1HQ3D

Crystal structure of the histone-core-octamer in kcl/phosphate
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
83
structure length
83
Chain Sequence
KVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HISTONE H2A-IV
publication title Structure of the histone-core octamer in KCl/phosphate crystals at 2.15 A resolution.
pubmed doi rcsb
molecule tags Dna binding protein
total genus 24
structure length 83
sequence length 83
chains with identical sequence H
ec nomenclature
pdb deposition date 2000-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1hq3D00
1BFMA 3MVDA 5B33C 3AV2C 1P34C 4HGAB 2PYOA 5GSUC 3MVDC 5B2IA 4UUZB 4H9PA 4XUJA 5KDMB 2PYOC 4KGCD 5B2IC 3C1BD 5B2JD 4XUJC 3AV1D 5BNVA 5AV6B 1M1AA 3LZ0A 1M19B 1M1AC 3X1VA 1M18A 3NQUB 3REJB 3AN2D 4KHAB 3X1VC 3X1SA 3AZLA 1M18C 5B31B 3MGPB 3X1UA 3V9RB 4ZBJB 3AZLC 3X1SC 1P3BD 4R8PD 1U35A 3MNND 3X1UC 5DNMA 1KX5A 1U35C 5AVBB 5CPKD 2FJ7B 5AVCB 1Q9CA 3WA9B 5B40A 1KX5C 5B1LD 5B40C 3AZIA 3AZGA 3W97D 4YM6B 3AV2B 1P34B 3AZIC 1A7WA 3AZGC 3MVDB 4EO5C 5B0YA 3WKJA 5F99A 2PYOB 1F1EA 1ULYA 5B2IB 4H9PB 5CP6D 5B0YC 3WKJC 4XUJB 3REKD 5F99C 4CSRA 3RELA 3REID 5BNVB 1P3FA 1M1AB 3RELC 3O62A 3C1CD 3LZ0B 1P3PA 3AZNB 5B31D 4QLCA 1P3FC 3X1VB 1M18B 3O62C 3AZKA 1P3PC 4M6BA 4QLCC 3AYWD 3AZLB 2HUEC 5CPJD 1P3MD 4LD9A 3AZKC 3B0BA 5AVBD 4J8WB 5AVCD 3X1UB 3W98A 4LD9C 4Z5TD 1KX3A 3W98C 5DNMB 5E5AD 5B33D 1AOIA 3WTPE 1P34D 5B40B 5GSUD 1ZLAD 3MVDD 1AOIC 1P34A 3AZIB 3AZEA 3AZGB 2PYOD 4EO5B 3B6GA 3MGRA 4WV4B 3MGQA 5B2ID 4WU8A 3AZEC 3B6GC 3MGRC 3MGQC 4WU8C 3WKJB 5F99B 5AY8B 3AZMA 2AROB 3B6FA 1JFIA 3AZMC 3RELB 2HIOA 2NZDA 2F8NH 4H9RA 3B6FC 3AZHA 1P3FB 2NZDC 3X1SD 3O62B 3AZLD 5GT3A 1P3PB 5GXQB 4NE5A 2NQBA 1M19A 2F8NK 4QLCB 3NQUA 2HUEB 5GT3C 4YS3B 1U35D 2NQBC 3UTBA 1M19C 5BT1C 2LY8A 3REHA 1KX5D 1N1JA 2BYKA 3UTBC 5AV8A 5B40D 3W98B 4J8VA 3REHC 1P3GD 1KX3B 1S32A 5AV8C 4J8VC 3UT9A 1EQZD 1S32C 3KXBA 1AOIB 2FJ7C 3UT9C 4G92B 3KXBC 4DRAA 5B0YD 1P3LA 4J8XA 3AZEB 3WKJD 5F99D 3MGRB 3MGQB 4WU8B 1P3LC 4J8XC 4YM6C 4Z66A 5BO0A 4NE6A 1KU5A 4ZUXB 4WU9B 5B0ZB 3AZMB 3KWQA 4H9OA 4NFTA 3O62D 2F8NB 3B6FB 1P3PD 1JFIB 2CV5A 3TU4A 3AZJD 2HIOB 4QLCD 3KWQC 2NZDB 4H9RB 3AZKD 2CV5C 3UTAA 3TU4C 3AZHB 1KX4A 3AZNA 5GT3B 5GT0B 4LD9D 2NQBB 3UTAC 1KX4C 3NQJA 3MGSD 5DNNB 1TAFB 4NE3A 3LZ0C 3AZNC 3UTBB 3REHB 1TZYA 1N1JB 5B24B 2BYKB 4J8WA 4Z2MH 5BNXA 5AV8B 3WTPD 1P3OA 4J8VB 4X23D 5G49B 1HQ3A 1TZYC 4J8WC 1S32B 1BH8B 3R45A 5B32A 1P3OC 3AZED 5B32G 3UT9B 1HQ3C 1BH9B 3KXBB 3MGRD 3MGQD 5B32C 3B6GD 5DNMC 4WU8D 4J8UA 5AV5A 1P3LB 4J8XB 4J8UC 5AV5C 3AZMD 3B6FD 4Z66B 5BO0B 5AY8A 2NZDD 5AV6D 3X1TA 2AROA 2YFVA 4H9OB 5AY8C 3KWQB 1R4VA 4JJNA 5GT3D 2CV5B 3TU4B 1M19D 3X1TC 2AROC 4WNNA 4KUDA 3REJD 4JJNC 3UTAB 1KX4B 2RVQD 3AFAA 4KUDC 5GXQA 3REHD 5JRGA 3MGPD 3NQJB 3AFAC 4YS3A 5GXQC 4J8VD 5JRGC 1S32D 4YS3C 1F66A 1TZYB 2FJ7D 3UT9D 3WA9D 5BNXB 1P3OB 1F66C 1HQ3B 5B32B 3R45B 4XZQA 1KX3C 1B67A 4YM6D 3AV2D 4XZQC 4J8UB 5AV5B 4H9NA 3AV1A 4G92C 1ID3A 4XUJD 3KWQD 3WAAA 3AV1C 3W96A 1ID3C 2CV5D 1HTAA 4ZUXA 4WU9A 3WAAC 5B0ZA 2L5AA 4G91C 3W96C 3AN2A 1M1AD 3X1TB 4ZUXC 2YFVB 4WU9C 2F8NA 4E44A 5B0ZC 3LZ0D 4JJNB 3AZND 3AN2C 2F8NG 1H3OA 3VH6A 3X1VD 1M18D 4WNNB 4KUDB 3MNNA 3LJAB 2HIOC 1P3IA 3AFAB 3VH6T 5GT0A 5AV9A 5JRGB 3MNNC 3AZHC 4J8WD 3X1UD 1P3IC 5DNNA 1TAFA 1P3OD 5GT0C 5AV9C 3B0DB 1WWSA 3LELB 1HQ3D 2BYMB 5B32D 5DNNC 5DNMD 5B24A 1F66B 3W97A 5CPIB 3AZFA 1P3AB 3LZ1A 5G49A 3VH6W 5B24C 1BH8A 3W97C 5AV5D 3AZFC 4XZQB 3W99A 3LZ1C 3AZID 3AZGD 1BH9A 3W99C 3REKA 4H9NB 5B2JB 3REKC 5AY8D 3AV1B 3REIA 1ID3B 3X1TD 2AROD 3WAAB 4G91B 4JJND 3REIC 3W96B 3RELD 4KUDD 4Z66C 3AN2B 1P3FD 5CPJA 3AFAD 1P3MA 5GXQD 5JRGD 1H3OB 5CPJC 1P3MC 4YS3D 3MNNB 1P3IB 5E5AA 5AV9B 3KUYA 3W98D 5GSUA 1B6WA 1KX3D 1ZLAA 2YFWA 5B1LB 4XZQD 3KUYC 1ZLAC 4Z2MG 3W97B 1AOID 3AZFB 2JSSA 3LZ1B 2IO5C 4E45A 3W99B 4CAYA 5CP6B 1ID3D 3REKB 3WAAD 3W96D 4ZUXD 4WU9D 5B0ZD 3REIB 1WWIA 3C1CB 2F8ND 4H9QA 1P3KA 2HIOD 3A6NA 1P3KC 3AZHD 3AYWB 1P3ID 5CPJB 1P3MB 5AV9D 5GT0D 3A6NC 2NQBD 5BT1D 5DNND 4Z5TB 1P3GA 3LJAA 5JA4A 3UTBD 5E5AB 1P3GC 5B24D 1EQZA 3LJAC 5B33B 3AZFD 5AV8D 3KUYB 3LZ1D 3LELA 5GSUB 1EQZC 1ZLAB 2YFWB 2BYMA 5B1MA 3W99D 2IO5B 3B0DC 3LELC 5CPIA 3KXBD 5B1MC 1P3AA 3VH5A 5CPIC 1P3AC 5C3IC 1P3LD 4J8XD 3VH5T 4CAYB 4KGCA 3C1BA 4Z66D 4AWLC 5B2JA 3AZJA 5CHLB 4KGCC 3C1BC 5B2JC 5FUGA 3AZJC 3X1SB 4H9QB 3VH5W 3TU4D 1P3KB 3MGSA 3AV2A 1U35B 3A6NB 3UTAD 1KX4D 3MGSC 1KX5B 1P3BA 3WTPA 4R8PA 3KUYD 4X23A 1P3GB 5JA4B 2CWEA 1P3BC 3WTPC 4R8PC 4X23C 5CPKA 1TZYD 1EQZB 4DRBA 5CPKC 5B1LA 5B1MB 5B0YB 3KSYA 4WZSB 4UUZA 5B1LC 5C3IB 4HGAC 5KDMA 4J8UD 4CSRB 3B0CT 4H9SA 5CP6A 5AV6A 4AWLB 4KGCB 3C1BB 4H9SC 5CP6C 5AV6C 1P3KD 3AZJB 3REJA 3AZKB 3A6ND 3B0CW 4KHAA 5FUGB 5BS7A 3C1CA 3REJC 4LD9B 5B31A 3MGPA 3V9RA 2RVQC 3MGSB 5BS7C 5B31G 3C1CC 5B31C 3LJAD 3MGPC 3AYWA 4ZBJC 5AVBA 2FJ7A 5AVCA 3WA9A 3AYWC 1P3BB 3WTPB 4R8PB 4Z5TA 4X23B 5AVBC 3LELD 5AVCC 3WA9C 5B1MD 4Z5TC 5CPKB 5B33A 1F66D 3B6GB 5CPID 4YM6A 1P3AD 5E5AC
chains in the Genus database with same CATH superfamily
2XD1A 1BFMA 3MVDA 5B33C 3AV2C 1P34C 4HGAB 2PYOA 5GSUC 3MVDC 5B2IA 4UUZB 4H9PA 4XUJA 5KDMB 2PYOC 4KGCD 5B2IC 3C1BD 3H0LC 5B2JD 4XUJC 3AV1D 5BNVA 5AV6B 1M1AA 2Y2QA 3LZ0A 1M19B 1M1AC 3X1VA 1M18A 3NQUB 3REJB 3AN2D 4UPKA 4KHAB 3X1VC 2RIQA 3X1SA 3AZLA 1M18C 5B31B 3MGPB 3X1UA 3V9RB 4ZBJB 3AZLC 3X1SC 1P3BD 4R8PD 1U35A 3MNND 3X1UC 5DNMA 1KX5A 1U35C 5AVBB 5CPKD 2FJ7B 5AVCB 1Q9CA 3WA9B 5B40A 1KX5C 5B1LD 5B40C 3AZIA 3AZGA 3W97D 4YM6B 3AV2B 1P34B 3AZIC 1A7WA 3AZGC 3MVDB 4EO5C 5B0YA 3WKJA 5F99A 2PYOB 1F1EA 1ULYA 5B2IB 4H9PB 5CP6D 5B0YC 3WKJC 4XUJB 3REKD 5F99C 4CSRA 3RELA 3REID 5BNVB 1P3FA 1M1AB 3RELC 3O62A 3C1CD 3LZ0B 1P3PA 3AZNB 5B31D 4QLCA 1P3FC 3X1VB 1M18B 3O62C 3AZKA 1P3PC 4M6BA 4QLCC 3AYWD 3AZLB 2HUEC 5CPJD 1P3MD 4LD9A 3AZKC 3B0BA 5AVBD 4J8WB 5AVCD 3X1UB 3W98A 4LD9C 4Z5TD 1KX3A 3W98C 5DNMB 5E5AD 5B33D 1AOIA 3WTPE 1P34D 5B40B 5GSUD 1ZLAD 3MVDD 1AOIC 1P34A 3AZIB 3AZEA 3AZGB 2PYOD 4EO5B 3B6GA 3MGRA 4WV4B 3MGQA 5B2ID 4WU8A 3AZEC 3B6GC 3MGRC 3MGQC 4WU8C 3WKJB 5F99B 5AY8B 3AZMA 2AROB 3B6FA 3H0MC 1JFIA 3AZMC 3RELB 2HIOA 2NZDA 2F8NH 4H9RA 2Y2HA 3B6FC 3AZHA 1P3FB 2NZDC 3X1SD 3O62B 3AZLD 5GT3A 1P3PB 5GXQB 4NE5A 2NQBA 1M19A 2F8NK 4QLCB 3NQUA 2HUEB 5GT3C 4YS3B 1U35D 2NQBC 3UTBA 1M19C 5BT1C 2LY8A 3REHA 1KX5D 1N1JA 2BYKA 3UTBC 3EPJA 5AV8A 5B40D 3W98B 4J8VA 3REHC 1P3GD 1KX3B 1S32A 5AV8C 4J8VC 3UT9A 1EQZD 1S32C 3KXBA 1AOIB 2UWXA 2Y2IA 2Y2LA 2FJ7C 3UT9C 4G92B 3KXBC 4DRAA 5B0YD 1P3LA 4J8XA 3AZEB 3WKJD 3FDDA 5F99D 3MGRB 3MGQB 4WU8B 1P3LC 4J8XC 4YM6C 3A1KA 5BO0A 4Z66A 4NE6A 1KU5A 4ZUXB 4WU9B 5B0ZB 3AZMB 3KWQA 4H9OA 4NFTA 3O62D 2F8NB 3B6FB 1P3PD 1JFIB 2CV5A 2G5HC 3TU4A 3AZJD 2HIOB 4QLCD 3KWQC 2NZDB 4H9RB 3AZKD 2CV5C 3UTAA 3TU4C 3AZHB 1KX4A 3AZNA 5GT3B 5GT0B 4LD9D 3KFUG 2NQBB 3UTAC 1KX4C 3A1IA 3NQJA 3MGSD 5DNNB 1TAFB 4NE3A 3LZ0C 3AZNC 3P5JB 3UTBB 3REHB 1TZYA 1N1JB 5B24B 2BYKB 4J8WA 4Z2MH 5BNXA 5AV8B 3WTPD 1P3OA 4J8VB 4X23D 5G49B 1HQ3A 1TZYC 4J8WC 1S32B 1BH8B 3R45A 5B32A 1P3OC 3AZED 5B32G 3UT9B 1HQ3C 1BH9B 3KXBB 3MGRD 3MGQD 5B32C 3B6GD 5DNMC 4WU8D 2DQNC 4J8UA 5AV5A 1P3LB 4J8XB 4J8UC 5AV5C 3AZMD 2Y2MA 3B6FD 4Z66B 5BO0B 5AY8A 2NZDD 5AV6D 3X1TA 2AROA 2YFVA 4H9OB 5AY8C 3KWQB 2ZM5A 1R4VA 4JJNA 5GT3D 2CV5B 3TU4B 1M19D 2XD5A 2AROC 4WNNA 3X1TC 1W2EA 4KUDA 3REJD 4JJNC 3UTAB 1KX4B 2RVQD 3AFAA 4KUDC 5GXQA 3REHD 5JRGA 3MGPD 2G5IC 3NQJB 3AFAC 4YS3A 5GXQC 4J8VD 5JRGC 1S32D 3H0RC 4YS3C 4DQYB 1F66A 1TZYB 2FJ7D 3UT9D 4WJ3C 3WA9D 5BNXB 1P3OB 1F66C 1PZRA 1HQ3B 5B32B 3R45B 4XZQA 1KX3C 1B67A 4YM6D 3AV2D 4XZQC 4J8UB 5AV5B 2Y2KA 4H9NA 3AV1A 4G92C 1ID3A 4XUJD 3KWQD 3WAAA 3AV1C 2Y2OA 3W96A 3EPHA 1ID3C 2CV5D 1HTAA 4ZUXA 4WU9A 3WAAC 5B0ZA 2L5AA 4G91C 3W96C 3AN2A 2ZY4A 1M1AD 3X1TB 4ZUXC 2YFVB 4WU9C 2F8NA 4E44A 5B0ZC 3LZ0D 4JJNB 3AZND 3AN2C 2F8NG 1H3OA 3VH6A 3X1VD 1M18D 4WNNB 4KUDB 3MNNA 3LJAB 3EPLA 2HIOC 1P3IA 3AFAB 3VH6T 5GT0A 5AV9A 5JRGB 3MNNC 3AZHC 4J8WD 3X1UD 1P3IC 5DNNA 1TAFA 1P3OD 5GT0C 5AV9C 3B0DB 1WWSA 3LELB 1HQ3D 2BYMB 5B32D 5DNNC 5DNMD 5B24A 1F66B 3W97A 5CPIB 2ZY5A 3AZFA 1P3AB 3LZ1A 5G49A 3VH6W 5B24C 1BH8A 3W97C 5AV5D 3AZFC 4XZQB 3W99A 3LZ1C 3AZID 3AZGD 1BH9A 2Y2GA 3W99C 3REKA 1T3UA 4H9NB 5B2JB 3REKC 5AY8D 3AV1B 3REIA 1ID3B 2Y2JA 3X1TD 2AROD 3WAAB 4G91B 4JJND 3REIC 3W96B 3RELD 2ZY3A 4KUDD 2JE5A 4Z66C 3AN2B 2F2AC 1P3FD 5CPJA 2BG1A 3AFAD 2Y2NA 1P3MA 5GXQD 5JRGD 1H3OB 5CPJC 1P3MC 4YS3D 3MNNB 1P3IB 5E5AA 5AV9B 3KUYA 3W98D 2DF4C 5GSUA 1B6WA 1KX3D 1ZLAA 2YFWA 5B1LB 4XZQD 3KUYC 1ZLAC 4Z2MG 3W97B 1AOID 3AZFB 2JSSA 3LZ1B 2IO5C 4E45A 3W99B 4CAYA 5CP6B 1ID3D 3REKB 3WAAD 3W96D 4ZUXD 4WU9D 5B0ZD 2ZY2A 3REIB 1WWIA 3C1CB 2F8ND 4H9QA 1P3KA 2HIOD 3A6NA 1P3KC 3AZHD 3AYWB 1P3ID 5CPJB 1P3MB 5AV9D 5GT0D 3A6NC 2NQBD 5BT1D 2J8PA 5DNND 4Z5TB 1P3GA 3LJAA 5JA4A 3UTBD 5E5AB 1P3GC 5B24D 1EQZA 3LJAC 5B33B 3AZFD 5AV8D 3KUYB 3LZ1D 3LELA 5GSUB 1EQZC 1ZLAB 2YFWB 2BYMA 5B1MA 3W99D 2IO5B 3B0DC 3LELC 5CPIA 3AL0C 3KXBD 5B1MC 1P3AA 2VQRA 3VH5A 5CPIC 1P3AC 5C3IC 1P3LD 4J8XD 3VH5T 4CAYB 4KGCA 3C1BA 4Z66D 4AWLC 5B2JA 3AZJA 5CHLB 4KGCC 3C1BC 3F6TA 5B2JC 5FUGA 3AZJC 3X1SB 2JCHA 4H9QB 3VH5W 3TU4D 1P3KB 3MGSA 3AV2A 3EG5B 3A6NB 1U35B 3UTAD 1KX4D 3MGSC 1KX5B 1P3BA 3WTPA 4R8PA 3KUYD 4X23A 1P3GB 5JA4B 2CWEA 1P3BC 3WTPC 4R8PC 4X23C 5CPKA 1TZYD 1EQZB 4DRBA 5CPKC 5B1LA 5B1MB 5B0YB 3KSYA 4WZSB 4UUZA 5B1LC 5C3IB 4HGAC 5KDMA 4J8UD 4CSRB 3B0CT 4H9SA 1Z2CB 5CP6A 5AV6A 4AWLB 2Y2PA 4KGCB 3C1BB 4H9SC 5CP6C 5AV6C 1P3KD 3AZJB 3REJA 3AZKB 3A6ND 3B0CW 4KHAA 5FUGB 5BS7A 3C1CA 3REJC 4LD9B 5B31A 3MGPA 3V9RA 2RVQC 2W8SA 5BS7C 5B31G 3MGSB 3C1CC 5B31C 3IP4C 3LJAD 3MGPC 3AYWA 3EPKA 4ZBJC 5AVBA 2FJ7A 5AVCA 3WA9A 3AYWC 1P3BB 3WTPB 4R8PB 4Z5TA 4X23B 5AVBC 3LELD 5AVCC 3WA9C 5B1MD 4Z5TC 5CPKB 2FFFB 5B33A 1F66D 3B6GB 5CPID 4YM6A 1P3AD 5E5AC
chains in the Genus database with same CATH topology
2XD1A 1BFMA 3MVDA 5B33C 3AV2C 1P34C 4HGAB 2PYOA 5GSUC 3MVDC 5B2IA 4UUZB 4H9PA 4XUJA 5KDMB 2PYOC 4KGCD 5B2IC 3C1BD 3H0LC 5B2JD 4XUJC 3AV1D 5BNVA 5AV6B 1M1AA 2Y2QA 3LZ0A 1M19B 1M1AC 3X1VA 1M18A 3NQUB 3REJB 3AN2D 4UPKA 4KHAB 3X1VC 2RIQA 3X1SA 3AZLA 1M18C 5B31B 3MGPB 3X1UA 3V9RB 4ZBJB 3AZLC 3X1SC 1P3BD 4R8PD 1U35A 3MNND 3X1UC 5DNMA 1KX5A 1U35C 5AVBB 5CPKD 2FJ7B 5AVCB 1Q9CA 3WA9B 5B40A 1KX5C 5B1LD 5B40C 3AZIA 3AZGA 3W97D 4YM6B 3AV2B 1P34B 3AZIC 1A7WA 3AZGC 3MVDB 4EO5C 5B0YA 3WKJA 5F99A 2PYOB 1F1EA 1ULYA 5B2IB 4H9PB 5CP6D 5B0YC 3WKJC 4XUJB 3REKD 5F99C 4CSRA 3RELA 3REID 5BNVB 1P3FA 1M1AB 3RELC 3O62A 3C1CD 3LZ0B 1P3PA 3AZNB 5B31D 4QLCA 1P3FC 3X1VB 1M18B 3O62C 3AZKA 1P3PC 4M6BA 4QLCC 3AYWD 3AZLB 2HUEC 5CPJD 1P3MD 4LD9A 3AZKC 3B0BA 5AVBD 4J8WB 5AVCD 3X1UB 3W98A 4LD9C 4Z5TD 1KX3A 3W98C 5DNMB 5E5AD 5B33D 1AOIA 3WTPE 1P34D 5B40B 5GSUD 1ZLAD 3MVDD 1AOIC 1P34A 3AZIB 3AZEA 3AZGB 2PYOD 4EO5B 3B6GA 3MGRA 4WV4B 3MGQA 5B2ID 4WU8A 3AZEC 3B6GC 3MGRC 3MGQC 4WU8C 3WKJB 5F99B 5AY8B 3AZMA 2AROB 3B6FA 3H0MC 1JFIA 3AZMC 3RELB 2HIOA 2NZDA 2F8NH 4H9RA 2Y2HA 3B6FC 3AZHA 1P3FB 2NZDC 3X1SD 3O62B 3AZLD 5GT3A 1P3PB 5GXQB 4NE5A 2NQBA 1M19A 2F8NK 4QLCB 3NQUA 2HUEB 5GT3C 4YS3B 1U35D 2NQBC 3UTBA 1M19C 5BT1C 2LY8A 3REHA 1KX5D 1N1JA 2BYKA 3UTBC 3EPJA 5AV8A 5B40D 3W98B 4J8VA 3REHC 1P3GD 1KX3B 1S32A 5AV8C 4J8VC 3UT9A 1EQZD 1S32C 3KXBA 1AOIB 2UWXA 2Y2IA 2Y2LA 2FJ7C 3UT9C 4G92B 3KXBC 4DRAA 5B0YD 1P3LA 4J8XA 3AZEB 3WKJD 3FDDA 5F99D 3MGRB 3MGQB 4WU8B 1P3LC 4J8XC 4YM6C 3A1KA 5BO0A 4Z66A 4NE6A 1KU5A 4ZUXB 4WU9B 5B0ZB 3AZMB 3KWQA 4H9OA 4NFTA 3O62D 2F8NB 3B6FB 1P3PD 1JFIB 2CV5A 2G5HC 3TU4A 3AZJD 2HIOB 4QLCD 3KWQC 2NZDB 4H9RB 3AZKD 2CV5C 3UTAA 3TU4C 3AZHB 1KX4A 3AZNA 5GT3B 5GT0B 4LD9D 3KFUG 2NQBB 3UTAC 1KX4C 3A1IA 3NQJA 3MGSD 5DNNB 1TAFB 4NE3A 3LZ0C 3AZNC 3P5JB 3UTBB 3REHB 1TZYA 1N1JB 5B24B 2BYKB 4J8WA 4Z2MH 5BNXA 5AV8B 3WTPD 1P3OA 4J8VB 4X23D 5G49B 1HQ3A 1TZYC 4J8WC 1S32B 1BH8B 3R45A 5B32A 1P3OC 3AZED 5B32G 3UT9B 1HQ3C 1BH9B 3KXBB 3MGRD 3MGQD 5B32C 3B6GD 5DNMC 4WU8D 2DQNC 4J8UA 5AV5A 1P3LB 4J8XB 4J8UC 5AV5C 3AZMD 2Y2MA 3B6FD 4Z66B 5BO0B 5AY8A 2NZDD 5AV6D 3X1TA 2AROA 2YFVA 4H9OB 5AY8C 3KWQB 2ZM5A 1R4VA 4JJNA 5GT3D 2CV5B 3TU4B 1M19D 2XD5A 2AROC 4WNNA 3X1TC 1W2EA 4KUDA 3REJD 4JJNC 3UTAB 1KX4B 2RVQD 3AFAA 4KUDC 5GXQA 3REHD 5JRGA 3MGPD 2G5IC 3NQJB 3AFAC 4YS3A 5GXQC 4J8VD 5JRGC 1S32D 3H0RC 4YS3C 4DQYB 1F66A 1TZYB 2FJ7D 3UT9D 4WJ3C 3WA9D 5BNXB 1P3OB 1F66C 1PZRA 1HQ3B 5B32B 3R45B 4XZQA 1KX3C 1B67A 4YM6D 3AV2D 4XZQC 4J8UB 5AV5B 2Y2KA 4H9NA 3AV1A 4G92C 1ID3A 4XUJD 3KWQD 3WAAA 3AV1C 2Y2OA 3W96A 3EPHA 1ID3C 2CV5D 1HTAA 4ZUXA 4WU9A 3WAAC 5B0ZA 2L5AA 4G91C 3W96C 3AN2A 2ZY4A 1M1AD 3X1TB 4ZUXC 2YFVB 4WU9C 2F8NA 4E44A 5B0ZC 3LZ0D 4JJNB 3AZND 3AN2C 2F8NG 1H3OA 3VH6A 3X1VD 1M18D 4WNNB 4KUDB 3MNNA 3LJAB 3EPLA 2HIOC 1P3IA 3AFAB 3VH6T 5GT0A 5AV9A 5JRGB 3MNNC 3AZHC 4J8WD 3X1UD 1P3IC 5DNNA 1TAFA 1P3OD 5GT0C 5AV9C 3B0DB 1WWSA 3LELB 1HQ3D 2BYMB 5B32D 5DNNC 5DNMD 5B24A 1F66B 3W97A 5CPIB 2ZY5A 3AZFA 1P3AB 3LZ1A 5G49A 3VH6W 5B24C 1BH8A 3W97C 5AV5D 3AZFC 4XZQB 3W99A 3LZ1C 3AZID 3AZGD 1BH9A 2Y2GA 3W99C 3REKA 1T3UA 4H9NB 5B2JB 3REKC 5AY8D 3AV1B 3REIA 1ID3B 2Y2JA 3X1TD 2AROD 3WAAB 4G91B 4JJND 3REIC 3W96B 3RELD 2ZY3A 4KUDD 2JE5A 4Z66C 3AN2B 2F2AC 1P3FD 5CPJA 2BG1A 3AFAD 2Y2NA 1P3MA 5GXQD 5JRGD 1H3OB 5CPJC 1P3MC 4YS3D 3MNNB 1P3IB 5E5AA 5AV9B 3KUYA 3W98D 2DF4C 5GSUA 1B6WA 1KX3D 1ZLAA 2YFWA 5B1LB 4XZQD 3KUYC 1ZLAC 4Z2MG 3W97B 1AOID 3AZFB 2JSSA 3LZ1B 2IO5C 4E45A 3W99B 4CAYA 5CP6B 1ID3D 3REKB 3WAAD 3W96D 4ZUXD 4WU9D 5B0ZD 2ZY2A 3REIB 1WWIA 3C1CB 2F8ND 4H9QA 1P3KA 2HIOD 3A6NA 1P3KC 3AZHD 3AYWB 1P3ID 5CPJB 1P3MB 5AV9D 5GT0D 3A6NC 2NQBD 5BT1D 2J8PA 5DNND 4Z5TB 1P3GA 3LJAA 5JA4A 3UTBD 5E5AB 1P3GC 5B24D 1EQZA 3LJAC 5B33B 3AZFD 5AV8D 3KUYB 3LZ1D 3LELA 5GSUB 1EQZC 1ZLAB 2YFWB 2BYMA 5B1MA 3W99D 2IO5B 3B0DC 3LELC 5CPIA 3AL0C 3KXBD 5B1MC 1P3AA 2VQRA 3VH5A 5CPIC 1P3AC 5C3IC 1P3LD 4J8XD 3VH5T 4CAYB 4KGCA 3C1BA 4Z66D 4AWLC 5B2JA 3AZJA 5CHLB 4KGCC 3C1BC 3F6TA 5B2JC 5FUGA 3AZJC 3X1SB 2JCHA 4H9QB 3VH5W 3TU4D 1P3KB 3MGSA 3AV2A 3EG5B 3A6NB 1U35B 3UTAD 1KX4D 3MGSC 1KX5B 1P3BA 3WTPA 4R8PA 3KUYD 4X23A 1P3GB 5JA4B 2CWEA 1P3BC 3WTPC 4R8PC 4X23C 5CPKA 1TZYD 1EQZB 4DRBA 5CPKC 5B1LA 5B1MB 5B0YB 3KSYA 4WZSB 4UUZA 5B1LC 5C3IB 4HGAC 5KDMA 4J8UD 4CSRB 3B0CT 4H9SA 1Z2CB 5CP6A 5AV6A 4AWLB 2Y2PA 4KGCB 3C1BB 4H9SC 5CP6C 5AV6C 1P3KD 3AZJB 3REJA 3AZKB 3A6ND 3B0CW 4KHAA 5FUGB 5BS7A 3C1CA 3REJC 4LD9B 5B31A 3MGPA 3V9RA 2RVQC 2W8SA 5BS7C 5B31G 3MGSB 3C1CC 5B31C 3IP4C 3LJAD 3MGPC 3AYWA 3EPKA 4ZBJC 5AVBA 2FJ7A 5AVCA 3WA9A 3AYWC 1P3BB 3WTPB 4R8PB 4Z5TA 4X23B 5AVBC 3LELD 5AVCC 3WA9C 5B1MD 4Z5TC 5CPKB 2FFFB 5B33A 1F66D 3B6GB 5CPID 4YM6A 1P3AD 5E5AC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BFM A;  3MVD A;  5B33 C;  3AV2 C;  1P34 C;  4HGA B;  2PYO A;  5GSU C;  3MVD C;  5B2I A;  4UUZ B;  4H9P A;  4XUJ A;  5KDM B;  2PYO C;  4KGC D;  5B2I C;  3C1B D;  5B2J D;  4XUJ C;  3AV1 D;  5BNV A;  5AV6 B;  1M1A A;  3LZ0 A;  1M19 B;  1M1A C;  3X1V A;  1M18 A;  3NQU B;  3REJ B;  3AN2 D;  4KHA B;  3X1V C;  3X1S A;  3AZL A;  1M18 C;  5B31 B;  3MGP B;  3X1U A;  3V9R B;  4ZBJ B;  3AZL C;  3X1S C;  1P3B D;  4R8P D;  1U35 A;  3MNN D;  3X1U C;  5DNM A;  1KX5 A;  1U35 C;  5AVB B;  5CPK D;  2FJ7 B;  5AVC B;  1Q9C A;  3WA9 B;  5B40 A;  1KX5 C;  5B1L D;  5B40 C;  3AZI A;  3AZG A;  3W97 D;  4YM6 B;  3AV2 B;  1P34 B;  3AZI C;  1A7W A;  3AZG C;  3MVD B;  4EO5 C;  5B0Y A;  3WKJ A;  5F99 A;  2PYO B;  1F1E A;  1ULY A;  5B2I B;  4H9P B;  5CP6 D;  5B0Y C;  3WKJ C;  4XUJ B;  3REK D;  5F99 C;  4CSR A;  3REL A;  3REI D;  5BNV B;  1P3F A;  1M1A B;  3REL C;  3O62 A;  3C1C D;  3LZ0 B;  1P3P A;  3AZN B;  5B31 D;  4QLC A;  1P3F C;  3X1V B;  1M18 B;  3O62 C;  3AZK A;  1P3P C;  4M6B A;  4QLC C;  3AYW D;  3AZL B;  2HUE C;  5CPJ D;  1P3M D;  4LD9 A;  3AZK C;  3B0B A;  5AVB D;  4J8W B;  5AVC D;  3X1U B;  3W98 A;  4LD9 C;  4Z5T D;  1KX3 A;  3W98 C;  5DNM B;  5E5A D;  5B33 D;  1AOI A;  3WTP E;  1P34 D;  5B40 B;  5GSU D;  1ZLA D;  3MVD D;  1AOI C;  1P34 A;  3AZI B;  3AZE A;  3AZG B;  2PYO D;  4EO5 B;  3B6G A;  3MGR A;  4WV4 B;  3MGQ A;  5B2I D;  4WU8 A;  3AZE C;  3B6G C;  3MGR C;  3MGQ C;  4WU8 C;  3WKJ B;  5F99 B;  5AY8 B;  3AZM A;  2ARO B;  3B6F A;  1JFI A;  3AZM C;  3REL B;  2HIO A;  2NZD A;  2F8N H;  4H9R A;  3B6F C;  3AZH A;  1P3F B;  2NZD C;  3X1S D;  3O62 B;  3AZL D;  5GT3 A;  1P3P B;  5GXQ B;  4NE5 A;  2NQB A;  1M19 A;  2F8N K;  4QLC B;  3NQU A;  2HUE B;  5GT3 C;  4YS3 B;  1U35 D;  2NQB C;  3UTB A;  1M19 C;  5BT1 C;  2LY8 A;  3REH A;  1KX5 D;  1N1J A;  2BYK A;  3UTB C;  5AV8 A;  5B40 D;  3W98 B;  4J8V A;  3REH C;  1P3G D;  1KX3 B;  1S32 A;  5AV8 C;  4J8V C;  3UT9 A;  1EQZ D;  1S32 C;  3KXB A;  1AOI B;  2FJ7 C;  3UT9 C;  4G92 B;  3KXB C;  4DRA A;  5B0Y D;  1P3L A;  4J8X A;  3AZE B;  3WKJ D;  5F99 D;  3MGR B;  3MGQ B;  4WU8 B;  1P3L C;  4J8X C;  4YM6 C;  4Z66 A;  5BO0 A;  4NE6 A;  1KU5 A;  4ZUX B;  4WU9 B;  5B0Z B;  3AZM B;  3KWQ A;  4H9O A;  4NFT A;  3O62 D;  2F8N B;  3B6F B;  1P3P D;  1JFI B;  2CV5 A;  3TU4 A;  3AZJ D;  2HIO B;  4QLC D;  3KWQ C;  2NZD B;  4H9R B;  3AZK D;  2CV5 C;  3UTA A;  3TU4 C;  3AZH B;  1KX4 A;  3AZN A;  5GT3 B;  5GT0 B;  4LD9 D;  2NQB B;  3UTA C;  1KX4 C;  3NQJ A;  3MGS D;  5DNN B;  1TAF B;  4NE3 A;  3LZ0 C;  3AZN C;  3UTB B;  3REH B;  1TZY A;  1N1J B;  5B24 B;  2BYK B;  4J8W A;  4Z2M H;  5BNX A;  5AV8 B;  3WTP D;  1P3O A;  4J8V B;  4X23 D;  5G49 B;  1HQ3 A;  1TZY C;  4J8W C;  1S32 B;  1BH8 B;  3R45 A;  5B32 A;  1P3O C;  3AZE D;  5B32 G;  3UT9 B;  1HQ3 C;  1BH9 B;  3KXB B;  3MGR D;  3MGQ D;  5B32 C;  3B6G D;  5DNM C;  4WU8 D;  4J8U A;  5AV5 A;  1P3L B;  4J8X B;  4J8U C;  5AV5 C;  3AZM D;  3B6F D;  4Z66 B;  5BO0 B;  5AY8 A;  2NZD D;  5AV6 D;  3X1T A;  2ARO A;  2YFV A;  4H9O B;  5AY8 C;  3KWQ B;  1R4V A;  4JJN A;  5GT3 D;  2CV5 B;  3TU4 B;  1M19 D;  3X1T C;  2ARO C;  4WNN A;  4KUD A;  3REJ D;  4JJN C;  3UTA B;  1KX4 B;  2RVQ D;  3AFA A;  4KUD C;  5GXQ A;  3REH D;  5JRG A;  3MGP D;  3NQJ B;  3AFA C;  4YS3 A;  5GXQ C;  4J8V D;  5JRG C;  1S32 D;  4YS3 C;  1F66 A;  1TZY B;  2FJ7 D;  3UT9 D;  3WA9 D;  5BNX B;  1P3O B;  1F66 C;  1HQ3 B;  5B32 B;  3R45 B;  4XZQ A;  1KX3 C;  1B67 A;  4YM6 D;  3AV2 D;  4XZQ C;  4J8U B;  5AV5 B;  4H9N A;  3AV1 A;  4G92 C;  1ID3 A;  4XUJ D;  3KWQ D;  3WAA A;  3AV1 C;  3W96 A;  1ID3 C;  2CV5 D;  1HTA A;  4ZUX A;  4WU9 A;  3WAA C;  5B0Z A;  2L5A A;  4G91 C;  3W96 C;  3AN2 A;  1M1A D;  3X1T B;  4ZUX C;  2YFV B;  4WU9 C;  2F8N A;  4E44 A;  5B0Z C;  3LZ0 D;  4JJN B;  3AZN D;  3AN2 C;  2F8N G;  1H3O A;  3VH6 A;  3X1V D;  1M18 D;  4WNN B;  4KUD B;  3MNN A;  3LJA B;  2HIO C;  1P3I A;  3AFA B;  3VH6 T;  5GT0 A;  5AV9 A;  5JRG B;  3MNN C;  3AZH C;  4J8W D;  3X1U D;  1P3I C;  5DNN A;  1TAF A;  1P3O D;  5GT0 C;  5AV9 C;  3B0D B;  1WWS A;  3LEL B;  1HQ3 D;  2BYM B;  5B32 D;  5DNN C;  5DNM D;  5B24 A;  1F66 B;  3W97 A;  5CPI B;  3AZF A;  1P3A B;  3LZ1 A;  5G49 A;  3VH6 W;  5B24 C;  1BH8 A;  3W97 C;  5AV5 D;  3AZF C;  4XZQ B;  3W99 A;  3LZ1 C;  3AZI D;  3AZG D;  1BH9 A;  3W99 C;  3REK A;  4H9N B;  5B2J B;  3REK C;  5AY8 D;  3AV1 B;  3REI A;  1ID3 B;  3X1T D;  2ARO D;  3WAA B;  4G91 B;  4JJN D;  3REI C;  3W96 B;  3REL D;  4KUD D;  4Z66 C;  3AN2 B;  1P3F D;  5CPJ A;  3AFA D;  1P3M A;  5GXQ D;  5JRG D;  1H3O B;  5CPJ C;  1P3M C;  4YS3 D;  3MNN B;  1P3I B;  5E5A A;  5AV9 B;  3KUY A;  3W98 D;  5GSU A;  1B6W A;  1KX3 D;  1ZLA A;  2YFW A;  5B1L B;  4XZQ D;  3KUY C;  1ZLA C;  4Z2M G;  3W97 B;  1AOI D;  3AZF B;  2JSS A;  3LZ1 B;  2IO5 C;  4E45 A;  3W99 B;  4CAY A;  5CP6 B;  1ID3 D;  3REK B;  3WAA D;  3W96 D;  4ZUX D;  4WU9 D;  5B0Z D;  3REI B;  1WWI A;  3C1C B;  2F8N D;  4H9Q A;  1P3K A;  2HIO D;  3A6N A;  1P3K C;  3AZH D;  3AYW B;  1P3I D;  5CPJ B;  1P3M B;  5AV9 D;  5GT0 D;  3A6N C;  2NQB D;  5BT1 D;  5DNN D;  4Z5T B;  1P3G A;  3LJA A;  5JA4 A;  3UTB D;  5E5A B;  1P3G C;  5B24 D;  1EQZ A;  3LJA C;  5B33 B;  3AZF D;  5AV8 D;  3KUY B;  3LZ1 D;  3LEL A;  5GSU B;  1EQZ C;  1ZLA B;  2YFW B;  2BYM A;  5B1M A;  3W99 D;  2IO5 B;  3B0D C;  3LEL C;  5CPI A;  3KXB D;  5B1M C;  1P3A A;  3VH5 A;  5CPI C;  1P3A C;  5C3I C;  1P3L D;  4J8X D;  3VH5 T;  4CAY B;  4KGC A;  3C1B A;  4Z66 D;  4AWL C;  5B2J A;  3AZJ A;  5CHL B;  4KGC C;  3C1B C;  5B2J C;  5FUG A;  3AZJ C;  3X1S B;  4H9Q B;  3VH5 W;  3TU4 D;  1P3K B;  3MGS A;  3AV2 A;  1U35 B;  3A6N B;  3UTA D;  1KX4 D;  3MGS C;  1KX5 B;  1P3B A;  3WTP A;  4R8P A;  3KUY D;  4X23 A;  1P3G B;  5JA4 B;  2CWE A;  1P3B C;  3WTP C;  4R8P C;  4X23 C;  5CPK A;  1TZY D;  1EQZ B;  4DRB A;  5CPK C;  5B1L A;  5B1M B;  5B0Y B;  3KSY A;  4WZS B;  4UUZ A;  5B1L C;  5C3I B;  4HGA C;  5KDM A;  4J8U D;  4CSR B;  3B0C T;  4H9S A;  5CP6 A;  5AV6 A;  4AWL B;  4KGC B;  3C1B B;  4H9S C;  5CP6 C;  5AV6 C;  1P3K D;  3AZJ B;  3REJ A;  3AZK B;  3A6N D;  3B0C W;  4KHA A;  5FUG B;  5BS7 A;  3C1C A;  3REJ C;  4LD9 B;  5B31 A;  3MGP A;  3V9R A;  2RVQ C;  3MGS B;  5BS7 C;  5B31 G;  3C1C C;  5B31 C;  3LJA D;  3MGP C;  3AYW A;  4ZBJ C;  5AVB A;  2FJ7 A;  5AVC A;  3WA9 A;  3AYW C;  1P3B B;  3WTP B;  4R8P B;  4Z5T A;  4X23 B;  5AVB C;  3LEL D;  5AVC C;  3WA9 C;  5B1M D;  4Z5T C;  5CPK B;  5B33 A;  1F66 D;  3B6G B;  5CPI D;  4YM6 A;  1P3A D;  5E5A C; 
#chains in the Genus database with same CATH topology
 2XD1 A;  1BFM A;  3MVD A;  5B33 C;  3AV2 C;  1P34 C;  4HGA B;  2PYO A;  5GSU C;  3MVD C;  5B2I A;  4UUZ B;  4H9P A;  4XUJ A;  5KDM B;  2PYO C;  4KGC D;  5B2I C;  3C1B D;  3H0L C;  5B2J D;  4XUJ C;  3AV1 D;  5BNV A;  5AV6 B;  1M1A A;  2Y2Q A;  3LZ0 A;  1M19 B;  1M1A C;  3X1V A;  1M18 A;  3NQU B;  3REJ B;  3AN2 D;  4UPK A;  4KHA B;  3X1V C;  2RIQ A;  3X1S A;  3AZL A;  1M18 C;  5B31 B;  3MGP B;  3X1U A;  3V9R B;  4ZBJ B;  3AZL C;  3X1S C;  1P3B D;  4R8P D;  1U35 A;  3MNN D;  3X1U C;  5DNM A;  1KX5 A;  1U35 C;  5AVB B;  5CPK D;  2FJ7 B;  5AVC B;  1Q9C A;  3WA9 B;  5B40 A;  1KX5 C;  5B1L D;  5B40 C;  3AZI A;  3AZG A;  3W97 D;  4YM6 B;  3AV2 B;  1P34 B;  3AZI C;  1A7W A;  3AZG C;  3MVD B;  4EO5 C;  5B0Y A;  3WKJ A;  5F99 A;  2PYO B;  1F1E A;  1ULY A;  5B2I B;  4H9P B;  5CP6 D;  5B0Y C;  3WKJ C;  4XUJ B;  3REK D;  5F99 C;  4CSR A;  3REL A;  3REI D;  5BNV B;  1P3F A;  1M1A B;  3REL C;  3O62 A;  3C1C D;  3LZ0 B;  1P3P A;  3AZN B;  5B31 D;  4QLC A;  1P3F C;  3X1V B;  1M18 B;  3O62 C;  3AZK A;  1P3P C;  4M6B A;  4QLC C;  3AYW D;  3AZL B;  2HUE C;  5CPJ D;  1P3M D;  4LD9 A;  3AZK C;  3B0B A;  5AVB D;  4J8W B;  5AVC D;  3X1U B;  3W98 A;  4LD9 C;  4Z5T D;  1KX3 A;  3W98 C;  5DNM B;  5E5A D;  5B33 D;  1AOI A;  3WTP E;  1P34 D;  5B40 B;  5GSU D;  1ZLA D;  3MVD D;  1AOI C;  1P34 A;  3AZI B;  3AZE A;  3AZG B;  2PYO D;  4EO5 B;  3B6G A;  3MGR A;  4WV4 B;  3MGQ A;  5B2I D;  4WU8 A;  3AZE C;  3B6G C;  3MGR C;  3MGQ C;  4WU8 C;  3WKJ B;  5F99 B;  5AY8 B;  3AZM A;  2ARO B;  3B6F A;  3H0M C;  1JFI A;  3AZM C;  3REL B;  2HIO A;  2NZD A;  2F8N H;  4H9R A;  2Y2H A;  3B6F C;  3AZH A;  1P3F B;  2NZD C;  3X1S D;  3O62 B;  3AZL D;  5GT3 A;  1P3P B;  5GXQ B;  4NE5 A;  2NQB A;  1M19 A;  2F8N K;  4QLC B;  3NQU A;  2HUE B;  5GT3 C;  4YS3 B;  1U35 D;  2NQB C;  3UTB A;  1M19 C;  5BT1 C;  2LY8 A;  3REH A;  1KX5 D;  1N1J A;  2BYK A;  3UTB C;  3EPJ A;  5AV8 A;  5B40 D;  3W98 B;  4J8V A;  3REH C;  1P3G D;  1KX3 B;  1S32 A;  5AV8 C;  4J8V C;  3UT9 A;  1EQZ D;  1S32 C;  3KXB A;  1AOI B;  2UWX A;  2Y2I A;  2Y2L A;  2FJ7 C;  3UT9 C;  4G92 B;  3KXB C;  4DRA A;  5B0Y D;  1P3L A;  4J8X A;  3AZE B;  3WKJ D;  3FDD A;  5F99 D;  3MGR B;  3MGQ B;  4WU8 B;  1P3L C;  4J8X C;  4YM6 C;  3A1K A;  5BO0 A;  4Z66 A;  4NE6 A;  1KU5 A;  4ZUX B;  4WU9 B;  5B0Z B;  3AZM B;  3KWQ A;  4H9O A;  4NFT A;  3O62 D;  2F8N B;  3B6F B;  1P3P D;  1JFI B;  2CV5 A;  2G5H C;  3TU4 A;  3AZJ D;  2HIO B;  4QLC D;  3KWQ C;  2NZD B;  4H9R B;  3AZK D;  2CV5 C;  3UTA A;  3TU4 C;  3AZH B;  1KX4 A;  3AZN A;  5GT3 B;  5GT0 B;  4LD9 D;  3KFU G;  2NQB B;  3UTA C;  1KX4 C;  3A1I A;  3NQJ A;  3MGS D;  5DNN B;  1TAF B;  4NE3 A;  3LZ0 C;  3AZN C;  3P5J B;  3UTB B;  3REH B;  1TZY A;  1N1J B;  5B24 B;  2BYK B;  4J8W A;  4Z2M H;  5BNX A;  5AV8 B;  3WTP D;  1P3O A;  4J8V B;  4X23 D;  5G49 B;  1HQ3 A;  1TZY C;  4J8W C;  1S32 B;  1BH8 B;  3R45 A;  5B32 A;  1P3O C;  3AZE D;  5B32 G;  3UT9 B;  1HQ3 C;  1BH9 B;  3KXB B;  3MGR D;  3MGQ D;  5B32 C;  3B6G D;  5DNM C;  4WU8 D;  2DQN C;  4J8U A;  5AV5 A;  1P3L B;  4J8X B;  4J8U C;  5AV5 C;  3AZM D;  2Y2M A;  3B6F D;  4Z66 B;  5BO0 B;  5AY8 A;  2NZD D;  5AV6 D;  3X1T A;  2ARO A;  2YFV A;  4H9O B;  5AY8 C;  3KWQ B;  2ZM5 A;  1R4V A;  4JJN A;  5GT3 D;  2CV5 B;  3TU4 B;  1M19 D;  2XD5 A;  2ARO C;  4WNN A;  3X1T C;  1W2E A;  4KUD A;  3REJ D;  4JJN C;  3UTA B;  1KX4 B;  2RVQ D;  3AFA A;  4KUD C;  5GXQ A;  3REH D;  5JRG A;  3MGP D;  2G5I C;  3NQJ B;  3AFA C;  4YS3 A;  5GXQ C;  4J8V D;  5JRG C;  1S32 D;  3H0R C;  4YS3 C;  4DQY B;  1F66 A;  1TZY B;  2FJ7 D;  3UT9 D;  4WJ3 C;  3WA9 D;  5BNX B;  1P3O B;  1F66 C;  1PZR A;  1HQ3 B;  5B32 B;  3R45 B;  4XZQ A;  1KX3 C;  1B67 A;  4YM6 D;  3AV2 D;  4XZQ C;  4J8U B;  5AV5 B;  2Y2K A;  4H9N A;  3AV1 A;  4G92 C;  1ID3 A;  4XUJ D;  3KWQ D;  3WAA A;  3AV1 C;  2Y2O A;  3W96 A;  3EPH A;  1ID3 C;  2CV5 D;  1HTA A;  4ZUX A;  4WU9 A;  3WAA C;  5B0Z A;  2L5A A;  4G91 C;  3W96 C;  3AN2 A;  2ZY4 A;  1M1A D;  3X1T B;  4ZUX C;  2YFV B;  4WU9 C;  2F8N A;  4E44 A;  5B0Z C;  3LZ0 D;  4JJN B;  3AZN D;  3AN2 C;  2F8N G;  1H3O A;  3VH6 A;  3X1V D;  1M18 D;  4WNN B;  4KUD B;  3MNN A;  3LJA B;  3EPL A;  2HIO C;  1P3I A;  3AFA B;  3VH6 T;  5GT0 A;  5AV9 A;  5JRG B;  3MNN C;  3AZH C;  4J8W D;  3X1U D;  1P3I C;  5DNN A;  1TAF A;  1P3O D;  5GT0 C;  5AV9 C;  3B0D B;  1WWS A;  3LEL B;  1HQ3 D;  2BYM B;  5B32 D;  5DNN C;  5DNM D;  5B24 A;  1F66 B;  3W97 A;  5CPI B;  2ZY5 A;  3AZF A;  1P3A B;  3LZ1 A;  5G49 A;  3VH6 W;  5B24 C;  1BH8 A;  3W97 C;  5AV5 D;  3AZF C;  4XZQ B;  3W99 A;  3LZ1 C;  3AZI D;  3AZG D;  1BH9 A;  2Y2G A;  3W99 C;  3REK A;  1T3U A;  4H9N B;  5B2J B;  3REK C;  5AY8 D;  3AV1 B;  3REI A;  1ID3 B;  2Y2J A;  3X1T D;  2ARO D;  3WAA B;  4G91 B;  4JJN D;  3REI C;  3W96 B;  3REL D;  2ZY3 A;  4KUD D;  2JE5 A;  4Z66 C;  3AN2 B;  2F2A C;  1P3F D;  5CPJ A;  2BG1 A;  3AFA D;  2Y2N A;  1P3M A;  5GXQ D;  5JRG D;  1H3O B;  5CPJ C;  1P3M C;  4YS3 D;  3MNN B;  1P3I B;  5E5A A;  5AV9 B;  3KUY A;  3W98 D;  2DF4 C;  5GSU A;  1B6W A;  1KX3 D;  1ZLA A;  2YFW A;  5B1L B;  4XZQ D;  3KUY C;  1ZLA C;  4Z2M G;  3W97 B;  1AOI D;  3AZF B;  2JSS A;  3LZ1 B;  2IO5 C;  4E45 A;  3W99 B;  4CAY A;  5CP6 B;  1ID3 D;  3REK B;  3WAA D;  3W96 D;  4ZUX D;  4WU9 D;  5B0Z D;  2ZY2 A;  3REI B;  1WWI A;  3C1C B;  2F8N D;  4H9Q A;  1P3K A;  2HIO D;  3A6N A;  1P3K C;  3AZH D;  3AYW B;  1P3I D;  5CPJ B;  1P3M B;  5AV9 D;  5GT0 D;  3A6N C;  2NQB D;  5BT1 D;  2J8P A;  5DNN D;  4Z5T B;  1P3G A;  3LJA A;  5JA4 A;  3UTB D;  5E5A B;  1P3G C;  5B24 D;  1EQZ A;  3LJA C;  5B33 B;  3AZF D;  5AV8 D;  3KUY B;  3LZ1 D;  3LEL A;  5GSU B;  1EQZ C;  1ZLA B;  2YFW B;  2BYM A;  5B1M A;  3W99 D;  2IO5 B;  3B0D C;  3LEL C;  5CPI A;  3AL0 C;  3KXB D;  5B1M C;  1P3A A;  2VQR A;  3VH5 A;  5CPI C;  1P3A C;  5C3I C;  1P3L D;  4J8X D;  3VH5 T;  4CAY B;  4KGC A;  3C1B A;  4Z66 D;  4AWL C;  5B2J A;  3AZJ A;  5CHL B;  4KGC C;  3C1B C;  3F6T A;  5B2J C;  5FUG A;  3AZJ C;  3X1S B;  2JCH A;  4H9Q B;  3VH5 W;  3TU4 D;  1P3K B;  3MGS A;  3AV2 A;  3EG5 B;  3A6N B;  1U35 B;  3UTA D;  1KX4 D;  3MGS C;  1KX5 B;  1P3B A;  3WTP A;  4R8P A;  3KUY D;  4X23 A;  1P3G B;  5JA4 B;  2CWE A;  1P3B C;  3WTP C;  4R8P C;  4X23 C;  5CPK A;  1TZY D;  1EQZ B;  4DRB A;  5CPK C;  5B1L A;  5B1M B;  5B0Y B;  3KSY A;  4WZS B;  4UUZ A;  5B1L C;  5C3I B;  4HGA C;  5KDM A;  4J8U D;  4CSR B;  3B0C T;  4H9S A;  1Z2C B;  5CP6 A;  5AV6 A;  4AWL B;  2Y2P A;  4KGC B;  3C1B B;  4H9S C;  5CP6 C;  5AV6 C;  1P3K D;  3AZJ B;  3REJ A;  3AZK B;  3A6N D;  3B0C W;  4KHA A;  5FUG B;  5BS7 A;  3C1C A;  3REJ C;  4LD9 B;  5B31 A;  3MGP A;  3V9R A;  2RVQ C;  2W8S A;  5BS7 C;  5B31 G;  3MGS B;  3C1C C;  5B31 C;  3IP4 C;  3LJA D;  3MGP C;  3AYW A;  3EPK A;  4ZBJ C;  5AVB A;  2FJ7 A;  5AVC A;  3WA9 A;  3AYW C;  1P3B B;  3WTP B;  4R8P B;  4Z5T A;  4X23 B;  5AVB C;  3LEL D;  5AVC C;  3WA9 C;  5B1M D;  4Z5T C;  5CPK B;  2FFF B;  5B33 A;  1F66 D;  3B6G B;  5CPI D;  4YM6 A;  1P3A D;  5E5A C; 
#chains in the Genus database with same CATH homology
 2XD1 A;  1BFM A;  3MVD A;  5B33 C;  3AV2 C;  1P34 C;  4HGA B;  2PYO A;  5GSU C;  3MVD C;  5B2I A;  4UUZ B;  4H9P A;  4XUJ A;  5KDM B;  2PYO C;  4KGC D;  5B2I C;  3C1B D;  3H0L C;  5B2J D;  4XUJ C;  3AV1 D;  5BNV A;  5AV6 B;  1M1A A;  2Y2Q A;  3LZ0 A;  1M19 B;  1M1A C;  3X1V A;  1M18 A;  3NQU B;  3REJ B;  3AN2 D;  4UPK A;  4KHA B;  3X1V C;  2RIQ A;  3X1S A;  3AZL A;  1M18 C;  5B31 B;  3MGP B;  3X1U A;  3V9R B;  4ZBJ B;  3AZL C;  3X1S C;  1P3B D;  4R8P D;  1U35 A;  3MNN D;  3X1U C;  5DNM A;  1KX5 A;  1U35 C;  5AVB B;  5CPK D;  2FJ7 B;  5AVC B;  1Q9C A;  3WA9 B;  5B40 A;  1KX5 C;  5B1L D;  5B40 C;  3AZI A;  3AZG A;  3W97 D;  4YM6 B;  3AV2 B;  1P34 B;  3AZI C;  1A7W A;  3AZG C;  3MVD B;  4EO5 C;  5B0Y A;  3WKJ A;  5F99 A;  2PYO B;  1F1E A;  1ULY A;  5B2I B;  4H9P B;  5CP6 D;  5B0Y C;  3WKJ C;  4XUJ B;  3REK D;  5F99 C;  4CSR A;  3REL A;  3REI D;  5BNV B;  1P3F A;  1M1A B;  3REL C;  3O62 A;  3C1C D;  3LZ0 B;  1P3P A;  3AZN B;  5B31 D;  4QLC A;  1P3F C;  3X1V B;  1M18 B;  3O62 C;  3AZK A;  1P3P C;  4M6B A;  4QLC C;  3AYW D;  3AZL B;  2HUE C;  5CPJ D;  1P3M D;  4LD9 A;  3AZK C;  3B0B A;  5AVB D;  4J8W B;  5AVC D;  3X1U B;  3W98 A;  4LD9 C;  4Z5T D;  1KX3 A;  3W98 C;  5DNM B;  5E5A D;  5B33 D;  1AOI A;  3WTP E;  1P34 D;  5B40 B;  5GSU D;  1ZLA D;  3MVD D;  1AOI C;  1P34 A;  3AZI B;  3AZE A;  3AZG B;  2PYO D;  4EO5 B;  3B6G A;  3MGR A;  4WV4 B;  3MGQ A;  5B2I D;  4WU8 A;  3AZE C;  3B6G C;  3MGR C;  3MGQ C;  4WU8 C;  3WKJ B;  5F99 B;  5AY8 B;  3AZM A;  2ARO B;  3B6F A;  3H0M C;  1JFI A;  3AZM C;  3REL B;  2HIO A;  2NZD A;  2F8N H;  4H9R A;  2Y2H A;  3B6F C;  3AZH A;  1P3F B;  2NZD C;  3X1S D;  3O62 B;  3AZL D;  5GT3 A;  1P3P B;  5GXQ B;  4NE5 A;  2NQB A;  1M19 A;  2F8N K;  4QLC B;  3NQU A;  2HUE B;  5GT3 C;  4YS3 B;  1U35 D;  2NQB C;  3UTB A;  1M19 C;  5BT1 C;  2LY8 A;  3REH A;  1KX5 D;  1N1J A;  2BYK A;  3UTB C;  3EPJ A;  5AV8 A;  5B40 D;  3W98 B;  4J8V A;  3REH C;  1P3G D;  1KX3 B;  1S32 A;  5AV8 C;  4J8V C;  3UT9 A;  1EQZ D;  1S32 C;  3KXB A;  1AOI B;  2UWX A;  2Y2I A;  2Y2L A;  2FJ7 C;  3UT9 C;  4G92 B;  3KXB C;  4DRA A;  5B0Y D;  1P3L A;  4J8X A;  3AZE B;  3WKJ D;  3FDD A;  5F99 D;  3MGR B;  3MGQ B;  4WU8 B;  1P3L C;  4J8X C;  4YM6 C;  3A1K A;  5BO0 A;  4Z66 A;  4NE6 A;  1KU5 A;  4ZUX B;  4WU9 B;  5B0Z B;  3AZM B;  3KWQ A;  4H9O A;  4NFT A;  3O62 D;  2F8N B;  3B6F B;  1P3P D;  1JFI B;  2CV5 A;  2G5H C;  3TU4 A;  3AZJ D;  2HIO B;  4QLC D;  3KWQ C;  2NZD B;  4H9R B;  3AZK D;  2CV5 C;  3UTA A;  3TU4 C;  3AZH B;  1KX4 A;  3AZN A;  5GT3 B;  5GT0 B;  4LD9 D;  3KFU G;  2NQB B;  3UTA C;  1KX4 C;  3A1I A;  3NQJ A;  3MGS D;  5DNN B;  1TAF B;  4NE3 A;  3LZ0 C;  3AZN C;  3P5J B;  3UTB B;  3REH B;  1TZY A;  1N1J B;  5B24 B;  2BYK B;  4J8W A;  4Z2M H;  5BNX A;  5AV8 B;  3WTP D;  1P3O A;  4J8V B;  4X23 D;  5G49 B;  1HQ3 A;  1TZY C;  4J8W C;  1S32 B;  1BH8 B;  3R45 A;  5B32 A;  1P3O C;  3AZE D;  5B32 G;  3UT9 B;  1HQ3 C;  1BH9 B;  3KXB B;  3MGR D;  3MGQ D;  5B32 C;  3B6G D;  5DNM C;  4WU8 D;  2DQN C;  4J8U A;  5AV5 A;  1P3L B;  4J8X B;  4J8U C;  5AV5 C;  3AZM D;  2Y2M A;  3B6F D;  4Z66 B;  5BO0 B;  5AY8 A;  2NZD D;  5AV6 D;  3X1T A;  2ARO A;  2YFV A;  4H9O B;  5AY8 C;  3KWQ B;  2ZM5 A;  1R4V A;  4JJN A;  5GT3 D;  2CV5 B;  3TU4 B;  1M19 D;  2XD5 A;  2ARO C;  4WNN A;  3X1T C;  1W2E A;  4KUD A;  3REJ D;  4JJN C;  3UTA B;  1KX4 B;  2RVQ D;  3AFA A;  4KUD C;  5GXQ A;  3REH D;  5JRG A;  3MGP D;  2G5I C;  3NQJ B;  3AFA C;  4YS3 A;  5GXQ C;  4J8V D;  5JRG C;  1S32 D;  3H0R C;  4YS3 C;  4DQY B;  1F66 A;  1TZY B;  2FJ7 D;  3UT9 D;  4WJ3 C;  3WA9 D;  5BNX B;  1P3O B;  1F66 C;  1PZR A;  1HQ3 B;  5B32 B;  3R45 B;  4XZQ A;  1KX3 C;  1B67 A;  4YM6 D;  3AV2 D;  4XZQ C;  4J8U B;  5AV5 B;  2Y2K A;  4H9N A;  3AV1 A;  4G92 C;  1ID3 A;  4XUJ D;  3KWQ D;  3WAA A;  3AV1 C;  2Y2O A;  3W96 A;  3EPH A;  1ID3 C;  2CV5 D;  1HTA A;  4ZUX A;  4WU9 A;  3WAA C;  5B0Z A;  2L5A A;  4G91 C;  3W96 C;  3AN2 A;  2ZY4 A;  1M1A D;  3X1T B;  4ZUX C;  2YFV B;  4WU9 C;  2F8N A;  4E44 A;  5B0Z C;  3LZ0 D;  4JJN B;  3AZN D;  3AN2 C;  2F8N G;  1H3O A;  3VH6 A;  3X1V D;  1M18 D;  4WNN B;  4KUD B;  3MNN A;  3LJA B;  3EPL A;  2HIO C;  1P3I A;  3AFA B;  3VH6 T;  5GT0 A;  5AV9 A;  5JRG B;  3MNN C;  3AZH C;  4J8W D;  3X1U D;  1P3I C;  5DNN A;  1TAF A;  1P3O D;  5GT0 C;  5AV9 C;  3B0D B;  1WWS A;  3LEL B;  1HQ3 D;  2BYM B;  5B32 D;  5DNN C;  5DNM D;  5B24 A;  1F66 B;  3W97 A;  5CPI B;  2ZY5 A;  3AZF A;  1P3A B;  3LZ1 A;  5G49 A;  3VH6 W;  5B24 C;  1BH8 A;  3W97 C;  5AV5 D;  3AZF C;  4XZQ B;  3W99 A;  3LZ1 C;  3AZI D;  3AZG D;  1BH9 A;  2Y2G A;  3W99 C;  3REK A;  1T3U A;  4H9N B;  5B2J B;  3REK C;  5AY8 D;  3AV1 B;  3REI A;  1ID3 B;  2Y2J A;  3X1T D;  2ARO D;  3WAA B;  4G91 B;  4JJN D;  3REI C;  3W96 B;  3REL D;  2ZY3 A;  4KUD D;  2JE5 A;  4Z66 C;  3AN2 B;  2F2A C;  1P3F D;  5CPJ A;  2BG1 A;  3AFA D;  2Y2N A;  1P3M A;  5GXQ D;  5JRG D;  1H3O B;  5CPJ C;  1P3M C;  4YS3 D;  3MNN B;  1P3I B;  5E5A A;  5AV9 B;  3KUY A;  3W98 D;  2DF4 C;  5GSU A;  1B6W A;  1KX3 D;  1ZLA A;  2YFW A;  5B1L B;  4XZQ D;  3KUY C;  1ZLA C;  4Z2M G;  3W97 B;  1AOI D;  3AZF B;  2JSS A;  3LZ1 B;  2IO5 C;  4E45 A;  3W99 B;  4CAY A;  5CP6 B;  1ID3 D;  3REK B;  3WAA D;  3W96 D;  4ZUX D;  4WU9 D;  5B0Z D;  2ZY2 A;  3REI B;  1WWI A;  3C1C B;  2F8N D;  4H9Q A;  1P3K A;  2HIO D;  3A6N A;  1P3K C;  3AZH D;  3AYW B;  1P3I D;  5CPJ B;  1P3M B;  5AV9 D;  5GT0 D;  3A6N C;  2NQB D;  5BT1 D;  2J8P A;  5DNN D;  4Z5T B;  1P3G A;  3LJA A;  5JA4 A;  3UTB D;  5E5A B;  1P3G C;  5B24 D;  1EQZ A;  3LJA C;  5B33 B;  3AZF D;  5AV8 D;  3KUY B;  3LZ1 D;  3LEL A;  5GSU B;  1EQZ C;  1ZLA B;  2YFW B;  2BYM A;  5B1M A;  3W99 D;  2IO5 B;  3B0D C;  3LEL C;  5CPI A;  3AL0 C;  3KXB D;  5B1M C;  1P3A A;  2VQR A;  3VH5 A;  5CPI C;  1P3A C;  5C3I C;  1P3L D;  4J8X D;  3VH5 T;  4CAY B;  4KGC A;  3C1B A;  4Z66 D;  4AWL C;  5B2J A;  3AZJ A;  5CHL B;  4KGC C;  3C1B C;  3F6T A;  5B2J C;  5FUG A;  3AZJ C;  3X1S B;  2JCH A;  4H9Q B;  3VH5 W;  3TU4 D;  1P3K B;  3MGS A;  3AV2 A;  3EG5 B;  3A6N B;  1U35 B;  3UTA D;  1KX4 D;  3MGS C;  1KX5 B;  1P3B A;  3WTP A;  4R8P A;  3KUY D;  4X23 A;  1P3G B;  5JA4 B;  2CWE A;  1P3B C;  3WTP C;  4R8P C;  4X23 C;  5CPK A;  1TZY D;  1EQZ B;  4DRB A;  5CPK C;  5B1L A;  5B1M B;  5B0Y B;  3KSY A;  4WZS B;  4UUZ A;  5B1L C;  5C3I B;  4HGA C;  5KDM A;  4J8U D;  4CSR B;  3B0C T;  4H9S A;  1Z2C B;  5CP6 A;  5AV6 A;  4AWL B;  2Y2P A;  4KGC B;  3C1B B;  4H9S C;  5CP6 C;  5AV6 C;  1P3K D;  3AZJ B;  3REJ A;  3AZK B;  3A6N D;  3B0C W;  4KHA A;  5FUG B;  5BS7 A;  3C1C A;  3REJ C;  4LD9 B;  5B31 A;  3MGP A;  3V9R A;  2RVQ C;  2W8S A;  5BS7 C;  5B31 G;  3MGS B;  3C1C C;  5B31 C;  3IP4 C;  3LJA D;  3MGP C;  3AYW A;  3EPK A;  4ZBJ C;  5AVB A;  2FJ7 A;  5AVC A;  3WA9 A;  3AYW C;  1P3B B;  3WTP B;  4R8P B;  4Z5T A;  4X23 B;  5AVB C;  3LEL D;  5AVC C;  3WA9 C;  5B1M D;  4Z5T C;  5CPK B;  2FFF B;  5B33 A;  1F66 D;  3B6G B;  5CPI D;  4YM6 A;  1P3A D;  5E5A C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...