VRQ C;  3HXM A;  4QIG A;  4F4A A;  1U26 A;  1NM2 A;  2LQ8 A;  1SH3 A;  3CUN A;  3PY8 A;  2FJW A;  4U9R A;  1AB8 A;  3GPA A;  2AJ4 A;  2FJB B;  3P3D A;  4OX9 F;  4KV8 B;  3EVO A;  4AFF A;  3PKY A;  1GK8 A;  3FJ2 A;  1IKV A;  4L3K A;  2C3P A;  4DR1 J;  3TI0 A;  2LQB A;  2AMC B;  4RWW A;  3DRP A;  4WWS A;  3A3P B;  4QQB A;  3DM2 B;  3K2Y A;  2CYY A;  3QRR A;  3B78 A;  3PVX A;  2F8H A;  4ZPT R;  3MUV P;  3W1Y C;  3DU5 A;  3HT3 A;  2FB0 A;  2HNY B;  2Y0B B;  3BYR A;  4K2J A;  4UST A;  4TKT A;  4X64 F;  1XMQ J;  1S9E A;  2Z0G A;  3KWM A;  4X4Q A;  5ETT A;  1V3R A;  1IR1 A;  4DL7 A;  5H9E J;  3KLI B;  2AEJ A;  3D9B A;  2BRK A;  3G96 A;  2W9B A;  2GIF A;  5DJB A;  3L9Z A;  1R8C A;  3OHA A;  2BQU A;  1CS4 A;  3MMC B;  2J8S A;  1Q5Y A;  3NS7 B;  3V4M A;  1EKS A;  4XPC A;  4NYO A;  4ZVH A;  3UCG A;  4CLK A;  4O23 A;  4JV1 A;  2W2Q P;  3ENW A;  3ZZ0 A;  3DI6 A;  2DR7 A;  1WF1 A;  4ED0 A;  4MYU A;  5KT6 A;  2KYZ A;  1DJ0 A;  3RRH A;  3M30 B;  5JVH Q;  4NLW A;  4KC5 A;  4GC6 A;  1V3S A;  5DQH A;  5DM7 Q;  3RB6 A;  1WG4 A;  3NGR A;  2V8V A;  4IOC Q;  4A8O A;  4F36 A;  1GX5 A;  1DUR A;  1NND A;  1GNK A;  4PXC A;  2AU0 A;  4ZN1 A;  4FYY B;  1FNM A;  2CJY B;  2KT5 A;  2QL7 B;  3NY0 A;  4XDC A;  3TAM A;  2BA9 A;  1ELO A;  2X1G A;  3MWB A;  3NXZ A;  3FZB A;  1P1T A;  4JP8 A;  1TK0 A;  1RHU B;  3Q86 A;  2XHW A;  4DOZ A;  4YDD B;  1NK5 A;  2QFI A;  4OQJ A;  1H73 A;  2ZH2 A;  2AQ4 A;  4KHM A;  3I0R A;  4FF4 A;  4BWJ A;  1Q8I A;  3PYF A;  2NUH A;  4RLE A;  3RR8 A;  4O0N A;  4JYA F;  1NSA A;  2AIR B;  3H2U B;  3LW5 C;  5ETL A;  3PYD A;  4OJG A;  2HNY A;  1V9O A;  1VR6 A;  4C3L A;  4DV4 F;  4LF4 J;  4P10 A;  4OYP A;  1SJ1 A;  1M0S A;  1CC7 A;  1RWW B;  2B51 A;  4KGV B;  4F8R A;  3KDO A;  5BYQ A;  1VK8 A;  4J5O A;  3IM8 A;  2HHP A;  3GIR A;  3SSS A;  1N6Q A;  4LT6 A;  2OPQ A;  4QBU A;  2AHO B;  1KP6 A;  3RAM A;  1GH8 A;  3PEJ A;  4KRW A;  5KFA A;  2E1M C;  4J9Q A;  4CO1 A;  2ZFH A;  4G1P A;  2F40 A;  4HAC A;  2AF6 A;  3C19 A;  4Q2M A;  1HIY A;  4Z7Y A;  5C24 A;  3TWZ A;  4CO4 A;  1XK8 A;  1I51 B;  1WAC A;  1XBW A;  2XS7 A;  4XO0 A;  2R2R A;  2CQB A;  2DCL A;  1MMN A;  1LWE A;  1SH2 A;  4KAI A;  2M7S A;  5I42 B;  2EK6 A;  4A8M P;  4HT5 A;  4IRC A;  5F8L A;  1KD1 T;  1IKX A;  5CCM A;  1R7I A;  4E0D A;  1RT2 B;  4RWX A;  1FKP B;  2KT3 A;  2AZ3 A;  3CCT A;  4AD6 A;  1F5A A;  2CFX A;  2AWZ A;  4X66 F;  1RCO B;  1HMV A;  1T8E A;  5KFI A;  2M2B A;  1Q53 A;  2FVQ A;  1H7W A;  2VU5 A;  1FA0 A;  6FD1 A;  1C2P A;  4FF2 A;  2J0X A;  2KU7 A;  3DGP A;  2OLW A;  3HHL A;  3K57 A;  2VFU A;  3V5R A;  4H4O B;  1R8A A;  4N47 A;  2IJF A;  1Q82 T;  1GTE A;  4CNY A;  3MR5 A;  4Z2X A;  3HHL B;  1RWP B;  2PC6 A;  4LIR A;  2D3O R;  2MTL A;  1OPI A;  3R6G B;  2VJU A;  3IWL A;  5LSR A;  4DV5 F;  4ZCL A;  1YGY A;  1SQF A;  4ZJL A;  1W7W A;  2W7A A;  3ZTR A;  3LUY A;  5CYJ A;  2B9Y A;  4M63 A;  4UOH A;  4PYA A;  2R8I A;  2L9D A;  2AJ1 A;  3D6M B;  1HPZ B;  4WXW A;  3VR1 A;  3F56 A;  1RT2 A;  5KFD A;  2LQ9 A;  1TAQ A;  1S6Q B;  2C2O B;  2RDD A;  3GYN A;  3OR1 B;  3O2I A;  1R0A B;  2X1A A;  1BWE A;  5J1N A;  4DQI A;  1F0X A;  4F2S A;  4FN5 A;  1SC1 B;  1R31 A;  1Y5N B;  4MKY A;  1KR4 A;  2XM3 A;  3JSB A;  4DV3 J;  1X9S A;  1HD0 A;  1E6V B;  4DPO A;  1IQT A;  3ZZZ A;  2HEK A;  2P2C B;  2LXI A;  1SCJ B;  3BRE A;  2V8G A;  3NKY A;  4KB7 A;  5E0O A;  3H4B A;  5H1S V;  1RTJ B;  2DEJ A;  2PI5 A;  2MQN A;  4HAC B;  1HWK A;  2YKP A;  3CD6 S;  1RWN B;  1FE0 A;  5ETM A;  1QAX A;  3W5X A;  4C6A A;  4A8S A;  3BQ2 A;  3DRR B;  2CJ9 A;  2FQQ B;  2NXE A;  4KE5 A;  4DPX A;  1N5Y A;  2ZZT A;  1KSP A;  1HYS A;  1U0H B;  3M8Y A;  1T9V A;  1UVL A;  2HPU A;  3SFU A;  3TUJ C;  1VQM S;  3PHE A;  3J81 j;  1ULR A;  5AE1 A;  2BX6 A;  4OYA A;  1K73 T;  5KG1 A;  3HFK A;  2W9A A;  2KZZ A;  4ZCM A;  2H48 B;  4TU7 A;  2KG0 A;  5AXL A;  4W98 A;  4X4T A;  2M8H A;  1OS5 A;  3NS6 A;  3DOM A;  4DPT A;  3GSI A;  1T3O A;  3OTO F;  4JI1 J;  3MOJ B;  2OTJ S;  4NCA A;  3KMQ A;  3T5H A;  1WJ9 A;  2C2K B;  1X4D A;  1MLA A;  2HZC A;  4RNO A;  3W2W A;  3OBI A;  2O5D A;  4DI6 A;  3BPS P;  4G65 A;  1JXE A;  2N3O A;  4LF8 F;  1X5T A;  2DR6 A;  1B4S A;  2CZV C;  3NP5 A;  3ZXW A;  4ECY A;  3R2D J;  2UVR A;  2OFG X;  3DLK B;  4O3P A;  3M8W A;  1TEL A;  4B17 A;  3K8V A;  4K50 A;  1SV5 B;  3D6T B;  3M1V A;  3BN4 A;  5C7P A;  5B0A A;  3JQM A;  2XY7 A;  1NK8 A;  1M5S A;  2V94 A;  2LMI A;  3TAM B;  2DXF A;  4F3Q A;  1G3O A;  1U25 A;  1KQG B;  1ZS6 A;  2JVR A;  2YX4 A;  4M5H A;  4WU2 A;  1F6T A;  2BBE A;  5BR8 F;  2HK2 A;  4CZC A;  3EM1 A;  3DDN A;  2COL A;  2DY1 A;  4FF3 A;  1XEZ A;  4X4N A;  1RT7 A;  4Q7A A;  4I2Q A;  4J7C A;  2ZH6 A;  3BQ1 A;  3D54 A;  3ILI A;  4DR2 F;  4ZVQ B;  3L7P A;  4IFV B;  5KFT A;  2BAB A;  1XMO F;  1YZ6 A;  3DI6 B;  5LMU F;  5HMW A;  3FSI A;  2AGQ A;  2UXC J;  2CQI A;  4UUW A;  1MNE A;  1DFD A;  2HLU A;  1EKR A;  2RB7 A;  4F7V A;  2EC2 A;  2ZUA A;  5L1I A;  1CG2 A;  4B3R F;  1PJ6 A;  1RAE B;  1CS4 B;  3MMC A;  3SQG A;  2BV3 A;  1BGX T;  4L3N A;  4MIW A;  4NI2 A;  4C11 A;  2ZM6 F;  2AYB A;  2BJD A;  1S4F A;  1FRI A;  1UWB B;  2HVZ A;  4DJB A;  2W24 A;  1JB0 C;  5K5M A;  3CIM A;  2CQP A;  1U24 A;  4NZ6 A;  5LM7 E;  2XYH B;  2BKP A;  3W61 A;  4WCE Q;  3WDO A;  1NME B;  2VPY B;  2XHC A;  3M8Q B;  4NMX A;  3EPG A;  5GAD U;  2UU9 J;  1JLE A;  1UVM A;  1I3O B;  5JXS A;  2ZZM A;  1NKE A;  1PYT A;  5LJ3 Y;  1FJG F;  2VON A;  1MG7 A;  2B7C B;  3HVT A;  2GA7 A;  3DM2 A;  3L95 X;  1SPB P;  4FKY A;  3U1N A;  2JWN A;  2BW2 A;  4JI0 F;  5B0B A;  7FDR A;  5B0D A;  2K3K A;  4DZD A;  2MZS A;  4KH1 B;  5D6G A;  3PW2 A;  3N6L A;  1IR0 A;  3GFX A;  2UUA J;  2NXU A;  3I0S B;  5GME A;  2MGZ B;  3G6X A;  3K58 A;  2N3L A;  4DL3 A;  5GAG I;  4NLO A;  4BHQ A;  1S72 S;  2FJV A;  2RHQ B;  3I32 A;  5HJX A;  5DDQ C;  4O0I A;  3PW4 A;  2IMW P;  4DR4 J;  2UUC F;  4F02 A;  3KUG A;  2IHR 1;  3FEX B;  5JUM A;  4DV2 J;  1NKC A;  1TKT B;  2YNH B;  3KYL A;  2IVF B;  3E51 A;  3O8W A;  2E1A A;  1ZZF A;  3G86 A;  3K8W A;  4LRC A;  3MUM P;  2KB2 A;  1TQL A;  2H65 B;  2YKN A;  5KOW A;  4P6Q A;  2VG6 A;  2FY1 A;  4LF7 J;  4LR9 A;  1TUG B;  1N5T A;  1HNZ J;  3GYG A;  5D4L A;  4LF9 F;  2W4P A;  1UEU A;  1JKH A;  2EFV A;  3UDE A;  3MM9 A;  4OHV A;  3R7B B;  4MK7 A;  5A2Q Y;  2G0C A;  3DRS B;  4N41 A;  1J27 A;  1LW0 B;  2GW8 A;  4WTO B;  4CTA A;  4EFA C;  5DGA A;  2IRX A;  1XJW B;  4FBU A;  1G6B A;  2M3D A;  3MMA B;  3U27 A;  4DCP B;  1FJE B;  5KFQ A;  1MRO A;  2VFR A;  3WHI A;  2R2U A;  1XR5 A;  2HRU A;  4F26 A;  4DX7 A;  4ILM A;  3OT9 A;  3AOC A;  2QLX A;  2XSJ B;  1PKU A;  1PAU B;  2GO8 A;  1V5V A;  2U1A A;  4CLW A;  3M9O B;  3ELH A;  1CC8 A;  3VAF A;  2XS2 A;  4J9N A;  4DSJ A;  2GHV C;  3PJX A;  4YDX A;  2E5L J;  1VQ6 S;  4ED3 A;  3FZ2 A;  3KHL A;  3T1Y F;  4GKJ J;  4R5P B;  4X4U A;  1U2C A;  4C98 A;  2UUB F;  4IQX A;  1WNE A;  1YZ7 A;  2DY9 A;  2W9C A;  3UNG C;  3HZG A;  4Y34 A;  5FLX U;  1I5O B;  1UZD A;  4O44 B;  2ERR A;  4Q8F A;  2VFS A;  3AJ1 A;  4NCB A;  2QG9 B;  1S1W B;  3MR7 A;  3QWP A;  3C8Y A;  1S48 A;  3T5J A;  1M90 T;  5CD4 H;  1SB6 A;  2JOQ A;  4DG1 B;  1KQS R;  2HGM A;  4C0B A;  3LWM A;  1FKA F;  3SV3 A;  1HA1 A;  1JIH A;  3A3N B;  1GAO A;  3M05 A;  2XMK A;  1IBL J;  3G9C A;  1R0C B;  4IKA A;  4NA3 A;  1FEH A;  2XI2 A;  2W2N P;  4DR5 F;  1DTT B;  1S6U A;  2QTW A;  4R8U A;  4TQR A;  1JLG B;  2FHM A;  1W2B R;  1WKL A;  5I3U A;  1BWV A;  4OL8 A;  4KKO A;  2B5J B;  2DHX A;  2WVC A;  3D66 A;  4HTI A;  2DK2 A;  2LEB A;  3LP1 A;  1NK4 A;  3C2P A;  1DY3 A;  2IAJ A;  2XTJ P;  3NL0 A;  1Y4Z B;  1Q8B A;  1I94 J;  2N4C A;  1KLM B;  2E7X A;  4LFC F;  3C16 B;  2D69 A;  3CJ5 A;  1EP4 B;  4HI2 A;  3BS9 A;  4OI2 A;  2X1B A;  3JSM A;  1N0V C;  1LW2 A;  1N0U A;  1TVR B;  3MTK A;  2BEF A;  4CRJ A;  4C8N A;  2CJB A;  3G8Q A;  5LXR A;  3D5M A;  1S1V B;  2KRR A;  1VOM A;  4ETZ A;  1QUP A;  2GMH A;  1U02 A;  2CVE A;  1A7G E;  3IFE A;  1TTH B;  4DV0 J;  2PEB A;  4F67 A;  4KFB B;  1W25 A;  3SDE A;  1NSP A;  4K5S A;  3GIL A;  1K1S A;  1CJK B;  2P9G A;  4OHX A;  2D9O A;  4JI6 F;  5DET A;  5IT4 A;  2CJA A;  1V6H A;  3QO9 B;  1NZ8 A;  2YNF A;  4KT0 C;  4NZ0 A;  1GTH A;  1BMQ B;  2Z56 B;  3NCR A;  1GFW B;  3MM7 A;  3OXG A;  2MZ1 A;  2FZK B;  3SYZ A;  2DIU A;  2YPZ A;  1T3N A;  2J0Q D;  2OPR A;  2AGP A;  2PMW A;  2VB6 A;  1V3Z A;  3T1Y J;  4GKJ F;  3G87 A;  1O5J A;  3I87 A;  2NYI A;  3ZC4 A;  1NK6 A;  1Y5L B;  3OLB A;  1YJ7 A;  1A6L A;  3Q8U A;  2VF3 A;  4HH0 A;  3MAA B;  2BJ7 A;  2I5J B;  1WC0 A;  2VG5 B;  3MM8 A;  4M5N A;  2W4C A;  2EBE A;  4USM A;  3I82 A;  3GCW P;  1FRJ A;  2M70 A;  1L3S A;  4N8O A;  3R1L A;  1HNI A;  4DL4 A;  4YQW A;  3U02 A;  2A6O A;  5A8K B;  3DLJ A;  3N4W A;  1KTV A;  1VHF A;  3FKB A;  1AFI A;  5J2P A;  3GON A;  2RU3 A;  1RT1 B;  2HKE A;  3CTR A;  1FXL A;  1UJ4 A;  4OV6 A;  1SQG A;  1HNZ F;  4URG A;  1RKJ A;  3A1Y G;  1RUS A;  3VV2 B;  5J1E B;  3LA0 A;  3M8Z A;  2KXN B;  4UY8 T;  3POT B;  1FXD A;  1HBO A;  3S6E A;  4ICL A;  2DHS A;  3MMJ A;  4DV2 F;  2KKH A;  1CJT B;  3IS9 A;  5HSP A;  2DHA A;  3C14 B;  4LRD A;  5F41 A;  1RT5 A;  4RKU C;  4EEY A;  4NLX A;  4WBF A;  3JAM Y;  4OMF G;  3KK1 B;  1U1K A;  1N34 J;  1RAJ A;  2ROG A;  4DBQ A;  2HQC A;  4IYQ A;  4ED7 A;  3GB0 A;  4AXI A;  3M2R B;  3MR2 A;  1NSQ A;  2HIY A;  2H9Z A;  3EGW B;  1AA1 B;  1Q95 G;  3WX4 A;  1RT4 B;  2VA2 A;  1CEZ A;  2ZJR Q;  3O1L A;  1QJH A;  3MMB B;  3TAQ A;  4N5S A;  2MY8 A;  3BSC A;  3MD3 A;  3R8Y A;  2AX1 A;  2FD2 A;  2RNE A;  4H4M B;  1FFG B;  2YXL A;  1S6O A;  3CO0 P;  4FYW B;  6FDR A;  2UU9 F;  2VG7 A;  2NZ4 A;  3QJP A;  2VOO A;  4HDH A;  5DZ7 A;  1SI9 A;  4XTT A;  5KTQ A;  1RBA A;  2EC0 A;  1FX4 A;  4G6V B;  1IKY A;  3UWT A;  5J2Q A;  1EX8 A;  2OD6 A;  3RJM B;  2YNI B;  4U7U D;  4JV5 F;  2MLZ A;  4NLD A;  3V4I B;  1TMJ A;  5CYM A;  4U8V A;  1CJU A;  1RBL A;  2MKS A;  4QYR A;  2ZM6 J;  2OPP A;  3CC4 S;  4MIB A;  3UR0 A;  3BJY A;  3KOA A;  2GVD A;  3G2X A;  4I1T A;  1TKZ B;  3AJ2 A;  1S57 A;  4NYP A;  5M2R A;  5LMU J;  1U1Q A;  2UXC F;  1WKJ A;  3HFV A;  4USW A;  3CCS S;  5K8P A;  2HS0 A;  4TXS A;  3CCU S;  1KLN A;  3W5Z A;  1VBY A;  1VQL S;  3KK3 A;  2HHS A;  1TMM A;  1G1X A;  1DHM A;  1FK9 A;  1HQU A;  2DIT A;  1OPZ A;  1HBU B;  3DLG B;  3QIP B;  2BKN A;  2EKY A;  4GO5 X;  4WXO A;  3TJ9 A;  2HGN A;  5FLX Y;  3MAQ A;  2PDA A;  3KK2 B;  2X3D A;  3T19 A;  4WKY A;  2L41 A;  2AZ1 A;  4HHU A;  3PO4 A;  1TV6 B;  3M32 B;  3VVT A;  4X4O A;  5D3G B;  2L08 A;  5CD4 A;  1JJ2 R;  4PG5 A;  2FHJ D;  3HVR A;  1VBZ A;  1QE1 B;  2UXB J;  2MDA A;  2XMM A;  1R3N A;  3DNC A;  1T05 A;  2NCK L;  1T9U A;  1RTD A;  1QTM A;  1OY6 A;  3CWJ A;  4F25 A;  3QT6 A;  2FLN A;  2HBY B;  4HVZ A;  1QAY A;  5LT5 A;  4ZA1 A;  2OSR A;  4HTJ A;  3EX7 B;  4I7F A;  5BYR A;  4GRS A;  5B0E A;  4ES3 A;  2DNK A;  3T1A A;  2XYG B;  2LU1 A;  3LAN A;  5IV3 A;  4CI0 B;  2QV6 A;  4OFZ A;  3O5T B;  1HBN B;  1F2G A;  2GVZ A;  3LAM A;  5B0F A;  1L3V A;  1HWI A;  5IWA F;  5A2Q U;  4QZV B;  4YS2 A;  5KFV A;  2XLJ A;  1S1T A;  4CT8 A;  3JYT B;  2HMI A;  2ZKU A;  2KJV A;  1GXL A;  3UDC A;  1S76 D;  3AOA A;  4JI7 J;  3KJV A;  1HNV A;  1ZYQ A;  3ISN D;  5L1K A;  3RZA A;  2JHE A;  1EQ0 A;  4NYZ A;  2MSS A;  2Z2M A;  4Q5V A;  4CIO A;  3CMA S;  1TL3 B;  5JVG Q;  1HWJ A;  2C3M A;  1S9F A;  2W7P A;  1X0P A;  2I2Y A;  2F5G A;  4B9M A;  2QL9 B;  2F7V A;  3KLG A;  1FKO A;  1NHV A;  3GV7 B;  2R7W A;  5KFS A;  2BM0 A;  1HR0 J;  2IJR A;  3IRX B;  4DLG A;  3NGT A;  4M95 A;  1MML A;  5F8N A;  1UCN A;  1CQM A;  3DCA A;  3TA1 A;  5FD1 A;  4QYZ J;  4CLY A;  1CPZ A;  1JNZ B;  1MWQ A;  2GCF A;  4JI5 F;  2DPI A;  2RDJ A;  3BYP A;  3AD9 C;  3UVJ A;  1N5Q A;  5K8N A;  3KLG B;  3DYA B;  3HFZ B;  4ZVP B;  4PWD B;  1NPK A;  4EWT A;  2F3J A;  3KHR A;  3TR5 A;  4RW4 A;  4CCH A;  2CQC A;  4RX6 A;  1HWU A;  1X4B A;  1TL7 B;  2FGC A;  1IBK F;  2ZH3 A;  3ET6 B;  3OFG A;  4NL5 A;  2P8I A;  3VAK A;  3NNA A;  2C42 A;  2HMI B;  2DEI A;  4JI3 J;  3AT1 B;  2H5I B;  2YKM A;  2JEF A;  2G1H A;  1HI8 A;  4UTG A;  5KFJ A;  2Z8Q A;  3UR3 C;  3AOB A;  1KVI A;  2AKW B;  1AW0 A;  3NWG A;  1VRT A;  1RGV A;  3BSN A;  5E5N A;  4WP3 A;  4PCQ A;  1P8G A;  2VAS A;  3HHE A;  3L3C A;  2HHW A;  3L7O A;  1DBD A;  4DV1 F;  2DNG A;  2RVJ A;  2H1Y A;  1IUJ A;  1Z2L A;  2CXE A;  2H5E A;  1S77 D;  1D09 B;  4OHZ A;  2CPE A;  5HI7 A;  4C4W A;  3KDN A;  2ZBP A;  3PJW A;  5GMD A;  1T05 B;  4ANC A;  4F3M A;  1QE1 A;  1RAO A;  1AUS L;  2P9C A;  4ZPA A;  2B4U A;  2V5H G;  1YBU A;  4NCG A;  3AFG A;  4DQR A;  2JL9 A;  2DBB A;  4P75 A;  1Q7L B;  5BJR A;  5C2G A;  3WZ0 A;  4EI2 A;  4LFB J;  5HQL A;  3NGS A;  4C8O A;  2QT7 A;  3OHB A;  1U1M A;  1DAR A;  3ADA C;  3OR2 B;  3UQS A;  2B9X A;  4ALZ A;  4J9P A;  1Q0N A;  3SZ2 A;  2E7V A;  4OI4 A;  1VC6 A;  3TUI C;  2V69 A;  1JLA B;  4DV4 J;  4LF4 F;  2LXF A;  3AD7 C;  2J0W A;  4GVB B;  3QIP A;  2OI2 A;  2CDQ A;  2M88 A;  2D3U A;  2BRL A;  2EBG A;  3CMQ A;  3IXQ A;  2VFT A;  4WPA A;  1S59 A;  3GFY A;  5A76 A;  4JI3 F;  1XR6 A;  2JNJ A;  3US5 A;  3HO1 A;  1TKZ A;  3G82 B;  2MMY A;  2BAN B;  4AQY J;  2AT1 B;  1RAF B;  2BM1 A;  5AJ3 J;  4ECU A;  3BKT A;  1GMU A;  3W66 A;  2QJ3 A;  4ECT A;  2A0F B;  2NXN A;  4FNH A;  3I9Z A;  3VF0 B;  5KFX A;  5E3R A;  5DLG A;  4CO0 A;  2MKJ A;  2AD9 A;  2V2Q A;  4CNZ A;  1YBT A;  3GIK A;  1IKY B;  2XCA A;  4ZP7 A;  3ISZ A;  4IH6 A;  3N01 A;  1K9M T;  3QJL A;  2K1R B;  1LV5 A;  5A8W A;  4H4M A;  2QFJ A;  4PAA A;  1IWG A;  1KQF B;  1SKS A;  3C6U A;  1HNX J;  4LBP A;  2YKA A;  3RB0 A;  1AZS A;  1CVJ A;  4Y28 C;  3Q2T C;  1DQ9 A;  4KGZ B;  4ZVG A;  1XC9 A;  1RAB B;  3MPY A;  3QWU A;  3JSR A;  1S12 A;  3O6Q A;  2IJN A;  2CWK A;  2WON B;  2J6U A;  4C97 A;  2KRB A;  2ATC B;  1EAY C;  5G0R A;  5EWG A;  1YWX A;  4MMO A;  2XMA A;  2MYF A;  4NLP A;  4PXE A;  3KXD A;  2RRA A;  4QOT A;  2W7O A;  4B3O A;  4J9U E;  4TYB A;  2J6S A;  2EKN A;  2CQD A;  1RBO B;  3C14 A;  2OHD A;  4L76 A;  4PXB A;  1Y3K A;  2AYE A;  2HRY A;  4OLP A;  4F4K A;  2DO4 A;  3Q23 A;  3SV4 A;  2MKH A;  1DLO B;  2KH9 A;  4ECW A;  4WKR A;  4RPF A;  1O8B A;  1Y5I B;  3POT A;  4CLU A;  1XMQ F;  4JI8 J;  2A10 A;  4P2X A;  3GV5 B;  5IWA J;  1TUV A;  3GG0 A;  4DX8 H;  2OGU A;  4JI2 F;  3IRW P;  2CQ4 A;  4CM2 A;  1SVD A;  5AT1 B;  1RT1 A;  3VGS A;  5JJB A;  3GCX P;  1KOH A;  4DX5 A;  4B3S J;  2G2O A;  4B3S F;  2JFK A;  3DOL B;  4C8Z A;  1P1L A;  5A6W A;  1PSD A;  1HQ2 A;  1IVZ A;  2V68 A;  4ZHR B;  5A8K A;  2XO7 A;  4MKB A;  4JI8 F;  4CH0 S;  1TL1 B;  5HLF B;  3MEC B;  1S99 A;  2MZJ A;  4QU7 A;  1TKD A;  5HMZ A;  1O51 A;  1RWO B;  2UXB F;  1HD1 A;  4QYZ K;  1UFW A;  2FUG 9;  3VQS A;  2MQ8 A;  2DKO B;  4FYX B;  5F8I A;  5F8G A;  1KQK A;  4FDF A;  3T9Z A;  3BGO P;  3MM6 B;  2XS5 A;  4IG0 A;  3FFI B;  4LSL A;  4HDG A;  2OPS A;  1LEO A;  3T41 A;  4PQU B;  2WBM A;  2WOM B;  3C15 B;  2QA4 G;  2ZJQ Q;  3TX8 A;  4I67 A;  3M2U A;  2LDI A;  5THW A;  4WJB A;  5IQ6 A;  3V6H A;  1U4B A;  1F9F A;  1HNX F;  4OZJ A;  1RHQ B;  1LWC A;  1TAU A;  2I8E A;  4ZDN A;  5C25 B;  3FCW A;  4I2P A;  5D0H A;  2KFN A;  3CDE A;  2ZNY A;  1S1V A;  3W3S A;  1YTY A;  2HFN A;  2LQ5 A;  4N56 A;  3R5C A;  3CJR A;  4KY3 A;  1NPR A;  2FJX A;  1Y11 A;  1Y9O A;  2PA3 A;  2W2M P;  4TNO A;  5IFM A;  2QIF A;  3QPI A;  1TVR A;  4TY8 B;  5E3C A;  3Q8R B;  2P6T A;  3FQL A;  3MCM A;  4KBI A;  4QIE A;  1QVG R;  1BQX A;  4B9S A;  1E6Y A;  3K17 A;  3MCS A;  2DNP A;  4LSZ B;  3SSR A;  2V8P A;  5AJ3 F;  1C0U A;  1URR A;  1SIZ A;  2MEW A;  2B8Q A;  3H20 A;  4AQY F;  4ECS A;  3RBE A;  4DF4 A;  4MYT A;  2ZZN A;  4K4X A;  1H6K X;  1FFS B;  3LP1 B;  1N88 A;  2B5J A;  4I2P B;  4KKO B;  4PQU A;  5C25 A;  3J7Y I;  1LWC B;  1JLG A;  4KPY A;  1S4E A;  2AJ0 A;  4YB7 A;  5LSL A;  1DTT A;  1FTR A;  1YVF A;  4NAS A;  3P49 B;  5T7L A;  2B3T B;  3HSG A;  1LK5 A;  4ZS6 A;  3FMB A;  4EZ9 A;  3CF5 Q;  4AT1 B;  2R9L A;  2R3V A;  3FFI A;  3LAL A;  4IG0 B;  1RKI A;  2FYX A;  2HFS A;  4LSL B;  4M5K A;  4RO0 A;  2VH7 A;  1HKA A;  3PFE A;  8RUC A;  4C3K A;  3D7S B;  4EGL A;  1G4C A;  1RWV B;  2XMU A;  4PWW A;  4XPE A;  1X9M A;  1XNR J;  1ZOT A;  2DHG A;  4V1A k;  2BE7 D;  4KHR A;  3A8J A;  4YR3 A;  1SIW B;  3PR5 B;  1VIO A;  3GIM A;  1LNQ A;  4LMZ A;  1F9E B;  3LPY A;  1S9G A;  2LEP A;  4P7V A;  1RT6 A;  2GIQ A;  4U8Y A;  3THP A;  2BDP A;  5LL6 d;  2WB4 A;  4ZHR A;  4DSK A;  1JNR B;  1VDH A;  3UD3 P;  4CH7 A;  3QYY A;  2CZ4 A;  3N28 A;  2WVE A;  1FRH A;  2OMO A;  3I5A A;  3W60 A;  4EK2 A;  4ER8 A;  2ZH9 A;  3RW6 A;  3TYT A;  3Q8V A;  3EPI A;  2DRB A;  4YOE A;  4RBU A;  2LYV A;  3OD2 A;  2MZR A;  2JLF A;  4QR1 A;  2GHW A;  1RU2 A;  3D1H A;  5I4M A;  1KNZ A;  4GC7 A;  2B6A A;  2EFO A;  3AH6 A;  3AQP A;  4DFK A;  5HP1 A;  3QFW A;  1REV B;  2EK1 A;  2IDE A;  1D9A A;  3MEG A;  1IBM J;  4NXM F;  5E7O B;  4EO8 A;  1HBM A;  4ZPD A;  5DQG A;  1X5S A;  5LSO A;  1S0V A;  4IH5 A;  4AUK A;  2MQQ A;  5G0R B;  1QD1 A;  2JH3 A;  1T02 A;  3NGU A;  5KFE A;  3K59 A;  4NRT A;  5HAT A;  3A8E A;  3SCJ E;  2YKN B;  5KFR A;  2FZC B;  4DFM A;  2DNL A;  3P4U B;  4JI6 J;  2A2D A;  4U95 A;  3GSD A;  5EN1 A;  1NZA A;  4ECV A;  5DG9 A;  4DV0 F;  3HJV A;  2HRT A;  4ZPV R;  3Q8S B;  2E7W A;  3NS5 A;  4ED6 A;  2BW7 A;  1EIY B;  2K1R A;  1EHW A;  3EZU A;  3VGU A;  2N7Y A;  4WII A;  4Q45 A;  1HR0 F;  5KFC A;  2GGP A;  1FWP A;  3GYX B;  2DNH A;  4GVL A;  5IT0 A;  1RE1 B;  3HHL C;  2ZBR A;  1FCA A;  2XG8 A;  4F0M A;  5H9E K;  4OI0 A;  2VC1 A;  5DO2 A;  2AW0 A;  2HGL A;  2F1F A;  1RJJ A;  2DO0 A;  2V8H A;  1JLF B;  2ACM A;  3HVT B;  3NBP B;  1UVK A;  3AD8 C;  9RUB A;  1L5U A;  1B99 A;  4OYB A;  2ZC4 A;  2I38 A;  3U1L A;  4LFC J;  2IDL A;  1I94 F;  2BAN A;  4PKD B;  2OD4 A;  4JI7 F;  2KG1 A;  1NK0 A;  3GFZ A;  4K8R A;  5HVF A;  3HF5 A;  1HWL A;  3L4B C;  4ZPW R;  2F8M A;  5KFP A;  1VC5 A;  3K5P A;  3TJA A;  2V4J B;  2LFV A;  2ILZ A;  4RU2 A;  4B9L A;  1F3F A;  3M6V A;  3EIC A;  2Y8W A;  4GVB A;  4UQG A;  1UWB A;  3LF0 A;  4AXJ A;  3D68 A;  3Q22 A;  2M8D B;  1TFY A;  3DHX A;  3SQG B;  4P73 A;  2VHG A;  5C42 B;  1WHW A;  4DR7 J;  1XER A;  4C2M A;  2VA3 A;  2DNQ A;  3IR5 B;  3KHH A;  2CJK A;  3PDN A;  4P2M A;  1NDL A;  1B0T A;  2DRD A;  1BHN A;  1X5O A;  4I64 A;  4ZLN A;  4QWC A;  1C1C B;  1S5Z A;  3B82 A;  3ETM A;  4IFV A;  3GJR B;  3G8S A;  4YEA A;  3G71 S;  1TZ0 A;  1U2R A;  2JLE A;  1JQG A;  3I56 S;  4B9V A;  1NB2 A;  3B4M A;  3IR6 B;  3DRX A;  2HG4 A;  2UP1 A;  1SXL A;  2KVQ E;  3OPK A;  2RIJ A;  3VWS A;  1UPM B;  1M1H A;  1ZA1 B;  3G8T A;  2ZHA A;  4DSI A;  4IH7 A;  4WFB Q;  4N77 A;  2B0G A;  3SCI E;  2B9E A;  2R7S A;  2HHT A;  2ASL A;  4K4Y A;  3TA0 A;  3J80 Y;  1T7P A;  3Q8P B;  3PM9 A;  1YK9 A;  4OYZ A;  3WBZ A;  2EI5 A;  2SXL A;  3DGV A;  4OYM A;  4IO9 Q;  4RJV A;  2IBK A;  1NDC A;  4CLL A;  2QN6 B;  2YKM B;  2HHV A;  1X5P A;  2C3O A;  1R27 B;  4DX6 A;  4J9L A;  2GFF A;  2HFO A;  3DOM B;  3MR3 A;  1SJ3 P;  4UOC A;  3MZI A;  4A8X A;  4DSE A;  2IVM A;  2L48 A;  1U1P A;  4V19 J;  4BWM A;  2KT2 A;  3SFG A;  3LTO A;  1TL7 A;  2ASJ A;  2G4B A;  2OSQ A;  3T6B A;  1PIL A;  2FHO B;  4WK3 A;  3KLE A;  1W26 A;  3IBW A;  3OTC A;  4RW4 B;  4YR2 A;  3DOK A;  4LF7 F;  2FVR A;  2R7X A;  4PWD A;  1Y0H A;  1X4F A;  2VPZ B;  3DYA A;  4Y2I A;  4QR2 A;  2NLW A;  2K06 A;  3UVJ B;  1N5Y B;  2C22 A;  5KG6 A;  2D3Z A;  2RUG A;  4DV6 J;  5D8H B;  4MK9 A;  5DDP C;  2VJV A;  4AL6 A;  2PO4 A;  1VQ5 S;  4BDP A;  4N7T A;  4DR4 F;  2XB2 D;  2CPX A;  2XQC A;  1TKX B;  4A46 A;  3HCX A;  2D9P A;  4LF5 F;  5EX3 A;  3H0P A;  5ETV A;  3T6J A;  3TRG A;  4K4S A;  2DR5 A;  3EXC X;  1U2F A;  1QSY A;  1YSJ A;  2MHE A;  4I6Y A;  2F9D A;  2AEM A;  4NLS A;  1LFW A;  3CJ4 A;  5D0R A;  1S6Q A;  3OR1 A;  3W8G A;  1TL3 A;  4D3G A;  3AXM A;  3KMS A;  1FDA A;  4USH A;  3BZQ A;  1HPZ A;  4LF5 J;  5HQ8 A;  1D8Y A;  2C2Z B;  4NLV A;  1YJ9 S;  4KR0 B;  1DTQ B;  2BE2 A;  1NDP A;  3JQK A;  2CQH A;  3W9J A;  3IC1 A;  5E3Q A;  4DV6 F;  1KON A;  2RUS A;  4XDD A;  2PEH A;  3CUL A;  1Q7Y T;  4Y65 A;  2WBR A;  4ZVU B;  4EZ6 A;  1EAR A;  1PYO B;  1RAC B;  2GQC A;  2QA4 S;  2K2P A;  2GVZ B;  3QGH A;  4HL9 A;  1HNW J;  4I4B A;  4P74 A;  1HBN A;  3J81 Y;  2RRB A;  2IA6 A;  3P5B P;  1R0B G;  2ABY A;  4KJI A;  2HQD A;  5DLF A;  3DGP B;  4RW6 A;  4F4Y A;  3QQC D;  4O3Q A;  4DUY F;  1C1B A;  3D6F B;  3LGN A;  3UN5 A;  1YI2 S;  1XMO J;  1VCT A;  2H5J B;  4CO5 A;  2J8A A;  3EE3 A;  2C2M B;  1Q86 T;  4W4M A;  1UET A;  1H2U X;  2GHP A;  5ADZ A;  3OL6 A;  4BCA A;  2QA1 A;  1TP7 A;  1FKP A;  2XMJ A;  2Z30 B;  3JS9 A;  2G2Y A;  2A3J A;  3LGH A;  2CG4 A;  2CUY A;  3CE8 A;  2ZOG A;  5D15 A;  1KKH A;  3NAH A;  2UV8 A;  2NRE A;  3DLH A;  5D3G A;  2UVV A;  3M32 A;  2DCU B;  3PAC A;  3W5Y A;  4P71 A;  4ZLJ A;  4H4K A;  2NZC A;  4KGM A;  4RUH A;  1YQH A;  1SUQ A;  2ZD1 B;  5J2N B;  3QBC A;  2BR0 A;  4CO3 A;  2CAD A;  1N54 B;  2BQR A;  4K7Q A;  4CDI A;  2PFD A;  3PYE A;  4LBH A;  5C24 B;  2KTQ A;  1IM4 A;  1FK9 B;  1HQU B;  4C3M A;  1HNW F;  2ATL A;  2ZNZ A;  1RTI B;  2HS4 A;  3CJ8 A;  3D1Q A;  3KK3 B;  4DL2 A;  3TZZ A;  3RBX A;  4DQP A;  2LDY A;  3RUB L;  1N6Q B;  2DPJ A;  2PD1 A;  3OFH A;  4PPD A;  3RB4 A;  1JXL A;  2XCP A;  2CNO B; 
#chains in the Genus database with same CATH homology
 5ETO A;  1TMJ A;  2QX0 A;  1G4C A;  3MCM A;  3HT0 A;  3MCO A;  5ETN A;  1RTZ A;  4M5J A;  2BMB A;  3ILI A;  1RAO A;  2F65 A;  3IP0 A;  5ETP A;  4M5N A;  5ETK A;  4AD6 A;  1EQM A;  1EQ0 A;  3HSZ A;  3KUH A;  4CRJ A;  3MCN A;  1F9H A;  1IM6 A;  3UDV A;  5ETT A;  3ILL A;  4CYU B;  5ETQ A;  4M5L A;  4F7V A;  4M5M A;  5ETS A;  1RU1 A;  1TMM A;  1Q0N A;  1KBR A;  3QBC A;  1CBK A;  4M5I A;  3HSD A;  5ETR A;  3HCX A;  3KUG A;  4M5G A;  3KUE A;  5ETV A;  5ETM A;  1RB0 A;  3HSJ A;  3HSG A;  1HQ2 A;  3HD2 A;  3UDE A;  2F63 A;  4CWB A;  1RU2 A;  1DY3 A;  3HD1 A;  5ETL A;  4PZV A;  3UD5 A;  1EX8 A;  4CYU A;  4M5K A;  3ILJ A;  3ILO A;  4M5H A;  2CG8 A;  1HKA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...