1HQ3D

Crystal structure of the histone-core-octamer in kcl/phosphate
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
83
structure length
83
Chain Sequence
b'KVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HISTONE H2A-IV
publication title Structure of the histone-core octamer in KCl/phosphate crystals at 2.15 A resolution.
pubmed doi rcsb
molecule tags Dna binding protein
total genus 24
structure length 83
sequence length 83
chains with identical sequence H
ec nomenclature
pdb deposition date 2000-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1hq3D00
3MGQB 4HGAC 3MGSC 3WA9A 3W96A 1ZLAA 3C1CC 3X1TD 3W97C 3B0CW 1HTAA 5B40D 4KUDD 2HUEC 3AV2C 4J8WC 5AY8B 5CPJC 5AV9B 2FJ7B 3MNND 3AZNA 3AZHB 3X1UD 3X1SD 3TU4D 1ID3C 3REKD 2BYKA 5AVBD 5B1MA 4J8XA 3MGPB 4R8PB 3AV1A 4G92B 3KUYA 4QLCD 3A6NA 5BS7A 3AZED 3LZ0D 1P34B 5JA4B 4Z5TB 3R45B 4WU9A 3MNNC 5JRGA 3WAAD 3X1UC 3MGQA 3AZJB 4KHAA 3AFAD 3TU4C 3REKC 1AOID 3UT9B 5E5AB 2F8ND 3V9RA 5AVBC 3A6NC 4WU8D 4NFTA 1P3GC 1U35B 4Z66C 1P3PB 4WNNB 4KGCC 3X1VD 5FUGB 4G91B 3VH6T 3AYWC 4QLCC 1TZYD 5AV6A 4ZUXB 3UTBD 1S32D 1P3KB 1TAFA 4XUJD 3LZ0C 5AV9A 2FJ7A 5AVCD 1KX5D 3REJB 3AZIB 5GSUA 2AROD 3AZGB 4JJNB 5B0ZC 1BFMA 4J8UB 3AZLB 3W99D 3MGPA 4H9OA 1WWIA 4XZQD 4R8PA 3REHB 1AOIC 4WU8C 4J8VB 5F99D 3KWQA 4HGAB 3WKJB 5B2ID 1TZYC 3MGSB 3MGRC 1S32C 3R45A 1P3BD 3LZ1D 4AWLC 4XUJC 5KDMB 3C1CB 5B24D 1KX5C 5B31D 3W97B 1P3LD 3AZJA 3NQUB 4CAYB 3B0DC 3UT9A 2HUEB 3AV2B 3W99C 1P3PA 4WNNA 2YFWA 5B1LD 4XZQC 5AV5D 3KWQC 5GXQA 4CSRB 5B0YD 2YFVB 4ZUXA 4H9SA 1P3KA 1P3MD 5B2JD 3REJA 4E44A 3AZIA 1P3BC 3LZ1C 5B24C 4JJNA 5B31C 3VH5A 4J8UA 1P3LC 3AZFD 3AZKC 3AZLA 5GXQC 1P3OA 3REHA 3B6FA 4J8VA 5BT1D 2BYKB 5B1LC 5B1MB 3MNNB 3X1UB 1KU5A 5BNVA 5B0YC 2CV5C 3TU4B 3MGSA 3REKB 4X23D 5DNNC 5AVBB 3A6NB 3B6GD 3C1CA 1P3GB 4Z66B 1P3OC 3NQUA 4KGCB 4CAYA 3LJAA 1M18D 3AYWB 4WU9B 4J8WA 5CPJA 3LZ0B 5GT0C 4KHAB 4CSRA 2JSSA 1EQZD 2YFVA 1ID3A 5BT1C 3V9RB 5B0ZB 2NZDD 3MVDD 5CPKD 1BH8B 4X23C 3LJAC 3LELD 3REID 2F8NB 4LD9C 5AV6B 4WU8B 1TAFB 1M1AC 5B33C 3WA9D 1M18C 3B0CT 5GSUB 1TZYB 3MGRB 2HIOC 4AWLB 3C1BC 3MNNA 3X1UA 4H9OB 1EQZC 3X1SA 1KX3D 5AV8D 3TU4A 3B0DB 3REKA 1M19D 3RELD 3X1TC 5AVBA 3MVDC 5B40C 1P3GA 4Z66A 5CP6D 3W99B 3LELC 4XZQB 4KGCA 4KUDC 3KWQB 3AYWA 4QLCA 4YS3D 4J8XD 3AZEA 2IO5C 3LZ0A 3AV1D 3X1SC 2NQBD 4DRBA 1P3BB 3LZ1B 5B32D 5B24B 5B31B 1H3OA 5B0ZA 2YFWB 4UUZB 1KX3C 5AV8C 3AFAA 1BH8A 5GXQB 3AZKB 1AOIA 2F8NA 3RELC 3AN2D 4WU8A 3AZEC 1F66D 1P3AD 4H9PB 5B1LB 1P3ID 5B0YB 2CV5B 2F8NG 1TZYA 5CPID 3MGRA 4YS3C 1S32A 5DNNB 4XUJA 3AZMD 3WAAC 5AVCA 1KX5A 3AFAC 2RVQD 5C3IC 1P3OB 2NQBC 2AROA 5B32C 5AY8D 4ZBJC 5AV9D 3B6FB 2FJ7D 3UTAD 3AZHD 3X1VC 3W99A 4XZQA 5GT0B 5BNVB 3AN2C 1B67A 3UTBC 3VH5W 1F66C 1P3AC 5AVCC 3MGPD 1P3IC 5F99A 4WZSB 2AROC 5CPIC 4X23B 3LJAB 3WTPD 1P3BA 3LZ1A 4LD9B 3AZMC 5B24A 1P34D 5B31A 4J8WB 5CPJB 1P3LA 3VH6A 4UUZA 1M1AB 3AZKA 4Z5TD 5B33B 4E45A 1M18B 1ID3B 3UTAC 1A7WA 2HIOB 5B31G 4H9PA 5B1LA 4DRAA 5F99C 3C1BB 3UT9D 5E5AD 5B2IC 1HQ3D 1EQZB 5B0YA 2CV5A 1KX4D 5GT3D 1U35D 4Z2MH 5DNNA 3X1TB 1P3MA 5B40B 3LELB 4EO5C 3WTPC 4KUDB 1P3FD 5AV5C 3REJD 3B0BA 2IO5B 5GT0A 2PYOD 3X1SB 4NE5A 3AZGD 4JJND 4J8UD 1F1EA 1P3MC 3O62D 5B2JC 3KXBD 3W98D 1HQ3C 1KX3B 5AV8B 5GT3C 1KX4C 4X23A 4LD9A 4QLCB 3AZFC 4H9RB 3AZEB 3WKJD 1M1AA 1P3FC 5B33A 1M18A 4YS3B 2HIOA 3W97D 5DNMD 1H3OB 3C1BA 3WAAB 2PYOC 3AFAB 1R4VA 1AOIB 5C3IB 3AV2D 1EQZA 2NQBB 4YM6D 3B6GC 5B32B 4ZBJB 3O62C 3X1TA 3KXBC 3W98C 2NZDA 3MVDA 5B40A 3X1VB 3LELA 1BH9B 4KUDA 3W96D 3AN2B 1ZLAD 1N1JB 3UTBB 1S32B 3NQJB 1F66B 1P3AB 4M6BA 4XUJB 3WKJC 5AVCB 1P3IB 1KX5B 2AROB 5CPIB 4H9QB 1JFIB 5DNMC 3AZMB 3AZND 2NZDC 5CPKC 4YM6C 3REIC 5AV8A 1KX3A 1M19A 4NE6A 3RELA 5B1MD 3UTAB 4H9RA 5CP6A 3WA9C 5F99B 3W96C 3KUYD 5B2IB 1ZLAC 5BNXB 2BYMB 3A6ND 4YS3A 1P3GD 4Z66D 5BO0A 2CWEA 4KGCD 3WAAA 1P3LB 1B6WA 3AYWD 1M19C 2NQBA 4EO5B 3WTPB 4WU9D 3AZNC 5B32A 5JRGD 5CP6C 3MGQD 4H9NB 5AV5B 3X1VA 1BH9A 3AN2A 5B1MC 1N1JA 4J8XC 3UTBA 5B32G 3NQJA 5B0ZD 3VH6W 1P3AA 1F66A 3AV1C 5G49B 3KUYC 1P3IA 4NE3A 1P3MB 5B2JB 1HQ3B 5AV6D 1KX4B 5BS7C 5GT3B 5CPIA 2F8NK 4H9QA 1JFIA 3AZMA 3AZFB 3WTPE 5GSUD 4WU9C 3MGRD 1P3FB 5AY8A 5JRGC 3MGQC 3UTAA 3AZHA 1ULYA 4R8PD 1WWSA 2F8NH 2PYOB 5B2IA 5BNXA 2BYMA 3B6GB 3VH5T 3O62B 2RVQC 3KXBB 3KWQD 3W98B 5AV6C 3WTPA 5AY8C 5AV9C 2FJ7C 3AZHC 1P34A 3AZJD 5JA4A 5GSUC 4H9NA 5AV5A 4Z5TA 4Z2MG 1P3PD 3MGPC 4R8PC 5DNMB 5G49A 3AZKD 4G92C 5GXQD 2NZDB 3MVDB 3KSYA 5CPKB 5E5AA 5B2JA 1HQ3A 4YM6B 1Q9CA 4ZUXD 5GT3A 3REIB 1P3KD 1KX4A 1U35A 1P34C 5FUGA 3AZFA 4Z5TC 3WA9B 3AZID 2CV5D 3W96B 1P3FA 1ZLAB 5DNND 3AZJC 3AZLD 1P3OD 3UT9C 5E5AC 3REHD 2PYOA 1M19B 3AZGA 1U35C 1P3PC 3B6FD 4J8VD 3RELB 3AZNB 4G91C 3B6GA 2LY8A 3O62A 5GT0D 5CP6B 3KXBA 3W98A 3MGSD 4ZUXC 4H9SC 1P3KC 2L5AA 3C1CD 4J8XB 3REJC 5BO0B 3AZIC 3AV1B 3WKJA 3LJAD 3KUYB 3AZGC 4LD9D 4JJNC 5KDMA 4J8UC 3W97A 3AZLC 4J8WD 4WV4B 5CPJD 5DNMA 3REHC 1M1AD 5B33D 5CPKA 5CHLB 3AV2A 3B6FC 4YM6A 4J8VC 3REIA 1ID3D 2HIOD 5JRGB 3C1BD
chains in the Genus database with same CATH superfamily
3MGQB 4HGAC 3MGSC 3WA9A 3W96A 1ZLAA 3C1CC 3X1TD 3W97C 3B0CW 1HTAA 5B40D 4KUDD 2HUEC 3AV2C 4J8WC 5AY8B 5CPJC 5AV9B 2Y2QA 2Y2KA 3MNND 3AZNA 2FJ7B 3AZHB 3X1UD 3X1SD 3TU4D 1ID3C 3REKD 2Y2OA 2BYKA 5AVBD 3EPLA 5B1MA 4J8XA 3MGPB 4R8PB 3AV1A 4G92B 3KUYA 4QLCD 3A6NA 5BS7A 3AZED 3LZ0D 1P34B 5JA4B 4Z5TB 3R45B 4WU9A 3MNNC 5JRGA 3FDDA 3WAAD 3X1UC 3MGQA 3AZJB 4KHAA 3AFAD 3TU4C 3REKC 1AOID 3UT9B 5E5AB 2F8ND 2FFFB 3V9RA 5AVBC 3A6NC 4WU8D 4NFTA 1P3GC 1U35B 4Z66C 1P3PB 4WNNB 4KGCC 3X1VD 5FUGB 4G91B 3VH6T 3AYWC 4QLCC 1TZYD 5AV6A 4ZUXB 3UTBD 1S32D 1P3KB 1TAFA 4XUJD 3LZ0C 5AV9A 2FJ7A 5AVCD 1KX5D 3REJB 3AZIB 5GSUA 2AROD 3AZGB 4JJNB 5B0ZC 1BFMA 4J8UB 3AZLB 3W99D 3H0LC 3MGPA 4H9OA 1WWIA 4XZQD 4R8PA 3REHB 1AOIC 4WU8C 4J8VB 5F99D 3KWQA 4HGAB 3WKJB 5B2ID 1TZYC 3MGSB 3MGRC 1S32C 3R45A 1P3BD 3LZ1D 4AWLC 2VQRA 4XUJC 5KDMB 3C1CB 5B24D 1KX5C 2JE5A 5B31D 3W97B 1P3LD 3AZJA 3NQUB 4CAYB 3B0DC 3UT9A 2HUEB 3AV2B 2BG1A 4DQYB 3W99C 1P3PA 4WNNA 2YFWA 5B1LD 4XZQC 5AV5D 3KWQC 5GXQA 4CSRB 5B0YD 2YFVB 4ZUXA 4H9SA 1P3KA 1P3MD 5B2JD 3REJA 4E44A 3AZIA 1P3BC 3LZ1C 5B24C 4JJNA 5B31C 3VH5A 4J8UA 1P3LC 3AZFD 3AZKC 3AZLA 5GXQC 1P3OA 3REHA 3B6FA 4J8VA 5BT1D 2BYKB 5B1LC 5B1MB 3MNNB 3X1UB 1KU5A 5BNVA 5B0YC 2CV5C 3TU4B 3MGSA 3REKB 4X23D 3A1IA 5DNNC 5AVBB 3A6NB 3B6GD 3C1CA 1P3GB 4Z66B 1P3OC 3NQUA 4KGCB 4CAYA 3LJAA 1M18D 3AYWB 4WU9B 4J8WA 3EG5B 3H0MC 5CPJA 3LZ0B 5GT0C 4KHAB 4CSRA 2JSSA 1EQZD 2YFVA 1ID3A 5BT1C 3V9RB 3F6TA 5B0ZB 2NZDD 3MVDD 5CPKD 1BH8B 3IP4C 4X23C 3LJAC 3LELD 3REID 2F8NB 4LD9C 5AV6B 4WU8B 1TAFB 3H0RC 1M1AC 3KFUG 5B33C 3WA9D 1M18C 3B0CT 5GSUB 1TZYB 3MGRB 2HIOC 4AWLB 3C1BC 3MNNA 3X1UA 4H9OB 1EQZC 3X1SA 1KX3D 5AV8D 3TU4A 3B0DB 3REKA 1M19D 3RELD 3X1TC 5AVBA 3MVDC 5B40C 1P3GA 4Z66A 5CP6D 3W99B 3LELC 4XZQB 4KGCA 4KUDC 3KWQB 3AYWA 4QLCA 4YS3D 4J8XD 3AZEA 2IO5C 3LZ0A 3AV1D 3X1SC 2NQBD 4DRBA 1P3BB 3LZ1B 1W2EA 5B32D 5B24B 5B31B 1H3OA 5B0ZA 2YFWB 4UUZB 1KX3C 5AV8C 3AFAA 1BH8A 5GXQB 3AZKB 1AOIA 2F8NA 3RELC 3AN2D 4WU8A 3AZEC 2Y2LA 1P3AD 1F66D 4H9PB 5B1LB 1P3ID 1Z2CB 5B0YB 2CV5B 2F8NG 1TZYA 5CPID 3MGRA 4YS3C 1S32A 5DNNB 4XUJA 3AZMD 3WAAC 5AVCA 1KX5A 2W8SA 2RVQD 3AFAC 5C3IC 1P3OB 2NQBC 2AROA 5B32C 5AY8D 4ZBJC 5AV9D 3B6FB 2FJ7D 3UTAD 3AZHD 3X1VC 3W99A 4XZQA 5GT0B 5BNVB 3AN2C 1B67A 3UTBC 3VH5W 1F66C 1P3AC 5AVCC 3MGPD 1P3IC 5F99A 4WZSB 2AROC 5CPIC 4X23B 3LJAB 3WTPD 1P3BA 3LZ1A 4LD9B 3AZMC 5B24A 1P34D 5B31A 4J8WB 5CPJB 1P3LA 3VH6A 4UUZA 1M1AB 3AZKA 4Z5TD 5B33B 4E45A 1M18B 1ID3B 3UTAC 1A7WA 2HIOB 5B31G 4H9PA 5B1LA 4DRAA 5F99C 3C1BB 3UT9D 5E5AD 5B2IC 1HQ3D 1EQZB 5B0YA 2CV5A 1KX4D 5GT3D 3EPKA 1U35D 4Z2MH 5DNNA 3X1TB 1P3MA 5B40B 3LELB 4EO5C 3WTPC 4KUDB 1P3FD 2Y2PA 5AV5C 3REJD 3B0BA 2IO5B 5GT0A 2PYOD 3X1SB 4NE5A 3AZGD 4JJND 4J8UD 1F1EA 1P3MC 3O62D 5B2JC 3KXBD 4WJ3C 3W98D 1HQ3C 1KX3B 5AV8B 5GT3C 1KX4C 4X23A 2ZY4A 4LD9A 4QLCB 2Y2NA 3AZFC 4H9RB 3AZEB 3WKJD 1M1AA 2RIQA 1P3FC 5B33A 1M18A 4YS3B 2HIOA 3W97D 1T3UA 5DNMD 1H3OB 3C1BA 3WAAB 2PYOC 3AFAB 1R4VA 1AOIB 5C3IB 3AV2D 1EQZA 2NQBB 4YM6D 3B6GC 5B32B 4ZBJB 3O62C 3EPJA 3X1TA 3KXBC 3W98C 2NZDA 3MVDA 5B40A 3X1VB 3LELA 1BH9B 4KUDA 3W96D 3AN2B 1ZLAD 1N1JB 3UTBB 1S32B 3NQJB 4UPKA 1P3AB 4M6BA 4XUJB 1F66B 3WKJC 5AVCB 1P3IB 1KX5B 2JCHA 2AROB 5CPIB 2UWXA 4H9QB 1JFIB 5DNMC 3AZMB 3AZND 2NZDC 5CPKC 4YM6C 3REIC 5AV8A 1KX3A 1M19A 4NE6A 3RELA 5B1MD 3UTAB 4H9RA 5CP6A 3WA9C 5F99B 3W96C 3KUYD 3P5JB 5B2IB 1ZLAC 5BNXB 3EPHA 2BYMB 3A6ND 4YS3A 1P3GD 4Z66D 5BO0A 2CWEA 4KGCD 3WAAA 1P3LB 1B6WA 3AYWD 1M19C 2NQBA 2DF4C 3WTPB 4EO5B 4WU9D 3AZNC 5B32A 5JRGD 5CP6C 3MGQD 4H9NB 5AV5B 3X1VA 1BH9A 2J8PA 3AN2A 5B1MC 1N1JA 4J8XC 3UTBA 5B32G 3NQJA 5B0ZD 3VH6W 1P3AA 1F66A 3AV1C 2Y2MA 5G49B 2G5HC 3KUYC 1P3IA 4NE3A 1P3MB 5B2JB 1HQ3B 5AV6D 1KX4B 5BS7C 5GT3B 5CPIA 2F8NK 4H9QA 1JFIA 3AZMA 2Y2HA 3AZFB 3WTPE 5GSUD 4WU9C 3MGRD 1P3FB 2ZM5A 5AY8A 5JRGC 3MGQC 2Y2IA 3UTAA 3AZHA 1ULYA 4R8PD 1WWSA 2F8NH 2PYOB 5B2IA 5BNXA 2BYMA 2DQNC 3B6GB 3VH5T 3O62B 2RVQC 3KXBB 3KWQD 3W98B 5AV6C 2ZY3A 3WTPA 5AY8C 5AV9C 2ZY2A 2FJ7C 2G5IC 3AZHC 3AL0C 1P34A 3AZJD 5JA4A 5GSUC 3A1KA 4H9NA 5AV5A 4Z5TA 4Z2MG 1P3PD 3MGPC 4R8PC 5DNMB 5G49A 3AZKD 4G92C 5GXQD 2NZDB 3MVDB 3KSYA 5CPKB 5E5AA 5B2JA 1HQ3A 4YM6B 1Q9CA 4ZUXD 5GT3A 3REIB 1P3KD 1KX4A 1U35A 1P34C 5FUGA 3AZFA 4Z5TC 3WA9B 3AZID 2CV5D 2F2AC 3W96B 1P3FA 1ZLAB 5DNND 3AZJC 3AZLD 1P3OD 3UT9C 5E5AC 3REHD 2PYOA 1M19B 3AZGA 1U35C 1P3PC 3B6FD 4J8VD 3RELB 3AZNB 4G91C 3B6GA 2LY8A 3O62A 5GT0D 5CP6B 3KXBA 3W98A 3MGSD 4ZUXC 1PZRA 4H9SC 1P3KC 2L5AA 2XD5A 3C1CD 4J8XB 3REJC 5BO0B 3AZIC 3AV1B 3WKJA 3LJAD 3KUYB 3AZGC 4LD9D 4JJNC 5KDMA 2XD1A 4J8UC 3W97A 3AZLC 4J8WD 4WV4B 5CPJD 2Y2JA 5DNMA 3REHC 2Y2GA 1M1AD 5B33D 5CPKA 5CHLB 2ZY5A 3AV2A 3B6FC 4YM6A 4J8VC 3REIA 1ID3D 2HIOD 5JRGB 3C1BD
chains in the Genus database with same CATH topology
3MGQB 4HGAC 3MGSC 3WA9A 3W96A 1ZLAA 3C1CC 3X1TD 3W97C 3B0CW 1HTAA 5B40D 4KUDD 2HUEC 3AV2C 4J8WC 5AY8B 5CPJC 5AV9B 2Y2QA 2Y2KA 3MNND 3AZNA 2FJ7B 3AZHB 3X1UD 3X1SD 3TU4D 1ID3C 3REKD 2Y2OA 2BYKA 5AVBD 3EPLA 5B1MA 4J8XA 3MGPB 4R8PB 3AV1A 4G92B 3KUYA 4QLCD 3A6NA 5BS7A 3AZED 3LZ0D 1P34B 5JA4B 4Z5TB 3R45B 4WU9A 3MNNC 5JRGA 3FDDA 3WAAD 3X1UC 3MGQA 3AZJB 4KHAA 3AFAD 3TU4C 3REKC 1AOID 3UT9B 5E5AB 2F8ND 2FFFB 3V9RA 5AVBC 3A6NC 4WU8D 4NFTA 1P3GC 1U35B 4Z66C 1P3PB 4WNNB 4KGCC 3X1VD 5FUGB 4G91B 3VH6T 3AYWC 4QLCC 1TZYD 5AV6A 4ZUXB 3UTBD 1S32D 1P3KB 1TAFA 4XUJD 3LZ0C 5AV9A 2FJ7A 5AVCD 1KX5D 3REJB 3AZIB 5GSUA 2AROD 3AZGB 4JJNB 5B0ZC 1BFMA 4J8UB 3AZLB 3W99D 3H0LC 3MGPA 4H9OA 1WWIA 4XZQD 4R8PA 3REHB 1AOIC 4WU8C 4J8VB 5F99D 3KWQA 4HGAB 3WKJB 5B2ID 1TZYC 3MGSB 3MGRC 1S32C 3R45A 1P3BD 3LZ1D 4AWLC 2VQRA 4XUJC 5KDMB 3C1CB 5B24D 1KX5C 2JE5A 5B31D 3W97B 1P3LD 3AZJA 3NQUB 4CAYB 3B0DC 3UT9A 2HUEB 3AV2B 2BG1A 4DQYB 3W99C 1P3PA 4WNNA 2YFWA 5B1LD 4XZQC 5AV5D 3KWQC 5GXQA 4CSRB 5B0YD 2YFVB 4ZUXA 4H9SA 1P3KA 1P3MD 5B2JD 3REJA 4E44A 3AZIA 1P3BC 3LZ1C 5B24C 4JJNA 5B31C 3VH5A 4J8UA 1P3LC 3AZFD 3AZKC 3AZLA 5GXQC 1P3OA 3REHA 3B6FA 4J8VA 5BT1D 2BYKB 5B1LC 5B1MB 3MNNB 3X1UB 1KU5A 5BNVA 5B0YC 2CV5C 3TU4B 3MGSA 3REKB 4X23D 3A1IA 5DNNC 5AVBB 3A6NB 3B6GD 3C1CA 1P3GB 4Z66B 1P3OC 3NQUA 4KGCB 4CAYA 3LJAA 1M18D 3AYWB 4WU9B 4J8WA 3EG5B 3H0MC 5CPJA 3LZ0B 5GT0C 4KHAB 4CSRA 2JSSA 1EQZD 2YFVA 1ID3A 5BT1C 3V9RB 3F6TA 5B0ZB 2NZDD 3MVDD 5CPKD 1BH8B 3IP4C 4X23C 3LJAC 3LELD 3REID 2F8NB 4LD9C 5AV6B 4WU8B 1TAFB 3H0RC 1M1AC 3KFUG 5B33C 3WA9D 1M18C 3B0CT 5GSUB 1TZYB 3MGRB 2HIOC 4AWLB 3C1BC 3MNNA 3X1UA 4H9OB 1EQZC 3X1SA 1KX3D 5AV8D 3TU4A 3B0DB 3REKA 1M19D 3RELD 3X1TC 5AVBA 3MVDC 5B40C 1P3GA 4Z66A 5CP6D 3W99B 3LELC 4XZQB 4KGCA 4KUDC 3KWQB 3AYWA 4QLCA 4YS3D 4J8XD 3AZEA 2IO5C 3LZ0A 3AV1D 3X1SC 2NQBD 4DRBA 1P3BB 3LZ1B 1W2EA 5B32D 5B24B 5B31B 1H3OA 5B0ZA 2YFWB 4UUZB 1KX3C 5AV8C 3AFAA 1BH8A 5GXQB 3AZKB 1AOIA 2F8NA 3RELC 3AN2D 4WU8A 3AZEC 2Y2LA 1P3AD 1F66D 4H9PB 5B1LB 1P3ID 1Z2CB 5B0YB 2CV5B 2F8NG 1TZYA 5CPID 3MGRA 4YS3C 1S32A 5DNNB 4XUJA 3AZMD 3WAAC 5AVCA 1KX5A 2W8SA 2RVQD 3AFAC 5C3IC 1P3OB 2NQBC 2AROA 5B32C 5AY8D 4ZBJC 5AV9D 3B6FB 2FJ7D 3UTAD 3AZHD 3X1VC 3W99A 4XZQA 5GT0B 5BNVB 3AN2C 1B67A 3UTBC 3VH5W 1F66C 1P3AC 5AVCC 3MGPD 1P3IC 5F99A 4WZSB 2AROC 5CPIC 4X23B 3LJAB 3WTPD 1P3BA 3LZ1A 4LD9B 3AZMC 5B24A 1P34D 5B31A 4J8WB 5CPJB 1P3LA 3VH6A 4UUZA 1M1AB 3AZKA 4Z5TD 5B33B 4E45A 1M18B 1ID3B 3UTAC 1A7WA 2HIOB 5B31G 4H9PA 5B1LA 4DRAA 5F99C 3C1BB 3UT9D 5E5AD 5B2IC 1HQ3D 1EQZB 5B0YA 2CV5A 1KX4D 5GT3D 3EPKA 1U35D 4Z2MH 5DNNA 3X1TB 1P3MA 5B40B 3LELB 4EO5C 3WTPC 4KUDB 1P3FD 2Y2PA 5AV5C 3REJD 3B0BA 2IO5B 5GT0A 2PYOD 3X1SB 4NE5A 3AZGD 4JJND 4J8UD 1F1EA 1P3MC 3O62D 5B2JC 3KXBD 4WJ3C 3W98D 1HQ3C 1KX3B 5AV8B 5GT3C 1KX4C 4X23A 2ZY4A 4LD9A 4QLCB 2Y2NA 3AZFC 4H9RB 3AZEB 3WKJD 1M1AA 2RIQA 1P3FC 5B33A 1M18A 4YS3B 2HIOA 3W97D 1T3UA 5DNMD 1H3OB 3C1BA 3WAAB 2PYOC 3AFAB 1R4VA 1AOIB 5C3IB 3AV2D 1EQZA 2NQBB 4YM6D 3B6GC 5B32B 4ZBJB 3O62C 3EPJA 3X1TA 3KXBC 3W98C 2NZDA 3MVDA 5B40A 3X1VB 3LELA 1BH9B 4KUDA 3W96D 3AN2B 1ZLAD 1N1JB 3UTBB 1S32B 3NQJB 4UPKA 1P3AB 4M6BA 4XUJB 1F66B 3WKJC 5AVCB 1P3IB 1KX5B 2JCHA 2AROB 5CPIB 2UWXA 4H9QB 1JFIB 5DNMC 3AZMB 3AZND 2NZDC 5CPKC 4YM6C 3REIC 5AV8A 1KX3A 1M19A 4NE6A 3RELA 5B1MD 3UTAB 4H9RA 5CP6A 3WA9C 5F99B 3W96C 3KUYD 3P5JB 5B2IB 1ZLAC 5BNXB 3EPHA 2BYMB 3A6ND 4YS3A 1P3GD 4Z66D 5BO0A 2CWEA 4KGCD 3WAAA 1P3LB 1B6WA 3AYWD 1M19C 2NQBA 2DF4C 3WTPB 4EO5B 4WU9D 3AZNC 5B32A 5JRGD 5CP6C 3MGQD 4H9NB 5AV5B 3X1VA 1BH9A 2J8PA 3AN2A 5B1MC 1N1JA 4J8XC 3UTBA 5B32G 3NQJA 5B0ZD 3VH6W 1P3AA 1F66A 3AV1C 2Y2MA 5G49B 2G5HC 3KUYC 1P3IA 4NE3A 1P3MB 5B2JB 1HQ3B 5AV6D 1KX4B 5BS7C 5GT3B 5CPIA 2F8NK 4H9QA 1JFIA 3AZMA 2Y2HA 3AZFB 3WTPE 5GSUD 4WU9C 3MGRD 1P3FB 2ZM5A 5AY8A 5JRGC 3MGQC 2Y2IA 3UTAA 3AZHA 1ULYA 4R8PD 1WWSA 2F8NH 2PYOB 5B2IA 5BNXA 2BYMA 2DQNC 3B6GB 3VH5T 3O62B 2RVQC 3KXBB 3KWQD 3W98B 5AV6C 2ZY3A 3WTPA 5AY8C 5AV9C 2ZY2A 2FJ7C 2G5IC 3AZHC 3AL0C 1P34A 3AZJD 5JA4A 5GSUC 3A1KA 4H9NA 5AV5A 4Z5TA 4Z2MG 1P3PD 3MGPC 4R8PC 5DNMB 5G49A 3AZKD 4G92C 5GXQD 2NZDB 3MVDB 3KSYA 5CPKB 5E5AA 5B2JA 1HQ3A 4YM6B 1Q9CA 4ZUXD 5GT3A 3REIB 1P3KD 1KX4A 1U35A 1P34C 5FUGA 3AZFA 4Z5TC 3WA9B 3AZID 2CV5D 2F2AC 3W96B 1P3FA 1ZLAB 5DNND 3AZJC 3AZLD 1P3OD 3UT9C 5E5AC 3REHD 2PYOA 1M19B 3AZGA 1U35C 1P3PC 3B6FD 4J8VD 3RELB 3AZNB 4G91C 3B6GA 2LY8A 3O62A 5GT0D 5CP6B 3KXBA 3W98A 3MGSD 4ZUXC 1PZRA 4H9SC 1P3KC 2L5AA 2XD5A 3C1CD 4J8XB 3REJC 5BO0B 3AZIC 3AV1B 3WKJA 3LJAD 3KUYB 3AZGC 4LD9D 4JJNC 5KDMA 2XD1A 4J8UC 3W97A 3AZLC 4J8WD 4WV4B 5CPJD 2Y2JA 5DNMA 3REHC 2Y2GA 1M1AD 5B33D 5CPKA 5CHLB 2ZY5A 3AV2A 3B6FC 4YM6A 4J8VC 3REIA 1ID3D 2HIOD 5JRGB 3C1BD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MGQ B;  4HGA C;  3MGS C;  3WA9 A;  3W96 A;  1ZLA A;  3C1C C;  3X1T D;  3W97 C;  3B0C W;  1HTA A;  5B40 D;  4KUD D;  2HUE C;  3AV2 C;  4J8W C;  5AY8 B;  5CPJ C;  5AV9 B;  2FJ7 B;  3MNN D;  3AZN A;  3AZH B;  3X1U D;  3X1S D;  3TU4 D;  1ID3 C;  3REK D;  2BYK A;  5AVB D;  5B1M A;  4J8X A;  3MGP B;  4R8P B;  3AV1 A;  4G92 B;  3KUY A;  4QLC D;  3A6N A;  5BS7 A;  3AZE D;  3LZ0 D;  1P34 B;  5JA4 B;  4Z5T B;  3R45 B;  4WU9 A;  3MNN C;  5JRG A;  3WAA D;  3X1U C;  3MGQ A;  3AZJ B;  4KHA A;  3AFA D;  3TU4 C;  3REK C;  1AOI D;  3UT9 B;  5E5A B;  2F8N D;  3V9R A;  5AVB C;  3A6N C;  4WU8 D;  4NFT A;  1P3G C;  1U35 B;  4Z66 C;  1P3P B;  4WNN B;  4KGC C;  3X1V D;  5FUG B;  4G91 B;  3VH6 T;  3AYW C;  4QLC C;  1TZY D;  5AV6 A;  4ZUX B;  3UTB D;  1S32 D;  1P3K B;  1TAF A;  4XUJ D;  3LZ0 C;  5AV9 A;  2FJ7 A;  5AVC D;  1KX5 D;  3REJ B;  3AZI B;  5GSU A;  2ARO D;  3AZG B;  4JJN B;  5B0Z C;  1BFM A;  4J8U B;  3AZL B;  3W99 D;  3MGP A;  4H9O A;  1WWI A;  4XZQ D;  4R8P A;  3REH B;  1AOI C;  4WU8 C;  4J8V B;  5F99 D;  3KWQ A;  4HGA B;  3WKJ B;  5B2I D;  1TZY C;  3MGS B;  3MGR C;  1S32 C;  3R45 A;  1P3B D;  3LZ1 D;  4AWL C;  4XUJ C;  5KDM B;  3C1C B;  5B24 D;  1KX5 C;  5B31 D;  3W97 B;  1P3L D;  3AZJ A;  3NQU B;  4CAY B;  3B0D C;  3UT9 A;  2HUE B;  3AV2 B;  3W99 C;  1P3P A;  4WNN A;  2YFW A;  5B1L D;  4XZQ C;  5AV5 D;  3KWQ C;  5GXQ A;  4CSR B;  5B0Y D;  2YFV B;  4ZUX A;  4H9S A;  1P3K A;  1P3M D;  5B2J D;  3REJ A;  4E44 A;  3AZI A;  1P3B C;  3LZ1 C;  5B24 C;  4JJN A;  5B31 C;  3VH5 A;  4J8U A;  1P3L C;  3AZF D;  3AZK C;  3AZL A;  5GXQ C;  1P3O A;  3REH A;  3B6F A;  4J8V A;  5BT1 D;  2BYK B;  5B1L C;  5B1M B;  3MNN B;  3X1U B;  1KU5 A;  5BNV A;  5B0Y C;  2CV5 C;  3TU4 B;  3MGS A;  3REK B;  4X23 D;  5DNN C;  5AVB B;  3A6N B;  3B6G D;  3C1C A;  1P3G B;  4Z66 B;  1P3O C;  3NQU A;  4KGC B;  4CAY A;  3LJA A;  1M18 D;  3AYW B;  4WU9 B;  4J8W A;  5CPJ A;  3LZ0 B;  5GT0 C;  4KHA B;  4CSR A;  2JSS A;  1EQZ D;  2YFV A;  1ID3 A;  5BT1 C;  3V9R B;  5B0Z B;  2NZD D;  3MVD D;  5CPK D;  1BH8 B;  4X23 C;  3LJA C;  3LEL D;  3REI D;  2F8N B;  4LD9 C;  5AV6 B;  4WU8 B;  1TAF B;  1M1A C;  5B33 C;  3WA9 D;  1M18 C;  3B0C T;  5GSU B;  1TZY B;  3MGR B;  2HIO C;  4AWL B;  3C1B C;  3MNN A;  3X1U A;  4H9O B;  1EQZ C;  3X1S A;  1KX3 D;  5AV8 D;  3TU4 A;  3B0D B;  3REK A;  1M19 D;  3REL D;  3X1T C;  5AVB A;  3MVD C;  5B40 C;  1P3G A;  4Z66 A;  5CP6 D;  3W99 B;  3LEL C;  4XZQ B;  4KGC A;  4KUD C;  3KWQ B;  3AYW A;  4QLC A;  4YS3 D;  4J8X D;  3AZE A;  2IO5 C;  3LZ0 A;  3AV1 D;  3X1S C;  2NQB D;  4DRB A;  1P3B B;  3LZ1 B;  5B32 D;  5B24 B;  5B31 B;  1H3O A;  5B0Z A;  2YFW B;  4UUZ B;  1KX3 C;  5AV8 C;  3AFA A;  1BH8 A;  5GXQ B;  3AZK B;  1AOI A;  2F8N A;  3REL C;  3AN2 D;  4WU8 A;  3AZE C;  1F66 D;  1P3A D;  4H9P B;  5B1L B;  1P3I D;  5B0Y B;  2CV5 B;  2F8N G;  1TZY A;  5CPI D;  3MGR A;  4YS3 C;  1S32 A;  5DNN B;  4XUJ A;  3AZM D;  3WAA C;  5AVC A;  1KX5 A;  3AFA C;  2RVQ D;  5C3I C;  1P3O B;  2NQB C;  2ARO A;  5B32 C;  5AY8 D;  4ZBJ C;  5AV9 D;  3B6F B;  2FJ7 D;  3UTA D;  3AZH D;  3X1V C;  3W99 A;  4XZQ A;  5GT0 B;  5BNV B;  3AN2 C;  1B67 A;  3UTB C;  3VH5 W;  1F66 C;  1P3A C;  5AVC C;  3MGP D;  1P3I C;  5F99 A;  4WZS B;  2ARO C;  5CPI C;  4X23 B;  3LJA B;  3WTP D;  1P3B A;  3LZ1 A;  4LD9 B;  3AZM C;  5B24 A;  1P34 D;  5B31 A;  4J8W B;  5CPJ B;  1P3L A;  3VH6 A;  4UUZ A;  1M1A B;  3AZK A;  4Z5T D;  5B33 B;  4E45 A;  1M18 B;  1ID3 B;  3UTA C;  1A7W A;  2HIO B;  5B31 G;  4H9P A;  5B1L A;  4DRA A;  5F99 C;  3C1B B;  3UT9 D;  5E5A D;  5B2I C;  1HQ3 D;  1EQZ B;  5B0Y A;  2CV5 A;  1KX4 D;  5GT3 D;  1U35 D;  4Z2M H;  5DNN A;  3X1T B;  1P3M A;  5B40 B;  3LEL B;  4EO5 C;  3WTP C;  4KUD B;  1P3F D;  5AV5 C;  3REJ D;  3B0B A;  2IO5 B;  5GT0 A;  2PYO D;  3X1S B;  4NE5 A;  3AZG D;  4JJN D;  4J8U D;  1F1E A;  1P3M C;  3O62 D;  5B2J C;  3KXB D;  3W98 D;  1HQ3 C;  1KX3 B;  5AV8 B;  5GT3 C;  1KX4 C;  4X23 A;  4LD9 A;  4QLC B;  3AZF C;  4H9R B;  3AZE B;  3WKJ D;  1M1A A;  1P3F C;  5B33 A;  1M18 A;  4YS3 B;  2HIO A;  3W97 D;  5DNM D;  1H3O B;  3C1B A;  3WAA B;  2PYO C;  3AFA B;  1R4V A;  1AOI B;  5C3I B;  3AV2 D;  1EQZ A;  2NQB B;  4YM6 D;  3B6G C;  5B32 B;  4ZBJ B;  3O62 C;  3X1T A;  3KXB C;  3W98 C;  2NZD A;  3MVD A;  5B40 A;  3X1V B;  3LEL A;  1BH9 B;  4KUD A;  3W96 D;  3AN2 B;  1ZLA D;  1N1J B;  3UTB B;  1S32 B;  3NQJ B;  1F66 B;  1P3A B;  4M6B A;  4XUJ B;  3WKJ C;  5AVC B;  1P3I B;  1KX5 B;  2ARO B;  5CPI B;  4H9Q B;  1JFI B;  5DNM C;  3AZM B;  3AZN D;  2NZD C;  5CPK C;  4YM6 C;  3REI C;  5AV8 A;  1KX3 A;  1M19 A;  4NE6 A;  3REL A;  5B1M D;  3UTA B;  4H9R A;  5CP6 A;  3WA9 C;  5F99 B;  3W96 C;  3KUY D;  5B2I B;  1ZLA C;  5BNX B;  2BYM B;  3A6N D;  4YS3 A;  1P3G D;  4Z66 D;  5BO0 A;  2CWE A;  4KGC D;  3WAA A;  1P3L B;  1B6W A;  3AYW D;  1M19 C;  2NQB A;  4EO5 B;  3WTP B;  4WU9 D;  3AZN C;  5B32 A;  5JRG D;  5CP6 C;  3MGQ D;  4H9N B;  5AV5 B;  3X1V A;  1BH9 A;  3AN2 A;  5B1M C;  1N1J A;  4J8X C;  3UTB A;  5B32 G;  3NQJ A;  5B0Z D;  3VH6 W;  1P3A A;  1F66 A;  3AV1 C;  5G49 B;  3KUY C;  1P3I A;  4NE3 A;  1P3M B;  5B2J B;  1HQ3 B;  5AV6 D;  1KX4 B;  5BS7 C;  5GT3 B;  5CPI A;  2F8N K;  4H9Q A;  1JFI A;  3AZM A;  3AZF B;  3WTP E;  5GSU D;  4WU9 C;  3MGR D;  1P3F B;  5AY8 A;  5JRG C;  3MGQ C;  3UTA A;  3AZH A;  1ULY A;  4R8P D;  1WWS A;  2F8N H;  2PYO B;  5B2I A;  5BNX A;  2BYM A;  3B6G B;  3VH5 T;  3O62 B;  2RVQ C;  3KXB B;  3KWQ D;  3W98 B;  5AV6 C;  3WTP A;  5AY8 C;  5AV9 C;  2FJ7 C;  3AZH C;  1P34 A;  3AZJ D;  5JA4 A;  5GSU C;  4H9N A;  5AV5 A;  4Z5T A;  4Z2M G;  1P3P D;  3MGP C;  4R8P C;  5DNM B;  5G49 A;  3AZK D;  4G92 C;  5GXQ D;  2NZD B;  3MVD B;  3KSY A;  5CPK B;  5E5A A;  5B2J A;  1HQ3 A;  4YM6 B;  1Q9C A;  4ZUX D;  5GT3 A;  3REI B;  1P3K D;  1KX4 A;  1U35 A;  1P34 C;  5FUG A;  3AZF A;  4Z5T C;  3WA9 B;  3AZI D;  2CV5 D;  3W96 B;  1P3F A;  1ZLA B;  5DNN D;  3AZJ C;  3AZL D;  1P3O D;  3UT9 C;  5E5A C;  3REH D;  2PYO A;  1M19 B;  3AZG A;  1U35 C;  1P3P C;  3B6F D;  4J8V D;  3REL B;  3AZN B;  4G91 C;  3B6G A;  2LY8 A;  3O62 A;  5GT0 D;  5CP6 B;  3KXB A;  3W98 A;  3MGS D;  4ZUX C;  4H9S C;  1P3K C;  2L5A A;  3C1C D;  4J8X B;  3REJ C;  5BO0 B;  3AZI C;  3AV1 B;  3WKJ A;  3LJA D;  3KUY B;  3AZG C;  4LD9 D;  4JJN C;  5KDM A;  4J8U C;  3W97 A;  3AZL C;  4J8W D;  4WV4 B;  5CPJ D;  5DNM A;  3REH C;  1M1A D;  5B33 D;  5CPK A;  5CHL B;  3AV2 A;  3B6F C;  4YM6 A;  4J8V C;  3REI A;  1ID3 D;  2HIO D;  5JRG B;  3C1B D; 
#chains in the Genus database with same CATH topology
 3MGQ B;  4HGA C;  3MGS C;  3WA9 A;  3W96 A;  1ZLA A;  3C1C C;  3X1T D;  3W97 C;  3B0C W;  1HTA A;  5B40 D;  4KUD D;  2HUE C;  3AV2 C;  4J8W C;  5AY8 B;  5CPJ C;  5AV9 B;  2Y2Q A;  2Y2K A;  3MNN D;  3AZN A;  2FJ7 B;  3AZH B;  3X1U D;  3X1S D;  3TU4 D;  1ID3 C;  3REK D;  2Y2O A;  2BYK A;  5AVB D;  3EPL A;  5B1M A;  4J8X A;  3MGP B;  4R8P B;  3AV1 A;  4G92 B;  3KUY A;  4QLC D;  3A6N A;  5BS7 A;  3AZE D;  3LZ0 D;  1P34 B;  5JA4 B;  4Z5T B;  3R45 B;  4WU9 A;  3MNN C;  5JRG A;  3FDD A;  3WAA D;  3X1U C;  3MGQ A;  3AZJ B;  4KHA A;  3AFA D;  3TU4 C;  3REK C;  1AOI D;  3UT9 B;  5E5A B;  2F8N D;  2FFF B;  3V9R A;  5AVB C;  3A6N C;  4WU8 D;  4NFT A;  1P3G C;  1U35 B;  4Z66 C;  1P3P B;  4WNN B;  4KGC C;  3X1V D;  5FUG B;  4G91 B;  3VH6 T;  3AYW C;  4QLC C;  1TZY D;  5AV6 A;  4ZUX B;  3UTB D;  1S32 D;  1P3K B;  1TAF A;  4XUJ D;  3LZ0 C;  5AV9 A;  2FJ7 A;  5AVC D;  1KX5 D;  3REJ B;  3AZI B;  5GSU A;  2ARO D;  3AZG B;  4JJN B;  5B0Z C;  1BFM A;  4J8U B;  3AZL B;  3W99 D;  3H0L C;  3MGP A;  4H9O A;  1WWI A;  4XZQ D;  4R8P A;  3REH B;  1AOI C;  4WU8 C;  4J8V B;  5F99 D;  3KWQ A;  4HGA B;  3WKJ B;  5B2I D;  1TZY C;  3MGS B;  3MGR C;  1S32 C;  3R45 A;  1P3B D;  3LZ1 D;  4AWL C;  2VQR A;  4XUJ C;  5KDM B;  3C1C B;  5B24 D;  1KX5 C;  2JE5 A;  5B31 D;  3W97 B;  1P3L D;  3AZJ A;  3NQU B;  4CAY B;  3B0D C;  3UT9 A;  2HUE B;  3AV2 B;  2BG1 A;  4DQY B;  3W99 C;  1P3P A;  4WNN A;  2YFW A;  5B1L D;  4XZQ C;  5AV5 D;  3KWQ C;  5GXQ A;  4CSR B;  5B0Y D;  2YFV B;  4ZUX A;  4H9S A;  1P3K A;  1P3M D;  5B2J D;  3REJ A;  4E44 A;  3AZI A;  1P3B C;  3LZ1 C;  5B24 C;  4JJN A;  5B31 C;  3VH5 A;  4J8U A;  1P3L C;  3AZF D;  3AZK C;  3AZL A;  5GXQ C;  1P3O A;  3REH A;  3B6F A;  4J8V A;  5BT1 D;  2BYK B;  5B1L C;  5B1M B;  3MNN B;  3X1U B;  1KU5 A;  5BNV A;  5B0Y C;  2CV5 C;  3TU4 B;  3MGS A;  3REK B;  4X23 D;  3A1I A;  5DNN C;  5AVB B;  3A6N B;  3B6G D;  3C1C A;  1P3G B;  4Z66 B;  1P3O C;  3NQU A;  4KGC B;  4CAY A;  3LJA A;  1M18 D;  3AYW B;  4WU9 B;  4J8W A;  3EG5 B;  3H0M C;  5CPJ A;  3LZ0 B;  5GT0 C;  4KHA B;  4CSR A;  2JSS A;  1EQZ D;  2YFV A;  1ID3 A;  5BT1 C;  3V9R B;  3F6T A;  5B0Z B;  2NZD D;  3MVD D;  5CPK D;  1BH8 B;  3IP4 C;  4X23 C;  3LJA C;  3LEL D;  3REI D;  2F8N B;  4LD9 C;  5AV6 B;  4WU8 B;  1TAF B;  3H0R C;  1M1A C;  3KFU G;  5B33 C;  3WA9 D;  1M18 C;  3B0C T;  5GSU B;  1TZY B;  3MGR B;  2HIO C;  4AWL B;  3C1B C;  3MNN A;  3X1U A;  4H9O B;  1EQZ C;  3X1S A;  1KX3 D;  5AV8 D;  3TU4 A;  3B0D B;  3REK A;  1M19 D;  3REL D;  3X1T C;  5AVB A;  3MVD C;  5B40 C;  1P3G A;  4Z66 A;  5CP6 D;  3W99 B;  3LEL C;  4XZQ B;  4KGC A;  4KUD C;  3KWQ B;  3AYW A;  4QLC A;  4YS3 D;  4J8X D;  3AZE A;  2IO5 C;  3LZ0 A;  3AV1 D;  3X1S C;  2NQB D;  4DRB A;  1P3B B;  3LZ1 B;  1W2E A;  5B32 D;  5B24 B;  5B31 B;  1H3O A;  5B0Z A;  2YFW B;  4UUZ B;  1KX3 C;  5AV8 C;  3AFA A;  1BH8 A;  5GXQ B;  3AZK B;  1AOI A;  2F8N A;  3REL C;  3AN2 D;  4WU8 A;  3AZE C;  2Y2L A;  1P3A D;  1F66 D;  4H9P B;  5B1L B;  1P3I D;  1Z2C B;  5B0Y B;  2CV5 B;  2F8N G;  1TZY A;  5CPI D;  3MGR A;  4YS3 C;  1S32 A;  5DNN B;  4XUJ A;  3AZM D;  3WAA C;  5AVC A;  1KX5 A;  2W8S A;  2RVQ D;  3AFA C;  5C3I C;  1P3O B;  2NQB C;  2ARO A;  5B32 C;  5AY8 D;  4ZBJ C;  5AV9 D;  3B6F B;  2FJ7 D;  3UTA D;  3AZH D;  3X1V C;  3W99 A;  4XZQ A;  5GT0 B;  5BNV B;  3AN2 C;  1B67 A;  3UTB C;  3VH5 W;  1F66 C;  1P3A C;  5AVC C;  3MGP D;  1P3I C;  5F99 A;  4WZS B;  2ARO C;  5CPI C;  4X23 B;  3LJA B;  3WTP D;  1P3B A;  3LZ1 A;  4LD9 B;  3AZM C;  5B24 A;  1P34 D;  5B31 A;  4J8W B;  5CPJ B;  1P3L A;  3VH6 A;  4UUZ A;  1M1A B;  3AZK A;  4Z5T D;  5B33 B;  4E45 A;  1M18 B;  1ID3 B;  3UTA C;  1A7W A;  2HIO B;  5B31 G;  4H9P A;  5B1L A;  4DRA A;  5F99 C;  3C1B B;  3UT9 D;  5E5A D;  5B2I C;  1HQ3 D;  1EQZ B;  5B0Y A;  2CV5 A;  1KX4 D;  5GT3 D;  3EPK A;  1U35 D;  4Z2M H;  5DNN A;  3X1T B;  1P3M A;  5B40 B;  3LEL B;  4EO5 C;  3WTP C;  4KUD B;  1P3F D;  2Y2P A;  5AV5 C;  3REJ D;  3B0B A;  2IO5 B;  5GT0 A;  2PYO D;  3X1S B;  4NE5 A;  3AZG D;  4JJN D;  4J8U D;  1F1E A;  1P3M C;  3O62 D;  5B2J C;  3KXB D;  4WJ3 C;  3W98 D;  1HQ3 C;  1KX3 B;  5AV8 B;  5GT3 C;  1KX4 C;  4X23 A;  2ZY4 A;  4LD9 A;  4QLC B;  2Y2N A;  3AZF C;  4H9R B;  3AZE B;  3WKJ D;  1M1A A;  2RIQ A;  1P3F C;  5B33 A;  1M18 A;  4YS3 B;  2HIO A;  3W97 D;  1T3U A;  5DNM D;  1H3O B;  3C1B A;  3WAA B;  2PYO C;  3AFA B;  1R4V A;  1AOI B;  5C3I B;  3AV2 D;  1EQZ A;  2NQB B;  4YM6 D;  3B6G C;  5B32 B;  4ZBJ B;  3O62 C;  3EPJ A;  3X1T A;  3KXB C;  3W98 C;  2NZD A;  3MVD A;  5B40 A;  3X1V B;  3LEL A;  1BH9 B;  4KUD A;  3W96 D;  3AN2 B;  1ZLA D;  1N1J B;  3UTB B;  1S32 B;  3NQJ B;  4UPK A;  1P3A B;  4M6B A;  4XUJ B;  1F66 B;  3WKJ C;  5AVC B;  1P3I B;  1KX5 B;  2JCH A;  2ARO B;  5CPI B;  2UWX A;  4H9Q B;  1JFI B;  5DNM C;  3AZM B;  3AZN D;  2NZD C;  5CPK C;  4YM6 C;  3REI C;  5AV8 A;  1KX3 A;  1M19 A;  4NE6 A;  3REL A;  5B1M D;  3UTA B;  4H9R A;  5CP6 A;  3WA9 C;  5F99 B;  3W96 C;  3KUY D;  3P5J B;  5B2I B;  1ZLA C;  5BNX B;  3EPH A;  2BYM B;  3A6N D;  4YS3 A;  1P3G D;  4Z66 D;  5BO0 A;  2CWE A;  4KGC D;  3WAA A;  1P3L B;  1B6W A;  3AYW D;  1M19 C;  2NQB A;  2DF4 C;  3WTP B;  4EO5 B;  4WU9 D;  3AZN C;  5B32 A;  5JRG D;  5CP6 C;  3MGQ D;  4H9N B;  5AV5 B;  3X1V A;  1BH9 A;  2J8P A;  3AN2 A;  5B1M C;  1N1J A;  4J8X C;  3UTB A;  5B32 G;  3NQJ A;  5B0Z D;  3VH6 W;  1P3A A;  1F66 A;  3AV1 C;  2Y2M A;  5G49 B;  2G5H C;  3KUY C;  1P3I A;  4NE3 A;  1P3M B;  5B2J B;  1HQ3 B;  5AV6 D;  1KX4 B;  5BS7 C;  5GT3 B;  5CPI A;  2F8N K;  4H9Q A;  1JFI A;  3AZM A;  2Y2H A;  3AZF B;  3WTP E;  5GSU D;  4WU9 C;  3MGR D;  1P3F B;  2ZM5 A;  5AY8 A;  5JRG C;  3MGQ C;  2Y2I A;  3UTA A;  3AZH A;  1ULY A;  4R8P D;  1WWS A;  2F8N H;  2PYO B;  5B2I A;  5BNX A;  2BYM A;  2DQN C;  3B6G B;  3VH5 T;  3O62 B;  2RVQ C;  3KXB B;  3KWQ D;  3W98 B;  5AV6 C;  2ZY3 A;  3WTP A;  5AY8 C;  5AV9 C;  2ZY2 A;  2FJ7 C;  2G5I C;  3AZH C;  3AL0 C;  1P34 A;  3AZJ D;  5JA4 A;  5GSU C;  3A1K A;  4H9N A;  5AV5 A;  4Z5T A;  4Z2M G;  1P3P D;  3MGP C;  4R8P C;  5DNM B;  5G49 A;  3AZK D;  4G92 C;  5GXQ D;  2NZD B;  3MVD B;  3KSY A;  5CPK B;  5E5A A;  5B2J A;  1HQ3 A;  4YM6 B;  1Q9C A;  4ZUX D;  5GT3 A;  3REI B;  1P3K D;  1KX4 A;  1U35 A;  1P34 C;  5FUG A;  3AZF A;  4Z5T C;  3WA9 B;  3AZI D;  2CV5 D;  2F2A C;  3W96 B;  1P3F A;  1ZLA B;  5DNN D;  3AZJ C;  3AZL D;  1P3O D;  3UT9 C;  5E5A C;  3REH D;  2PYO A;  1M19 B;  3AZG A;  1U35 C;  1P3P C;  3B6F D;  4J8V D;  3REL B;  3AZN B;  4G91 C;  3B6G A;  2LY8 A;  3O62 A;  5GT0 D;  5CP6 B;  3KXB A;  3W98 A;  3MGS D;  4ZUX C;  1PZR A;  4H9S C;  1P3K C;  2L5A A;  2XD5 A;  3C1C D;  4J8X B;  3REJ C;  5BO0 B;  3AZI C;  3AV1 B;  3WKJ A;  3LJA D;  3KUY B;  3AZG C;  4LD9 D;  4JJN C;  5KDM A;  2XD1 A;  4J8U C;  3W97 A;  3AZL C;  4J8W D;  4WV4 B;  5CPJ D;  2Y2J A;  5DNM A;  3REH C;  2Y2G A;  1M1A D;  5B33 D;  5CPK A;  5CHL B;  2ZY5 A;  3AV2 A;  3B6F C;  4YM6 A;  4J8V C;  3REI A;  1ID3 D;  2HIO D;  5JRG B;  3C1B D; 
#chains in the Genus database with same CATH homology
 3MGQ B;  4HGA C;  3MGS C;  3WA9 A;  3W96 A;  1ZLA A;  3C1C C;  3X1T D;  3W97 C;  3B0C W;  1HTA A;  5B40 D;  4KUD D;  2HUE C;  3AV2 C;  4J8W C;  5AY8 B;  5CPJ C;  5AV9 B;  2Y2Q A;  2Y2K A;  3MNN D;  3AZN A;  2FJ7 B;  3AZH B;  3X1U D;  3X1S D;  3TU4 D;  1ID3 C;  3REK D;  2Y2O A;  2BYK A;  5AVB D;  3EPL A;  5B1M A;  4J8X A;  3MGP B;  4R8P B;  3AV1 A;  4G92 B;  3KUY A;  4QLC D;  3A6N A;  5BS7 A;  3AZE D;  3LZ0 D;  1P34 B;  5JA4 B;  4Z5T B;  3R45 B;  4WU9 A;  3MNN C;  5JRG A;  3FDD A;  3WAA D;  3X1U C;  3MGQ A;  3AZJ B;  4KHA A;  3AFA D;  3TU4 C;  3REK C;  1AOI D;  3UT9 B;  5E5A B;  2F8N D;  2FFF B;  3V9R A;  5AVB C;  3A6N C;  4WU8 D;  4NFT A;  1P3G C;  1U35 B;  4Z66 C;  1P3P B;  4WNN B;  4KGC C;  3X1V D;  5FUG B;  4G91 B;  3VH6 T;  3AYW C;  4QLC C;  1TZY D;  5AV6 A;  4ZUX B;  3UTB D;  1S32 D;  1P3K B;  1TAF A;  4XUJ D;  3LZ0 C;  5AV9 A;  2FJ7 A;  5AVC D;  1KX5 D;  3REJ B;  3AZI B;  5GSU A;  2ARO D;  3AZG B;  4JJN B;  5B0Z C;  1BFM A;  4J8U B;  3AZL B;  3W99 D;  3H0L C;  3MGP A;  4H9O A;  1WWI A;  4XZQ D;  4R8P A;  3REH B;  1AOI C;  4WU8 C;  4J8V B;  5F99 D;  3KWQ A;  4HGA B;  3WKJ B;  5B2I D;  1TZY C;  3MGS B;  3MGR C;  1S32 C;  3R45 A;  1P3B D;  3LZ1 D;  4AWL C;  2VQR A;  4XUJ C;  5KDM B;  3C1C B;  5B24 D;  1KX5 C;  2JE5 A;  5B31 D;  3W97 B;  1P3L D;  3AZJ A;  3NQU B;  4CAY B;  3B0D C;  3UT9 A;  2HUE B;  3AV2 B;  2BG1 A;  4DQY B;  3W99 C;  1P3P A;  4WNN A;  2YFW A;  5B1L D;  4XZQ C;  5AV5 D;  3KWQ C;  5GXQ A;  4CSR B;  5B0Y D;  2YFV B;  4ZUX A;  4H9S A;  1P3K A;  1P3M D;  5B2J D;  3REJ A;  4E44 A;  3AZI A;  1P3B C;  3LZ1 C;  5B24 C;  4JJN A;  5B31 C;  3VH5 A;  4J8U A;  1P3L C;  3AZF D;  3AZK C;  3AZL A;  5GXQ C;  1P3O A;  3REH A;  3B6F A;  4J8V A;  5BT1 D;  2BYK B;  5B1L C;  5B1M B;  3MNN B;  3X1U B;  1KU5 A;  5BNV A;  5B0Y C;  2CV5 C;  3TU4 B;  3MGS A;  3REK B;  4X23 D;  3A1I A;  5DNN C;  5AVB B;  3A6N B;  3B6G D;  3C1C A;  1P3G B;  4Z66 B;  1P3O C;  3NQU A;  4KGC B;  4CAY A;  3LJA A;  1M18 D;  3AYW B;  4WU9 B;  4J8W A;  3EG5 B;  3H0M C;  5CPJ A;  3LZ0 B;  5GT0 C;  4KHA B;  4CSR A;  2JSS A;  1EQZ D;  2YFV A;  1ID3 A;  5BT1 C;  3V9R B;  3F6T A;  5B0Z B;  2NZD D;  3MVD D;  5CPK D;  1BH8 B;  3IP4 C;  4X23 C;  3LJA C;  3LEL D;  3REI D;  2F8N B;  4LD9 C;  5AV6 B;  4WU8 B;  1TAF B;  3H0R C;  1M1A C;  3KFU G;  5B33 C;  3WA9 D;  1M18 C;  3B0C T;  5GSU B;  1TZY B;  3MGR B;  2HIO C;  4AWL B;  3C1B C;  3MNN A;  3X1U A;  4H9O B;  1EQZ C;  3X1S A;  1KX3 D;  5AV8 D;  3TU4 A;  3B0D B;  3REK A;  1M19 D;  3REL D;  3X1T C;  5AVB A;  3MVD C;  5B40 C;  1P3G A;  4Z66 A;  5CP6 D;  3W99 B;  3LEL C;  4XZQ B;  4KGC A;  4KUD C;  3KWQ B;  3AYW A;  4QLC A;  4YS3 D;  4J8X D;  3AZE A;  2IO5 C;  3LZ0 A;  3AV1 D;  3X1S C;  2NQB D;  4DRB A;  1P3B B;  3LZ1 B;  1W2E A;  5B32 D;  5B24 B;  5B31 B;  1H3O A;  5B0Z A;  2YFW B;  4UUZ B;  1KX3 C;  5AV8 C;  3AFA A;  1BH8 A;  5GXQ B;  3AZK B;  1AOI A;  2F8N A;  3REL C;  3AN2 D;  4WU8 A;  3AZE C;  2Y2L A;  1P3A D;  1F66 D;  4H9P B;  5B1L B;  1P3I D;  1Z2C B;  5B0Y B;  2CV5 B;  2F8N G;  1TZY A;  5CPI D;  3MGR A;  4YS3 C;  1S32 A;  5DNN B;  4XUJ A;  3AZM D;  3WAA C;  5AVC A;  1KX5 A;  2W8S A;  2RVQ D;  3AFA C;  5C3I C;  1P3O B;  2NQB C;  2ARO A;  5B32 C;  5AY8 D;  4ZBJ C;  5AV9 D;  3B6F B;  2FJ7 D;  3UTA D;  3AZH D;  3X1V C;  3W99 A;  4XZQ A;  5GT0 B;  5BNV B;  3AN2 C;  1B67 A;  3UTB C;  3VH5 W;  1F66 C;  1P3A C;  5AVC C;  3MGP D;  1P3I C;  5F99 A;  4WZS B;  2ARO C;  5CPI C;  4X23 B;  3LJA B;  3WTP D;  1P3B A;  3LZ1 A;  4LD9 B;  3AZM C;  5B24 A;  1P34 D;  5B31 A;  4J8W B;  5CPJ B;  1P3L A;  3VH6 A;  4UUZ A;  1M1A B;  3AZK A;  4Z5T D;  5B33 B;  4E45 A;  1M18 B;  1ID3 B;  3UTA C;  1A7W A;  2HIO B;  5B31 G;  4H9P A;  5B1L A;  4DRA A;  5F99 C;  3C1B B;  3UT9 D;  5E5A D;  5B2I C;  1HQ3 D;  1EQZ B;  5B0Y A;  2CV5 A;  1KX4 D;  5GT3 D;  3EPK A;  1U35 D;  4Z2M H;  5DNN A;  3X1T B;  1P3M A;  5B40 B;  3LEL B;  4EO5 C;  3WTP C;  4KUD B;  1P3F D;  2Y2P A;  5AV5 C;  3REJ D;  3B0B A;  2IO5 B;  5GT0 A;  2PYO D;  3X1S B;  4NE5 A;  3AZG D;  4JJN D;  4J8U D;  1F1E A;  1P3M C;  3O62 D;  5B2J C;  3KXB D;  4WJ3 C;  3W98 D;  1HQ3 C;  1KX3 B;  5AV8 B;  5GT3 C;  1KX4 C;  4X23 A;  2ZY4 A;  4LD9 A;  4QLC B;  2Y2N A;  3AZF C;  4H9R B;  3AZE B;  3WKJ D;  1M1A A;  2RIQ A;  1P3F C;  5B33 A;  1M18 A;  4YS3 B;  2HIO A;  3W97 D;  1T3U A;  5DNM D;  1H3O B;  3C1B A;  3WAA B;  2PYO C;  3AFA B;  1R4V A;  1AOI B;  5C3I B;  3AV2 D;  1EQZ A;  2NQB B;  4YM6 D;  3B6G C;  5B32 B;  4ZBJ B;  3O62 C;  3EPJ A;  3X1T A;  3KXB C;  3W98 C;  2NZD A;  3MVD A;  5B40 A;  3X1V B;  3LEL A;  1BH9 B;  4KUD A;  3W96 D;  3AN2 B;  1ZLA D;  1N1J B;  3UTB B;  1S32 B;  3NQJ B;  4UPK A;  1P3A B;  4M6B A;  4XUJ B;  1F66 B;  3WKJ C;  5AVC B;  1P3I B;  1KX5 B;  2JCH A;  2ARO B;  5CPI B;  2UWX A;  4H9Q B;  1JFI B;  5DNM C;  3AZM B;  3AZN D;  2NZD C;  5CPK C;  4YM6 C;  3REI C;  5AV8 A;  1KX3 A;  1M19 A;  4NE6 A;  3REL A;  5B1M D;  3UTA B;  4H9R A;  5CP6 A;  3WA9 C;  5F99 B;  3W96 C;  3KUY D;  3P5J B;  5B2I B;  1ZLA C;  5BNX B;  3EPH A;  2BYM B;  3A6N D;  4YS3 A;  1P3G D;  4Z66 D;  5BO0 A;  2CWE A;  4KGC D;  3WAA A;  1P3L B;  1B6W A;  3AYW D;  1M19 C;  2NQB A;  2DF4 C;  3WTP B;  4EO5 B;  4WU9 D;  3AZN C;  5B32 A;  5JRG D;  5CP6 C;  3MGQ D;  4H9N B;  5AV5 B;  3X1V A;  1BH9 A;  2J8P A;  3AN2 A;  5B1M C;  1N1J A;  4J8X C;  3UTB A;  5B32 G;  3NQJ A;  5B0Z D;  3VH6 W;  1P3A A;  1F66 A;  3AV1 C;  2Y2M A;  5G49 B;  2G5H C;  3KUY C;  1P3I A;  4NE3 A;  1P3M B;  5B2J B;  1HQ3 B;  5AV6 D;  1KX4 B;  5BS7 C;  5GT3 B;  5CPI A;  2F8N K;  4H9Q A;  1JFI A;  3AZM A;  2Y2H A;  3AZF B;  3WTP E;  5GSU D;  4WU9 C;  3MGR D;  1P3F B;  2ZM5 A;  5AY8 A;  5JRG C;  3MGQ C;  2Y2I A;  3UTA A;  3AZH A;  1ULY A;  4R8P D;  1WWS A;  2F8N H;  2PYO B;  5B2I A;  5BNX A;  2BYM A;  2DQN C;  3B6G B;  3VH5 T;  3O62 B;  2RVQ C;  3KXB B;  3KWQ D;  3W98 B;  5AV6 C;  2ZY3 A;  3WTP A;  5AY8 C;  5AV9 C;  2ZY2 A;  2FJ7 C;  2G5I C;  3AZH C;  3AL0 C;  1P34 A;  3AZJ D;  5JA4 A;  5GSU C;  3A1K A;  4H9N A;  5AV5 A;  4Z5T A;  4Z2M G;  1P3P D;  3MGP C;  4R8P C;  5DNM B;  5G49 A;  3AZK D;  4G92 C;  5GXQ D;  2NZD B;  3MVD B;  3KSY A;  5CPK B;  5E5A A;  5B2J A;  1HQ3 A;  4YM6 B;  1Q9C A;  4ZUX D;  5GT3 A;  3REI B;  1P3K D;  1KX4 A;  1U35 A;  1P34 C;  5FUG A;  3AZF A;  4Z5T C;  3WA9 B;  3AZI D;  2CV5 D;  2F2A C;  3W96 B;  1P3F A;  1ZLA B;  5DNN D;  3AZJ C;  3AZL D;  1P3O D;  3UT9 C;  5E5A C;  3REH D;  2PYO A;  1M19 B;  3AZG A;  1U35 C;  1P3P C;  3B6F D;  4J8V D;  3REL B;  3AZN B;  4G91 C;  3B6G A;  2LY8 A;  3O62 A;  5GT0 D;  5CP6 B;  3KXB A;  3W98 A;  3MGS D;  4ZUX C;  1PZR A;  4H9S C;  1P3K C;  2L5A A;  2XD5 A;  3C1C D;  4J8X B;  3REJ C;  5BO0 B;  3AZI C;  3AV1 B;  3WKJ A;  3LJA D;  3KUY B;  3AZG C;  4LD9 D;  4JJN C;  5KDM A;  2XD1 A;  4J8U C;  3W97 A;  3AZL C;  4J8W D;  4WV4 B;  5CPJ D;  2Y2J A;  5DNM A;  3REH C;  2Y2G A;  1M1A D;  5B33 D;  5CPK A;  5CHL B;  2ZY5 A;  3AV2 A;  3B6F C;  4YM6 A;  4J8V C;  3REI A;  1ID3 D;  2HIO D;  5JRG B;  3C1B D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...