1HQEA

Human immunodeficiency virus type 1
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
554
structure length
554
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Lys103Asn mutation of HIV-1 RT: a novel mechanism of drug resistance.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords POL POLYPROTEIN
total genus 135
structure length 554
sequence length 554
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2000-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1hqeA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1hqeA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1hqeA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1hqeA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1hqeA05
1HMVB 2E9TA 1VSHA 4AHRA 4F2RA 4LD0A 5KFPA 4K4VA 5SWMA 4LSNB 4HTUA 1QSSA 4CGHA 4QWEA 1S0MA 5F8JA 5KFGA 4W5OA 1L3SA 1TKXB 5KFUA 3TVKA 1I3AA 1JLEA 3HK2A 5KFDA 5E41A 4RNOA 2AU0A 3K59A 2Z1IA 5HBMA 4C8KA 2KZZA 4RU9A 1RT4A 4ID5A 5KRSA 3UQSA 4LQ3A 5KFKA 3SV4A 3DYAB 4F2SA 3JYTA 4PUOA 3H2LA 4DTNA 2Y1JA 1L5UA 1FKPA 1RCHA 3KLVA 4IDKB 2UVUA 2KFNA 3H98A 3SUOA 3KKRA 1HNVA 2OPPB 3KHLA 4CJKA 1BL3A 2OPPA 4IFVB 4DSKA 1SH3A 3C94A 1ZBFA 3WNEA 1S1WB 4YMEA 2BANB 1HQEA 4BACA 1A5WA 4B3OB 5KT3A 3KHGA 3L2QA 1VSIA 3Q8QB 1REVB 3L2UA 3UPFA 2R2UA 5DQHA 2I5JA 3A2FA 1X1PA 4PWDB 3M8RA 1FKOA 3G6VA 2G8FA 4AHSA 4N5SA 2HMIB 2OH2A 3M9OB 3MEGB 3CDWA 4EBEA 4WZMA 4J2DA 2WRMA 3IRXB 3NMAA 4O3RA 1RBUA 3WNHA 4M3RA 5C25A 1U04A 4HCCA 3M8PB 3P1GA 3V6JA 3DLKB 1L3UA 4NYFA 5J2QA 1RT6B 1SUQB 5KFHA 4UQGA 1JXEA 4J2EA 5KG1A 3ULDA 1LWEB 3M8SA 1JLQA 1J9AA 1VRTA 3PR5B 3AA5X 1S1TA 2GUIA 1Q8IA 2F8EX 4FZXC 4Z4EA 1JL2A 2IJNA 4B9NA 2HNZB 1N56A 3BSCA 5KTQA 3FRZA 4FLVA 3JSMA 2P5OA 3MECB 1C1BB 1S6QB 4N56A 4IFYB 1S1UA 4M3YA 3S3MA 4ZVEA 3I0SA 2IM1A 3UIQA 2W9BB 1XR5A 4CFDA 3V9WA 4IH5A 1HMVA 4KBIA 4I2PA 1ASWA 4QCLA 4N76A 4FLZA 2R2RA 2RPIA 1Q9YA 2FBXA 3CJ4A 4MH8A 5HLFA 3HPHA 2NUBA 4GC6A 4CJSA 3KLHB 2XGQA 3T5JA 1U09A 3AA2A 3KOAA 4KTWA 4J2BA 1JLFB 2XWYA 1B92A 2RDJA 2YNIA 4ZPDA 4CJLA 4K8XA 4RW7B 4Q8FA 2YNIB 2D7SA 3H5YA 4M3ZA 1TQLA 1WSFA 3NDKA 4HHTA 3TAEA 2HAIA 3Q8SB 2E6MA 3QO9A 3AVBA 5HP1A 1X9MA 5KG2A 2RKIB 3IG1A 2R7YA 3SJJA 4B9VA 1IKXA 2JEFA 4IR9A 2UVWA 4FLXA 1QHTA 4ED8A 2GC8A 2FJXA 1S0NA 4FJJA 4ED0A 1TGOA 3QZ8A 4O3SA 3ISND 1JLCB 5I3UB 2GIRA 4CFAA 3IS9A 2BE2B 3H5SA 3THVA 1C0TB 2BR0A 4E1MA 4DS5A 4RW6A 2BRLA 3SZ2A 3KMSA 4FM2A 3T19A 5J2NA 4JV0A 4FJXA 3S3NA 4CK1A 4OGCA 4CEAA 3GIIA 1JX4A 3K2PA 1ZTTA 2O5DA 4KE5A 1TK0A 3NAEA 3MR3A 4E89A 3O3FA 2XCPA 2VG6A 1TL1B 5F8HA 3MEGA 2B43A 4DSJA 4BDZA 4DTXA 2DFHA 4ED1A 1TK5A 4ED3A 3T1AA 4CJ4A 4KAIA 4JLHA 5C25B 4JRQA 4M45A 3TANA 4MK8A 3LP1B 3AO3A 3PW5A 2CJQA 3V6HA 2EHGA 3MEDB 1OS5A 1KHWA 5FDLB 4H4OA 3BDPA 2G8HA 4TSXA 1RT1A 3CFPA 1SV5B 3DMJB 3QYYA 3MXMA 4YFUA 4O3PA 3QEPA 3E51A 4FYDA 1RT7B 2VG5B 3K58A 3FSIA 4DLGA 3AVLA 1T94A 3SCXA 4R8UA 2R8IA 2HMIA 3SV3A 1DLOA 2XRIA 1QUVA 2JLEA 4CHYA 5KFEA 3TAGA 2HHSA 1RDBA 3VQ7A 2OA8A 1HYSB 1JLGA 1NK9A 3ICLA 1S6PB 4NYZA 4E0DA 4N47A 1JLGB 2W9CA 1RTJB 1BIZA 2RN2A 4CK2A 1TL3A 1K6YA 4ICLA 4FK0A 3PHEA 4O4GA 1IH7A 4KHMA 5I42B 4KO0B 3LAMA 4E7LA 3VQ9A 4M95A 4EO6A 2WB4A 3V4IA 5T7BA 3PW7A 1ASVA 4ZHRA 2ITGA 4CJVA 4CEBA 3QINA 1RT4B 4ID5B 3VN5A 4Q5VA 4MFBA 3HJFA 3OYJA 3T3FA 2FLPA 3HXMA 1TAUA 4K4ZA 4J9MA 4JS5A 4NCGB 4KKOA 4DL6A 3BGRB 4PUOB 5L1JA 2BQUA 4I9LA 4LSLB 4DF4A 1JXLA 2D0AA 3KK1A 2ZKUA 1HRHA 3KTQA 4IH6A 4Z0UA 2BQRA 5KFNA 4DEZA 4OKEA 3QEWA 4ECXA 5L1KA 3PUFA 3LP3A 2AQ4A 4H8KA 4CEQA 4FJ5A 3PJWA 3IN5A 2XO7A 2ILZA 2RF2A 3OYNA 3CIZA 4C8OA 1SL1A 5L9XA 4E7IA 4M42A 4OKKA 1HNIB 3RMAA 3MR5A 3OYCA 1LW2B 1RT2B 3VQEA 4WE1B 1QTMA 1IKXB 1VSJA 3CM5A 4Y2CA 4OL8A 4IDKA 3KLFA 3TWHA 4FJIA 4KTQA 1NK7A 2HVHA 5DMRA 2WCXA 3K5OA 1Z26A 4KFBA 4CGFA 3EZ5A 1IKWA 4KFBB 4FS1A 4OJRA 4TY9A 1RTDB 2ASJA 4FLWA 4KRFA 3BSAA 3MXJA 5JS2A 3HVWA 1S1VA 1XHXA 5C24B 3DOKB 3VQSA 2UUTA 4FJGA 1HYZA 3QO9B 5HP1B 2OYQA 3HVTB 1C6VA 3AO4A 2D5RA 4FZZA 4BDPA 2V4RA 1D8YA 4WE1A 3PW2A 3F9KA 1TV6B 2YNHB 1S9EA 3ZCMA 3EPIA 3LANA 1TKZA 2X6NA 5D3GB 4O3QA 2C2DA 5KI6A 4DL4A 4RW8B 4E1NA 4KHYA 4CF9A 1S6PA 4F3TA 4ECVA 2YNGA 3M8PA 4WFYA 3RBDA 1BQNB 1XC9A 1ITGA 1KLMA 3VQBA 2D41A 4O4RA 1R0AB 3T5KA 4BE0A 2C28A 3QLHA 3RB4A 3RR7A 1KVCA 2AX1A 5FDLA 3E01B 1KTQA 3NGYA 3E01A 1NOYA 3NH0A 4CJFA 4ZPAA 2VG7B 3L2VA 1RT5A 3LP0A 2DTUA 3CDEA 1C0UA 1DTQA 3NF6A 4CF0A 2J6UA 1C2PA 4J9SA 1DTTA 1QE1B 3V1RA 3ZSQA 3DRSB 4Q43A 4CIFA 4NLOA 1RTIB 1N6QA 4OPJA 2OPQB 3KK2B 1RTJA 3QIPA 4IRKA 3RB6A 3QNNA 2E9RX 1RDCA 2IM0A 3ZSWA 2J6SA 4O0JA 1JLQB 1SV5A 4YR2A 4EO8A 2CKWA 4IG3B 3C6UB 2JEJA 2HNYA 3ZSVA 4NRUA 2IC3B 3NGIA 4R8UB 2ZQBA 3G86A 3N6MA 4F50A 2XY5A 1ZBUA 4WXWA 3VA0A 1HYSA 3AVJA 3NAHA 3L8BA 4DTJA 5FRMA 2BRKA 4NLGA 3OYFA 2G8WA 2D3UA 3GQCA 4O4GB 2YKNA 2XI2A 4CFBA 3PR4A 5CZ1A 4YR0A 5DLFA 3OYLA 2R8GA 2FC0A 2HNDB 4ED6A 2GBZA 1ASUA 3AVGA 4F3OA 3IS9B 5HRPA 1NKEA 1S1WA 4MIAA 4ZTFA 3OHAA 1LV5A 5KFQA 1VK0A 1JIHA 4J9NA 3PZPA 2QKKA 2RKIA 3IG1B 5EWEA 4CF1A 3SQ4A 5KFYA 4ZP7A 2Z1GA 4XO0A 4RW9A 4G1QA 4ZPCA 4B8CA 4CJWA 3VQAA 1W25A 4G1QB 3KHHA 4Z4FA 3ZT4A 4FM0A 2HNZA 4NCBA 2ZD1B 1VRUB 1N5YA 2F8SA 3FFIB 3AVMA 3CFRA 3FFIA 4EP5A 5KT7A 5C42A 3RMDA 1HJRA 4HUFA 3KLHA 3ISNC 1SKSA 4W5NA 1IKWB 2QXFA 1SH2A 3KLEB 2W8KA 4RW6B 1X9WA 4IKFA 1VSMA 1QAJA 2UVVA 4I2PB 3SQ0A 4EYIB 1WNSA 2FBTA 4TYBA 2ASDA 3DI6A 2XGPA 3U3GA 3I0RB 1LW2A 1RT2A 3AVCA 3GIJA 3DOLB 3LZJA 3O3HA 1VRTB 1GX6A 3JYTB 3KLIA 3QNOA 1X9SA 1D0EA 4ZP8A 3LP2A 4YP3A 4FBUA 4Z4HA 3NAIA 3VQQA 1W9HA 1HPZB 1VSFA 1ZBIA 1EP4A 4F4ZA 1RILA 3VQPA 3OS0A 1RT6A 2KZMA 2G8UA 2YNFB 1HQEB 3AV9A 4JV2A 3RWUA 2O4GA 5KFOA 3VQ5A 5I42A 1BQMB 5J1EB 2HHQA 2F96A 4AHUA 3CDUA 3H5UA 3V4IB 1RYRA 4FLTA 5KT2A 2FVRA 2HHVA 4RNMA 4HYKA 2RDIA 1CZBA 5CZ2A 4N41A 2GIQA 4DU4A 4IBNA 5KFBA 2HWIA 3C6TA 4AHTA 5KT4A 1ZBHA 4NLXA 2FVPA 5J2MB 1KHVA 3V9UA 3FQLA 4R5PB 3BSNA 4K8ZA 3V6DB 3MEEB 3MR6A 3HKWA 1RTIA 1WSEA 4DL2A 4M41A 1K1SA 1Q9XA 5HRRA 2A1RA 3OYKA 2R8HA 1RA7A 3LDSA 5KGWA 4QWDA 2R8JA 3ZSYA 5KFRA 3AVFA 2WK4A 3DRPA 4M94A 4TQSA 4ECZA 4I2QA 2IC3A 4NYNA 4NLYA 4DTMA 4E7KA 3G0ZA 1N48A 5J2NB 2KW4A 2DFEA 3WNFA 4ECRA 4FJHA 1NK8A 2D0CA 3KIOA 3GV8B 2IM3A 4KREA 2VG5A 1WLJA 1WAFA 1N5YB 4PA1A 2O4IA 1GOCA 3QZ7A 3ITHB 2R8KA 5DG7A 5HRSA 1CZ9A 3OYAA 4QWBA 3HO1A 1NJZA 2KQ2A 1T03A 1LAWA 5JXSA 1KLMB 5F8IA 5HBMB 1JXBA 3QERA 1NJYA 3S9HA 1KLNA 4FS2A 3HVRA 2XY8A 4PWDA 3TABA 1U47A 2OPRA 3LWLA 1GOBA 1S5JA 3QEXA 1T05B 4KB7A 2B6AA 4CHQA 2FJVA 3QGGA 4F4KA 4NLRA 1RBTA 3NF8A 1IKVA 4FJLA 4RUCA 4O55A 4MK7A 2I1RA 1IKVB 4CEDA 3B6PA 2WHOA 3OHBA 5L1IA 4IFVA 1LW0A 4FW1A 3CJ3A 1SL2A 1RDRA 2F8TA 3DLEA 3NHGA 2HHTA 2FVCA 3NH2A 1BGXT 3LPTA 2HHUA 1D5AA 3CO9A 1RT3A 4CIEA 1IG9A 2OPSA 1CSJA 3Q8PB 2OPSB 5DG8A 1S9FA 3NF7A 3KNAA 1UAXA 1XR6A 4FW2A 4ZMMA 4NRTA 4XIUA 3OVNA 3HPGA 5KT6A 3H40A 2PYLA 4DQPA 1J5OB 4CEFA 3NGDA 3M8QA 3L2RA 4E3SA 1LWFA 1BI4B 3QESA 2ZE2A 2ZD1A 4KHUA 1CLQA 2V0NA 1A5XA 4E7HA 4QOZB 2IAJA 4E7JA 1IM4A 1LAVA 2P1JA 4FBTA 2LSNA 5EU7A 2HHXA 1G15A 3N6NA 2B5JA 4MFBB 1NJWA 4M3XA 4OKJA 5CYMB 4EEYA 3NH1A 2V4QA 3TAPA 1EETB 4GW6A 4EBDA 3OSNA 3QLHB 3LAKA 1JLBB 1L3TA 4CERA 4BWMA 3OJUA 4FLYA 1J53A 3RMCA 1WAJA 2G8IA 3SNNA 5KFVA 4KV8B 4DG1A 3CJ2A 2YV0X 4B8AB 3RAQA 5J2PA 4FJMA 3CVKA 1TAQA 4DU1A 3LP0B 4TXSA 1L3VA 5DQIA 4ECQA 3SQ1A 4NLSA 3M9NB 3KJVA 2DPIA 4CECA 4NCGA 1O1WA 3RRHA 3B6OA 5J2MA 1U45A 2AJQA 1RAJA 4R5PA 1N4LA 1BIUA 3T5HA 3K57A 4WFZA 4DTPA 4F4XA 4Q0BB 3D28A 4CESA 1MMLA 4KO0A 3FQKA 3GIKA 2HNYB 3SPYA 5F8MA 1A5VA 4K4UA 4CHZA 3HYFA 1NK4A 4OLBA 1UWBB 4ZP9A 4DFKA 1YT3A 3NBPA 2VG7A 2OZMA 4CK3A 2AGPA 1KSPA 1YVFA 4C8MA 4IG0A 2BDPA 2AGQA 1IKYB 4O3OA 2ETJA 2W42A 3I5CA 4TQRA 4KHSA 4RNNA 3K5MA 3HP6A 3HP9A 5EWFA 4WZQA 4FK2A 4B08A 4K50A 4FJ7A 1I6JA 2OPQA 3KK2A 1HARA 4DSLA 3H08A 3D5MA 4XPCA 3L3UA 4RNHA 3NKYA 3PW0A 3DM2B 3PX0A 1DTTB 1QE1A 2ILYA 4FVMA 3DM2A 3S3OA 2C22A 1HQUB 1D9DA 4C8NA 4AH9A 3LP1A 4KI6A 1NKCA 2HB5A 1S4FA 3HSTB 1BQNA 4IH7A 3SPZA 1XWLA 4H4OB 1UA0A 2IA6A 4URSA 4DSIA 4Y1CA 2FJWA 1B9DA 5HROA 4HUEA 1TKZB 1SKWA 5T14A 3ZSRA 2FBYA 3I5BA 4NLUA 4LY7A 3LP2B 4CEZA 1QS4A 1NK0A 3AVAA 3DRRA 2AWZA 2WONA 1LW0B 4BE1A 4NLQA 4DTRA 4B9TA 4IRDA 4RG8A 4KHQA 5F9LA 5K14B 4JUZA 3HVAA 3VQDA 3IAYA 1S48A 1RT3B 2YHAA 1YVUA 3RBEA 4X2BA 3DI6B 1C1CA 3GYNA 4Y1DA 3TR8A 1NJXA 2HNDA 3V1QA 5SZTA 4Q8EA 4DSEA 5KFTA 4TYAA 3OYMA 2IGIA 3OL8A 2AX0A 1WSGA 4OVLA 4ELTA 1F21A 3KD1E 1S49A 4RW9B 2FLNA 4ZVGA 3V1OA 1I39A 3PY8A 2ZE2B 2XY7A 1DLOB 4EZ6A 1C0MA 3RR8A 3JSMB 2Y1IA 5KFJA 4KB1A 4ECUA 3KHRA 4JS4A 1S9GB 2B5JB 4K4SA 3QIDA 3DLGA 1VSLA 4KHNA 1N6QB 3KLEA 3MF5A 4F4YA 3ZSXA 1KCFA 3PV8A 2GV9A 3DLBA 2IBKA 5DGBA 2D0BA 1VRUA 5KFWA 4Y3CA 1CXUA 1YTAA 4IOBA 1NOZA 4ED2A 1LWEA 2X6SA 2RF2B 5KG6A 4I2QB 4O5BA 3VQ6A 4IG0B 4WFXA 1TP7A 4F4WA 3QGHA 1RBSA 1DTQB 2J6TA 3VQCA 3C6TB 4NLVA 2DPJA 4KKOB 3VA3A 2E9ZA 4RNFA 3QEIA 1W0HA 3VQ8A 3BGRA 1FK9B 2IDOA 2YKNB 4JRPA 4KSEB 4FM1A 3P83D 1BCOA 4ELVA 2QK9A 1WSHA 4CJQA 1WN7A 4Y34A 3NF9A 4IQXA 2E4LA 1TK8A 1TKTA 4GVMA 5J1EA 4DTOA 4DFPA 1XHZA 2IM2A 2QKBA 1NNDA 3KJVB 3NBPB 4J2AA 3NE6A 1JLAB 2I5JB 4FLUA 1YTUA 2HWHA 4DFMA 3AO5A 1ZTWA 3CM6A 3ZSOA 3O3GA 1EKEA 1T7PA 4ZPBA 1FKPB 1RTHA 4Q0BA 1D9FA 2JEGA 3IRXA 3KLFB 3UR0A 2EC0A 3D45A 5C42B 4IKAA 3ASMA 4CHNA 2B4JA 1XI1A 3V81A 3PVXA 2FLLA 1S10A 3ZT3A 4J9QA 1JLEB 3V6DA 5F8LA 4CHOA 4L8RB 4MKAA 3NL0A 4EYHB 3GV7B 3U3YA 3AVNA 3PX6A 3HVTA 4RW4A 4LH5A 2HHWA 1D1UA 3DOLA 3H4DA 4URQU 3O4QA 1BQMA 3I8DA 4DS4A 4DSFA 4ZTJA 4PY5A 1KVBA 1FXXA 1FKOB 4GMJB 4MK9A 1TVRB 3RMBA 1RDDA 3LWMA 3SQ2A 3KK3B 4LH4A 1S9GA 3BJYA 4K4YA 3OS2A 2PYJA 3C95A 4LSNA 1HYVA 3OJSA 1RA6A 4CIGA 4HCBA 3CYMA 3OL7A 3TAFA 3DLEB 4ZP6A 5KG3A 4KTZA 4RW8A 4EZ9A 1EP4B 3HT3A 3TAMB 4C8LA 1TKXA 4CEEA 3TAMA 5FRNA 1SUQA 4YQWA 2AGOA 3KD5E 4ECTA 4B9LA 1ZBLA 3PO5A 4QW9A 4E19A 2ASLA 4Z4IA 4MIBA 4CJ5A 3PX4A 2OPRB 3OYHA 4GC7A 1BI4A 2VWKA 5HROB 2B6AB 1NK6A 2C2EA 3ZT2A 3SI8A 4CJUA 3OLBA 4ED7A 4DQRA 4M3TA 4KHWA 2IAJB 4TLRA 3KK3A 4U7CA 3DRRB 4J9OA 5F9NA 4FJ9A 4U6PA 2XC9A 3MECA 3G6YA 4LQ9A 1T05A 1U48A 3G6XA 1IO2A 4PQUB 4RZRA 4LSLA 3I5AA 5KFZA 1BHLA 1RBVA 3CJ5A 4NLPA 2WOMA 4HUGA 4CGGA 4DF8A 4KAZA 3OYIA 1UOCA 3AA3A 3CQ8A 4ZVHA 4YR3A 3U6FA 4HVJA 2UUWA 2BE2A 1S1TB 4K4TA 5KG4A 1K1QA 1KFSA 3OYDA 4J9LA 3DRPB 3CJ0A 1KRPA 1WSJA 3MFHA 1RBRA 4FXDA 1UWBA 3TQ1A 3AVHA 4JV1A 2JC1A 4KPYA 2W9AA 4FJ8A 3PW4A 2VA3A 1RDAA 1S1UB 3K5NA 5KFIA 4AHVA 4Y2AA 3KMQA 2XI3A 5KFCA 3QETA 3CWJA 1NHUA 1RTHB 4CCHA 3DLKA 3MTKA 3AVIA 4CGDA 4NLDA 1LWCA 3SYZA 3V81B 3H5XA 5KFMA 3TI0A 2ALZA 5CY4A 3CFOA 3WNGA 1MU2A 1HQUA 3MFIA 3RB3A 4HKQA 1EETA 2A1SA 4B9SA 4W5QA 1MU2B 5J2QB 4OLAA 3QGIA 4DMNA 4XPEA 4ID1A 2QE5A 4CGJA 3HM9A 4KB0A 1S6QA 1S97A 4CFCA 4AILC 3OSPA 1TV6A 2ATLA 1LWFB 4O44B 4AHCA 4K4XA 3MAQA 4URGA 1Z4UA 4O44A 2DY4A 2YNHA 4DQSA 2FBVA 4BWJA 4BDYA 4B9MA 1S1XB 3RRGA 3LPUA 3BQ2A 1KVAA 3ALYA 3SI6A 1HPZA 1EX4A 4CJEA 2IOCA 3DLRA 4DQQA 4J9PA 4KI4A 2W9CB 4WXOA 3N6LA 1QQCA 3OYGA 1RTDA 4H4MB 1VSDA 4Q44A 2BGGA 3TAQA 1QAIA 4TN2A 3MEDA 3D0PA 4DTUA 3K5LA 5KG5A 3SFUA 3TARA 1RT1B 5KGXA 2HW3A 1TL1A 4KV8A 4DG1B 1SL0A 1RT5B 1SKRA 4Z4GA 4CF8A 3AO2A 4R0EA 3DLHA 4O0IA 4EBCA 3M9MB 1JLCA 5I3UA 3V6KA 4BE2A 5CYQA 3GIMA 3OS1A 4F8RA 2FVSA 4PQUA 2VA2A 3EPGA 4ECYA 3PJXA 1C0TA 3EY1A 4TY8B 3OY9A 1C1CB 5KT5A 1VSKA 4RW4B 1GX5A 4DU3A 1UA1A 2IS3A 2YNFA 4NCAA 4I7FA 3EYZA 1TKTB 1WNEA 3PO4A 2X78A 5HLFB 4I7FB 1B9FA 3MR2A 3OYBA 1RT7A 3F73A 4MKBA 3GILA 5KFLA 5J2PB 2YKMB 5KFSA 3C6UA 5C5JA 3M8QB 2EX3A 2YKMA 2W8LA 4CF2A 1ZYQA 3T5LA 4Q45A 3G10A 4DL5A 2XCAA 2BQ3A 4CE9A 1C1BA 3O4NA 3QEVA 2WTFA 5EWGA 4B9UA 3I0SB 3DYAA 3H4BA 2W9BA 3DRSA 1ZETA 5K14A 1QSYA 3MEEA 4IR1A 4OPKA 3OL6A 2Z1HA 4QWAA 4W5TA 2WONB 3ZT0A 3SFGA 2OZSA 1JLFA 4IG3A 5JS1A 3P5JA 4WYWA 1NKBA 4ZHRB 1KFDA 4FJNA 3LZIA 5JUMA 5EDWA 5DGAA 4WYLA 4IRCA 4O3NA 3IGNA 3BSOA 1C1AA 4DLEA 4EP4A 4CHPA 1BCMA 4OGEA 4W5RA 3LALA 3OLAA 3MXIA 5DG9A 3FDSA 2KTQA 3NCIA 4RUAA 4DFJA 1VSEA 4ICLB 3KKSA 3SUPA 1HNVB 3ITHA 2VWJA 1LWCB 2IJFA 2R2TA 3KLGA 1EXQA 5HRNA 4DTSA 3UDLA 3KLGB 5KG7A 3AO1A 1WSIA 2BANA 1TL3B 4H4MA 1T03B 4YNQA 4G3IA 5F8GA 3SUNA 1R0AA 2G8VA 1REVA 3IGVA 2PY5A 3I0RA 1NHVA 5KFAA 4FCYA 2JGUA 5EUHA 5DK5A 1IKYA 4J9KA 4FJKA 1J5OA 3Q8RB 4DL3A 4H54A 4ZVFA 1Y97A 1T3NA 5KG0A 5DQGA 3BQ1A 3AA4A 2FVQA 1C0UB 1XR7A 4DL7A 3L3VA 1S9EB 1GOAA 4DQIA 3DDKA 1JKHB 3ZT1A 1T8EA 5L1LA 1S1XA 4DWIA 1JKHA 1J54A 4J9RA 4K4WA 3RTVA 4ECWA 2ATQA 2QV6A 1FK9A 3BR9A 3DLGB 1Z25A 2PZSA 4NLTA 3KK1B 3QIPB 3HL8A 4CJRA 1JLBA 3V9ZA 1JL1A 4B3OA 2KFZA 3DMJA 1SH0A 1TKDA 4FK4A 3ZSZA 3RB0A 3L2WA 4CJTA 3EZUA 5KFFA 3KLIB 2VG6B 3BREA 4QW8A 4ELUA 2Z1JA 3NGZA 1RYSA 1JLAA 2X74A 3VQ4A 1QSLA 2XY6A 2G8KA 2XHBA 5KRTA 2YHBA 2IMWP 2W7PA 4KHRA 5KFXA 3GV5B 5CYMA 4QPXA 2V9WA 2YNGB 4M3UA 3RAXA 3OL9A 5CYQB 2P5GA 1BISA 3V9SA 3SUQA 2R2SA 4QAGA 3V9XA 2Q3SA 4MQ3A 1U49A 4TY8A 4CJPA 1S1VB 4QWCA 2W7OA 2C2RA 2E6LA 3OYEA 2HVIA 4NZ0A 4NLWA 5DLGA 1S0OA 3HPOA 2JC0A 4Z4CA 4ECSA 1CXQA 4RW7A 5C24A 2JEIA 3H59A 3DOKA 3CG7A 4M3WA 5F8NA 5D3GA 3BQ0A 3QIOA 4CEOA 3NFAA 4FZYA 4CJ3A 2DFFA 1NK5A 4IFYA 1RNHA 4I9QA 1HNIA 1U4BA 2D3ZA 2WOMB 4CGIA 1TVRA 2UVRA 3HHKA 5FROA 2P51A 3AVKA
chains in the Genus database with same CATH superfamily
1LKZA 1VSHA 2BA9A 4DV5F 4LF7K 1RWWB 5KFPA 1M5PC 2DNRA 1QD1A 3CO0P 4QWEA 1S0MA 4ZVSB 5F8JA 3W5YA 2DH8A 2DT9A 1RWNB 2VJUA 2Z1IA 3G4SN 1UEKA 4IO8A 3DYAB 2W01A 2J8SA 2VDIA 4JKHA 1FO1A 4DTNA 4UQTA 1Q18A 3CCUS 1JJ4A 1MN7A 5ETOA 1VDHA 5DJBA 2UVUA 3IWNC 4W92B 2OPPB 5D78A 4A8QA 2CJYB 3ENQA 3KHLA 4CJKA 4X65K 1BL3A 4IFVB 2DNPA 4DSKA 3OTDA 1S1WB 2VL1A 3I33A 1U02A 2Z2ZA 4JKCA 4BACA 2NXJA 3OR2A 5EN1A 2KVIA 3UN2A 3L2UA 3VF0B 3FCVA 2R7RA 1VR6A 4EMDA 5K8PA 1UP1A 1YQHA 4DQ8A 3VTHA 4DCOB 3M1VB 2J76E 2PE8A 3HHEA 4IOAL 3FZHA 2RAQA 1VBXA 3CMES 2DIUA 4J2DA 2VQFK 3IRXB 4HEA9 4O3RA 4JHDB 4HCCA 3MMCA 2L9WA 3V6JA 3DLKB 1YG0A 1RT6B 2AHOB 5KFHA 1B7FA 4J8FA 4G1PA 4JI2J 5KG1A 1QQNA 5AFUH 4FL9A 3VERA 1VQ9S 3EICA 1Q8IA 2F8EX 4NI2B 4FZXC 2OSQA 4DPYA 3P5TL 1GXTA 1HFEL 4GV3A 3BBBA 4OLPA 2QC3A 3A1YG 2BJEA 4RJVA 3L6QA 1D8ZA 3KVGA 4FLVA 4DPUA 3JSMA 4TNOA 4UOFA 2IVPA 3OVSA 1BLUA 3TZWA 4N56A 4IFYB 5ETKA 4M3YA 2BH1A 3S3MA 3DLLQ 1U2FA 3UIQA 4CFDA 4OHWA 3ZZPA 2YBVA 4I2PA 4OLOA 2YPYA 3OUYA 4N76A 2XHWA 1FFSB 1Q9YA 3CJ4A 3C7NA 1NSAA 1QM9A 2XWYA 1K8KA 4DR6F 3D1QA 3W60A 2HK3A 2YNIA 1KD1T 4CJLA 4K8XA 3H5YA 3NDKA 3CJSA 3TAEA 3CCUN 3A12A 1X9MA 1UVNA 1VQ4N 2RKIB 3W2VA 3A5OC 1IKXA 2JEFA 4IR9A 3OTOJ 3B8HA 3CCMN 2VKZG 3O5TB 4O3SA 3CJ7A 4QIEA 1GNKA 3QAEA 2UUAK 3H5SA 3U1LA 2PA8D 2QN6B 5AQZA 1WKKA 2HBKA 4A8KA 2CQBA 2VH7A 3VVTA 2R7TA 3SZ2A 2D0PA 3VF6A 4JV0A 5JLHA 2GVDB 3S3NA 2D69A 3K17A 4C8ZA 4CEAA 2RQCA 1K73T 2VBYA 1FF2A 1YITS 3NAEA 4L76A 2VFVA 5I4MA 3NGKA 1MDUB 1CVJA 2FYXA 3CCTA 4ED1A 3T1AA 2OEKA 2KM8C 1TUUA 4JRQA 3UNGC 3HM8A 1RAEB 1GMWA 1RU1A 2V68A 3AO3A 2JWKA 1V5VA 1FDAA 5HJXA 1XMOK 2O1PA 3P3DA 4LRFA 1KHWA 5FDLB 4H4OA 3BDPA 3FVYA 3M4XA 5M2RA 6FD1A 3GCWP 3UI3A 3VGKA 4WQ5A 1UL3A 3D66A 1ZAXA 5L38A 2B8QA 2YJFA 2MHEA 3FSIA 4R8UA 2Y3YA 2DNMA 1DLOA 2W24A 3P8BB 1QUVA 3TAGA 2DNNA 4F02A 3OXFA 1NK9A 5EGYA 4E0DA 2W9CA 3UNYA 3OFFA 4O4GA 1OPIA 3HBTA 4MJKA 2IPOB 1X60A 4CTAA 3FGUA 1ZH5A 4Z7CA 4EO6A 5KOWA 3HCXA 2JOQA 1OVYA 3V4IA 5D77A 1GEHA 2DXFA 4DR2K 3WQTA 2V2ZA 4UZBA 3B54A 2ITGA 1HNZF 2E66A 5AZJA 2AYEA 4DX8H 2GGPB 4Q5VA 1F9EB 3HJFA 3OYJA 3T3FA 2FLPA 3CCRN 4JS5A 4EU0A 4LSLB 4DF4A 4OO1J 1JXLA 2M8HA 2D0AA 3KK1A 2ZKUA 4DR5J 4ZVUB 3J7ZT 4KHPF 4IH6A 4ZK7M 1SPBP 1E3MA 1M5KC 2OTJN 2ZFHA 3GJTB 2YKQA 2I7NA 1RKIA 1HNWJ 1MWKA 2AQ4A 2DY1A 2CQ4A 4FJ5A 2MLYA 2XO7A 2RHKA 1KBRA 4WIIA 2B7CB 4C7QA 1SL1A 2FJAB 5JVHQ 4NMXA 4DUYJ 1YJNS 4XK8C 2K1RA 3OTEA 3MR5A 1LW2B 1RT2B 4TU7A 3VQEA 1VSJA 3JQJA 4Y2CA 3OTOK 4IDKA 4JYAJ 3KXDA 2LEBA 1FEHA 2HVHA 1W26A 3VEOA 2BJ9A 5EOYA 1Z26A 4JI6K 3EZ5A 4CGFA 5AE2A 4NEZA 4FS1A 2XZDB 2HS4A 3GYGA 4OJRA 4KRFA 4UOHA 3J80U 1S1VA 1R6VA 3NNHA 3VQSA 3TJAA 3ZZOA 4FJGA 1SS6A 3QO9B 4UW2A 3D2FA 3HI0A 2DNOA 3JXOA 2HZCA 2V4RA 1D8YA 2D3OR 1F5CA 1S77D 5B0DA 2E1RA 4C3KA 4WP3A 3C66A 4F3TA 4OV1A 4M5JA 2Y0BB 1CC8A 3THTA 1N0UA 3M8PA 1BQNB 3PFOA 1XC9A 1KLMA 2XWXA 1R0AB 4NLBA 3HKZD 4UZCA 3T5KA 4BE0A 3QLHA 4WQ4A 3FZMA 3RB4A 3AQOA 1HD0A 2MZRA 3UO0A 2KVQE 3SAHA 3NGYA 1NOYA 3NH0A 2DXEA 4ZPAA 1HBUB 3EKSA 2ZH1A 2AYMA 1DTQA 2YI1A 4HTJA 4HHJA 1QE1B 4ETZA 2UV8G 1NG9A 5CR4A 3V1RA 3ZSQA 4J7CA 4B3RJ 3QWUA 3TPQA 1U0SA 4KH6A 2OPQB 4BR9A 1RTJA 5AQWA 4IRKA 3MDFA 2E9RX 3ZSWA 3VZIA 2J6SA 3E9OA 3PRBA 1SV5A 4YR2A 4EO8A 4IG3B 2Q6CA 5GMKa 4YOYA 1ZA1B 2HGLA 3UR3C 2P9UA 3NGIA 3OBWA 4F50A 1ZBUA 4LF6J 4WXWA 1HWIA 2IIHA 3KUEA 1WOSA 2K8GA 2AD9A 5E3RA 2ZJPQ 3MPYA 4AD6A 4BR7A 4FOIA 3OYFA 2X1GA 3AD7C 4H03B 2YKNA 3OR1B 4GO7X 4CFBA 2HBQB 4FF2A 2CAJA 2ROGA 1DHMA 2GBZA 1FFWB 1Y64A 4GVEA 1GMWD 1N52B 3G82A 5HRPA 4Z2XA 5HK4A 4FNIA 4ZOSA 2W2NP 2ADCA 4JKFA 4BQZA 4PKDB 3DXKA 4ZTFA 3C14A 1VK0A 1LFWA 5B0BA 2MQNA 3B82A 1OSDA 5CYJA 2RKIA 4BR2A 3WXIA 5KFYA 3HZEA 4ZP7A 4XO0A 4LFAK 4ZPCA 1NXIA 1VQSA 4B3TF 1W25A 3VQAA 3G8SA 2RHQB 4Z4FA 3ZT4A 1M5SA 2J7WA 3AH6A 1VRUB 2FHJD 3CFRA 5E33A 4YHHF 3MK6A 3KLHA 3ISNC 3LPEA 1UMJA 2HVDA 1WEZA 3KLEB 2W8KA 2UVVA 4YOVA 2D9PA 2DGOA 4EYIB 1WNSA 2CZ9A 1K73O 4WFNQ 3DI6A 3CE8A 3MN7A 2DTJA 3U3GA 1HI8A 5A8WB 3I0RB 2XMAA 4IO1A 3AVCA 5AZIA 5THWA 1VRTB 1E6YA 1U2RA 4OZNA 2UUCJ 2GW8A 1JJ2M 4ZP8A 2B56A 2LQ5A 4ILGB 3JSBA 3JQMA 4K43A 4X4QA 4MLEA 1W9HA 1HPZB 2HBMA 3FBFA 1ZBIA 1EP4A 2UUCF 4F4ZA 1CJUA 3AJ1A 2KZMA 3CHWA 2NYHA 4HL9A 3RWUA 2Q0RA 4PXDA 3VQ5A 2WBMA 1SAZA 1TU0B 2GHPA 2ZBCA 5J1EB 3ZTSA 2F96A 1YK9A 1GLBG 5KT2A 1DZ5A 4RNMA 2C3PA 1IR2A 4DU4A 4JI7F 4IBNA 4OZJA 2HWIA 3TX8A 3MUMP 5KT4A 3UN5A 2FVPA 2A2CA 3AD9C 3V9UA 4N8NA 2V50A 1N8RO 4TLQA 4ETXA 1WSEA 3VR1A 4M41A 4CTAB 2ASYA 1E4FT 5F0WA 3H0PA 3CF5Q 3KHYA 2ZITA 2A1RA 4YY3K 2DO4A 2R8HA 4PWUA 2YXLA 4QIGA 5KGWA 3FNNA 2DR8A 2M7SA 4LRDA 4V19J 2WK4A 5JICA 1PGZA 2HHPA 4I2QA 3HHNB 4NYNA 4EFHA 1NMDA 3G0ZA 4CO0A 1N48A 2RUGA 5LMUF 4JNEA 4C4WA 1UFLA 3KIOA 3CJQA 3DRYA 4KREA 5DDRC 2BXJA 5B8HA 5AQYA 2XS2A 3ITHB 4FWOA 3UVJA 1G4CA 1JCFA 4FO0A 3HO1A 1VIOA 2DISA 4C9DA 2P9SA 3D7SB 2R42A 3AGKA 4DUZF 2KQ2A 1SC1B 1N33F 2FTRA 4YY3J 4WCEL 2IRXA 3D54A 3S9HA 1V3SA 2OUGA 4PWDA 3ENAA 4OYIA 4AXIA 2KFYA 4WWSA 1GOBA 1FE4A 3WUHA 2FJVA 3QGGA 1T9WA 2GWJA 4LF8K 2ZOGA 1N33J 3ATUA 1T9YA 3UD4P 2BUNA 1QAXA 3DDNA 4YY3F 1IKVA 4RUCA 4O55A 4ZVOB 4JI2K 1TL7B 1NRKA 2Q1NA 3CCJS 1OH5A 2IVNA 2CJAA 2VV5A 3SJHA 4H0XB 2BZ2A 3QB0A 4X4RA 3P5BP 4KH5A 3DLEA 4ANCA 2HHTA 5BN8A 3NH2A 3LPTA 2HHUA 1IG9A 3QPIA 5G4DA 1CSJA 4ZKAA 1YHQN 3KNAA 2OPSB 2WW8A 4FF4A 4FW2A 1IJEB 4ZMMA 3SIPB 4NRTA 3AHPA 2VU5A 3TSUA 4DQPA 4DX7A 5AXLA 3M8QA 3L2RA 1WI8A 4PHTX 1U6FA 2ZHAA 2ZE2A 4FPBA 2ZD1A 2HAFA 3K5PA 4CLZA 2MQLA 4ER8A 2IAJA 2AYBA 3IWLA 4FBTA 3WQPA 1G15A 3N6NA 2UXCK 1N88A 2OHDA 4EEYA 3UD3P 3VGVA 3W66A 5MLCQ 3Q22A 3TAPA 1EETB 1XJWB 3GZ7A 4EBDA 3QLHB 3LAKA 2GX9A 1QAYA 3R8EA 1J53A 4X4NA 1Q82O 4J37A 3AOBA 5KFVA 4DG1A 3RVCA 5J2PA 5DZ6A 3DU5A 2WVBA 4TXSA 1KC8T 4YHHJ 4NLSA 3M9NB 2DPIA 5A6PA 1BE4A 2BW7A 4OHVA 4BQLA 4H0PA 1RFQA 3CQYA 2AJQA 1RAJA 3A4TA 4DV5J 1U8SA 3PYGA 3I96A 3K57A 2FZCB 3IR5B 4X66J 3UVJB 4IXCA 1URNA 3D28A 4FN5A 3O6WA 3SPYA 2NCKL 2J9DA 1NK4A 4OLBA 1UWBB 3DN9A 1VRQC 5AJ3F 3IR6B 2VG7A 2OZMA 4WQ5C 4L6V3 4IG0A 2AGQA 4O3OA 3J81j 3NOCA 2DRDA 3C46A 3HP9A 5EWFA 2MZQA 3UW1A 2ZGYA 4GKKK 4NYPA 3IWXA 3BS9A 3D5MA 4CO1A 1VGYA 2H51B 3PW0A 2ILYA 3DM2A 2F4VJ 1D9DA 4AH9A 1LNQA 1K8AO 1U6BA 4AE5A 1BXNA 1GH8A 1NJIT 2HB5A 1F60B 2ZH4A 2F9JA 1EKRA 2IYIA 4ATNA 3HSTB 4IH7A 4DHYA 2CH6A 4EWTA 4IUFA 3MMVA 2X3GA 2IA6A 2YTCA 1DJ0A 2MTLA 3R1XA 4Y1CA 1AFIA 2I6WA 3VGUA 3LDNA 5CHIA 2FBYA 2BM1A 1QS4A 4JYAF 3UDEA 2WONA 4B9TA 3AT1B 3NG8A 4BS2A 3WEEB 3NNCA 2LVWA 1FJEB 4JKBA 3HHLA 1RT3B 2RNEA 3DI6B 1C1CA 4RWXA 1NJXA 1JJ2R 3V1QA 2DBBA 1T95A 5KFTA 3OYMA 3N9UC 1WSGA 3H1VX 3ZYYX 4JI7J 2LXFA 1S49A 5A0YA 4RW9B 2MGZB 3QJLA 2J9EA 3MMAA 1C0MA 3RR8A 5K5MA 1S9GB 5CQGA 4DR1K 2FXUA 1VSLA 5HAOA 1ACMB 3WEEA 1KQSM 2RSQA 2H4WB 4DPWA 2ZZTA 3GFXA 4F4YA 1XNRF 1KCFA 3PV8A 2Y8YA 2GV9A 3DLBA 2IBKA 2D0BA 2ALYB 2HZVA 2CQCA 4KH0B 4KGMA 1CXUA 1TFWA 4X64F 2KJWA 4MTPA 5E5NA 1SQGA 3E1YA 1KN6A 1JK9B 2RF2B 1HWKA 3CMAN 1ILYA 2O66A 4IG0B 4IEEA 4F4WA 3QGHA 2DPJA 4A4JA 2UXDF 3QATA 5BRDA 1W0HA 1ZBTA 2VC0A 5T7LA 3VQ8A 3BGRA 1NGHA 1K9MO 1FK9B 4YDUA 3HI9A 2DHHA 1QQMA 4KSEB 3EZWA 4JI3F 2F9DA 2QK9A 4CJQA 3CCMS 4EGLA 3OW2R 3NF9A 3KJFB 2E4LA 1TKTA 5C7PA 4DTOA 1JCGA 1Y3KA 2IM2A 3THXA 4WFBL 4YB5A 3IC1A 4B1XB 1NNDA 3UKRB 3KJVB 3CMAS 3IAS9 4F26A 4ZN3A 2I5JB 4S0MA 1KTVA 4KR0B 3U4LA 4BROA 1WB9A 1KR4A 3LDLA 1ZTWA 3GU0A 1T7PA 3VGSA 4ZPBA 4WF9L 2EG1A 1D9FA 5ETTA 2VONA 5T41A 4M7XA 3CQXA 1BWEA 1WUUA 2R3VA 1S10A 2EEYA 1JLEB 2OELA 4W98A 2G0JA 2O01C 5F8LA 1IR1A 4CHOA 2CQHA 1NJIO 1Q1KA 3C2PA 4MKAA 1I1GA 1NPRA 2FY8A 1VYAA 3L09A 2RJZA 1OWXA 3DOLA 2PGCA 4DSFA 4ZTJA 4XH4A 4OX6A 2MGZA 1NGGA 1J5EJ 4YDDB 3CUNA 1RDDA 3SQ2A 1SIZA 4IOCL 2FGCA 3D2EA 3L4IA 1RWVB 1S9GA 2A6MA 3UDVA 4IEIA 2PYJA 1IBLJ 1HYVA 4NL5A 4HCBA 3DLEB 4ZP6A 4KTZA 3TX0A 4C8LA 1TKXA 5ITHA 4CEEA 1Y10A 3TAMA 2V8PA 3D6MB 2AGOA 4B9LA 2ZWPA 2ZEJA 3CPWR 1FE0A 4CJ5A 2XS5A 4GC7A 5JVGQ 1SJRA 1WTBA 2X51A 4CJUA 3GWCA 4M3TA 2A18A 2IAJB 3H42A 3N5BA 1KAYA 3W0LA 3MD3A 3G6YA 3POTB 4BCAA 4CP5A 1UEVA 4RZRA 1YAGA 4LSLA 2FHKA 2XO6A 3RBZA 3CJ5A 4CT8A 4DF8A 4KAZA 3OUYB 5M1PA 1VQ6N 4ZVHA 2R7UA 5GAEI 4NEYA 3LF0A 1S1TB 5KG4A 5KOXA 3DRPB 3BM7A 3CJ0A 1BWVA 1N8RT 1KRPA 1WSJA 1VQYA 4FXDA 1RBRA 2YWFA 3CB4A 3OR2B 5DO2A 1TUWA 4JI8F 2B4OA 4H0TB 2VA3A 2W40A 2GMJA 3THWA 3GTYX 2F4VF 5LL6d 2OIHA 3JTPA 4CGDA 5H1SV 2O8BA 2FD2A 3LA0A 3Q8YA 3SSQA 4OYWA 2XMVA 5KFMA 2MY8A 2HMPA 5CY4A 4ZN1A 1M1GA 3K2YA 4NE9C 1XMQJ 4QIFA 2K06A 4UY8O 1MU2B 1EHWA 4OLAA 3QGIA 4X4TA 4JI0F 4DV6J 4CGJA 3S6EA 1N33K 4IQMA 3J81U 4HTLA 3HM9A 3TZZA 2XNQA 2N7CA 1S6QA 4H0YB 1X8DA 1S97A 2XMUA 3DNCA 3SCLE 1PAUB 3DRXA 3CW2C 4K4XA 3AGRA 1Z4UA 4O44A 2DY4A 1PC4A 1HR0F 3P6YC 4PL7A 2GMHA 1V4SA 3E9PA 1HA1A 2ZBQA 2R7VA 1ZXOA 4CJEA 3DLRA 2XYGB 4IJAA 3K9JA 1SIWB 1PYTA 3U7JA 4CQ1A 5IT0A 3I56S 4TN2A 1R8BA 4I69A 4EHUA 5LL6Z 1B3TA 4FXVA 3IMQJ 4XDCA 1NB2A 3H46O 1WC3A 5KG5A 3SFUA 5KGXA 2M5YA 2RU3A 1SL0A 1RT5B 2E5JA 2V69A 1SKRA 2F7VA 1F0XA 1WEXA 1FKAF 1YXQA 2O8CA 4ED4A 4E2FB 5DM6L 2GQ2A 2RB7A 1FX2A 1C0TA 3ZTPA 3I6PA 4LSZB 3OY9A 3G4SS 1C1CB 5KT5A 3EVWA 2ZH3A 1GLEG 1GX5A 4DU3A 3FSYA 2DNQA 3MR2A 3VAHA 4PRFA 2YWEA 5KFSA 3D0HE 2YKMA 3I9ZA 3MAAA 1UPMB 2RU9A 4CF2A 4Q45A 4OZ3A 3G10A 2NXNA 4CE9A 1NPKA 3QEVA 2WTFA 1IBMJ 3I0SB 3VETA 3R5CA 2W9BA 3DRSA 2VPZB 2DNLA 1QSYA 3MEEA 3ZO7A 1DFDA 5IC4B 4WK1A 1H98A 1OQ6A 2Z1HA 3LQVA 5F41A 1H2VZ 3ZT0A 3CERA 1UW4A 2OZSA 1JLFA 3TUJC 2MKYA 2E20A 2KLAA 1S4EA 1X31C 4DN9A 4IRCA 1ZZNA 3BSOA 1C1AA 4CHPA 4X4PA 2XLIA 3VWSA 4OPAA 5IT9U 2GHVC 2R7QA 5E3QA 1VSEA 5HJYA 2WSCC 4C1NK 2QTWA 3CC7N 1OH8A 4BVPA 2DNYA 4RBVA 1V3ZA 4CLTA 2VWJA 2R2TA 1YTYA 1GLCG 3KLGB 3AO1A 2QA1A 1FERA 1HKAA 4P73A 4IOCQ 3CCES 3NY0A 1O5JA 2EFPA 3K8WA 4G3IA 4DV1K 2FIUA 1NHVA 1IKYA 4FJKA 4H0VB 3ZTOA 4H54A 1VQLN 2MZ1A 2NS1B 4ZVFA 1YLXA 2CADA 1W2BR 5KG0A 5EVZA 4CLSA 4MIWA 2ZWOA 2MPUA 2RE1A 3L3VA 4DQIA 2ZDPA 4JI5F 3DDKA 4HACA 1JKHB 3R1HA 3H25A 1T8EA 3QGPA 4DWIA 4J9RA 2ATQA 1FRIA 3N79A 3MM6B 3KK1B 1RSCA 1Z05A 2QSWA 4CJRA 1JLBA 1BA0A 1E6VB 1FDDA 4B3OA 4OYBA 4DPOA 5D0RA 4FSVA 3O44A 1SH0A 1FTCA 1T11A 3MMBB 3D6TB 1VQLS 3CPWM 5HI7A 3L2WA 3Q2SC 5A2QO 3KLIB 1RUSA 2Z1JA 1X4HA 2NXUA 1UVMA 1RYSA 3NGZA 2V34A 4BLGA 4GKKF 2FHMA 2XHBA 2G8KA 1QQOA 5KRTA 3R7NB 2W7PA 5KFXA 5DDOC 4IDHA 1Q95G 2YNGB 4M3UA 2P9EA 3ZZYA 5CYQB 5DM7L 2P5GA 3V9SA 5AXKA 2OKQA 1DAXA 3W9HA 3M3ZA 2E6LA 1IBLK 2F65A 3PTWA 1WKJA 2FPHX 4NLWA 3W3SA 5LM7E 4B17A 1OPZA 2XSJA 3MCNA 5DLGA 1DURA 3VEXA 3M32B 4BRFA 3HPOA 2P9UB 3H59A 1VQON 4M3WA 2D9OA 5D3GA 1RKJA 2VGNA 4CBUA 4USJC 3HZ6A 1PO6A 1BU6O 3Q8VA 4OI3A 4CJ3A 3ZX0A 4IOXA 1YBUA 3O1LA 1RNHA 1XK8A 1HNIA 1V6HA 4PG4A 2R9LA 4CGIA 3HHKA 5FROA 2P51A 3AVKA 4F2RA 4LD0A 4LFBK 2QFJA 3PEJA 4K4VA 4LSNB 1SKUB 4GV9A 1VHXA 3QICA 2FSKA 4W5OA 1L3SA 2EVZA 3TVKA 5KFUA 4USUA 1FWPA 1I3AA 5E41A 4RNOA 2CXEA 5GINA 3DGPA 3DC2A 5IM0A 1R27B 5KRSA 3AODA 5KFKA 4WP9A 3FJ2A 2ROEA 3CD6S 3JYTA 3CC4S 4JI6F 2GZOA 2DH9A 1FKPA 1CJTB 3K0SA 2WTUA 4DDFA 5U47A 2KFNA 3VEWA 5D6GA 3CULA 2V8GA 3VGLA 3CDBA 1WACA 3G8QA 2P8IA 3G71N 3MM6A 2V2QA 1ZBFA 3WNEA 4WF9Q 2KT5A 2GMLA 3JXUA 1VJWA 3Q0AA 5HQ8A 3VAJA 4EAHD 4B3OB 5KT3A 3L2QA 4F0KA 2BJ3A 3WX4A 2HFVA 2GHWA 5AQMA 2NZTA 3QT7A 2UXBJ 2ATCB 3G6VA 3PIPQ 4AHSA 4AL6A 1JNZB 3Q24A 5B0EA 5JMNA 3NMUA 5IV4A 4P52A 2C42A 1NNEA 3GONA 5C2DA 3TA0A 2F9WA 3WNHA 2RIJA 3ENWA 2IMOA 3P1GA 2YX7A 4H5RA 2HQIA 5J2QA 1KWMA 1SUQB 4K2JA 3O80A 1JXEA 1LWEB 3M8SA 1X4GA 2AP1A 2V5HG 4K0KF 2GUIA 2VODA 2HBZB 1H7XA 5A2QY 4B9NA 1N56A 2MJUA 3BSCA 2YX1A 2O8CB 2P5OA 2ZNYA 3MECB 1IBLF 3UKUA 4BG8A 2KN4A 4PCQA 1VHIA 3AAPA 3U1MA 4FLZA 2R2RA 2RPIA 3GG0A 4PG6A 2B9WA 4EFAC 2EC2A 3ZXWA 5EHHA 2NUBA 3J81O 4CJSA 2H54B 3KLHB 2XGQA 3AA2A 4KTWA 2VBXA 1YJ9S 4GVBA 4J2BA 3AY9A 1KXPA 1NGBA 2RDJA 4ZPDA 4P6QA 4Q8FA 4HHTA 3ENBA 2G2YA 3GE1A 2EK6A 3W2VB 5AZIB 3TNVA 1SZ2A 2O8DA 3TTCA 3MGJA 1GAOA 5B0CA 3DKDA 3J80O 4X62F 4BR5A 3KKFA 2V8HA 3W63A 3OW2M 9ATCB 1YZ6A 3QZ8A 1JNRB 2MZSA 1PBAA 5C2FA 3IS9A 2Y1RI 1PJ6A 4UOGA 3THVA 2CQPA 2BR0A 4E1MA 2P9SB 2DK2A 2BRLA 2CQ3A 2JVRA 1NU0A 3KMSA 1G3OA 4C8YA 2Q0UA 1BDGA 3I31A 3EGZA 4FJXA 2QWMA 4OGCA 4B1VA 3GIIA 2RD5C 4IJNA 5F1XA 1EKSA 3AA9A 4DU8A 1C0GA 3MR3A 1OH7A 4E89A 2LU1A 4LIRA 4CNZA 2AEMA 3D2WA 1M5OC 2G1DA 4DTXA 2DFHA 5AFUA 5B7WA 4X64K 1GTEA 4KPCA 1BOTO 4JLHA 4OI0A 4M45A 1C4AA 2W6LA 3TANA 1YBTA 4MK8A 3LP1B 4E1JA 1A6LA 3SMZA 2DIVA 4EUVA 1U7LA 2ZM6J 4RTFD 5J1PA 3W5ZA 2G8HA 1RT1A 3CFPA 3DMJB 3QYYA 3MXMA 2KH9A 4AM6A 2HIYA 2VG5B 3K58A 4DLGA 1G7CB 3JQKA 1Q7YT 1TTHB 2UXCF 2XRIA 2JLEA 3H3NO 4CHYA 2FY1A 1WC5A 2HKEA 2ZVIA 3PSFA 1JLGB 1RTJB 2PEBA 1BIZA 4CK2A 3VF2A 2ZJPL 1TL3A 4C6AA 3MCSA 3WXMB 3SBMA 4E7LA 1WC0A 3L4QA 2IRUA 4BGAA 4KIAA 2ZBPA 4DX5A 5DETA 2YX4A 4ZHRA 3BN7A 2Z30B 4CJVA 5LMUK 3QINA 4ID5B 1HBMA 4MFBA 1FESA 3ELHA 3P96A 5IC6B 2CPJA 3HXMA 1TAUA 4J9MA 1DARA 2DXDA 2H48B 3TUIC 2J0SD 4Y0FA 4JI4J 3J7AP 4J91A 2E1CA 1HRHA 3QT6A 4ZA1A 3MN6A 2BQRA 3OXLA 2D0OA 1W7WA 4DEZA 1J2VA 4OKEA 4CO5A 2XSJB 3PUFA 5K8OA 3SDEB 1LQ9A 2XSFA 4CBWA 4H8KA 3R7BB 3IN5A 4P2SA 4X64J 4DR2F 3C14B 1MG7A 4MDBA 1IM6A 2VD3A 4M42A 2E44A 1HNIB 2DRBA 2QI2A 4WE1B 3H2VE 2EFOA 4O23A 2NZ4A 5AJ3K 1PJ5A 3P39A 4LF6F 2X3DA 4CLWA 1IQTA 5HQLA 3RRKA 5DS7A 5DMRA 5K8NA 2E29A 3K5OA 3VV2B 4UY8T 2M9KA 1FVSA 4OJ1A 4TY9A 3RG6A 2ASJA 3BSAA 2LQ8A 1LXNA 1PKUA 1FA0A 4M8LA 2YQ1A 2IVOA 3DOKB 3SK3A 3J7YI 4PG8A 4HR2A 2OYQA 3O9TA 4USVA 1J5EK 4Y28C 3ZETA 3C15A 3GPAA 5IT9O 5CA5A 4FZZA 4GV6A 1Q7LB 4WE1A 2YNHB 1VBYA 3EPIA 3LANA 1R8CA 4O3QA 1Y5IB 2C2DA 5KI6A 3PRVA 4DL4A 1FDBA 5LOQA 4CF9A 2EKYA 3O9UA 2OD4A 2QTDA 1XMBA 2F4VK 3ZC4A 1ITGA 2D41A 2CJXB 5HN0A 3ZNUA 1U1OA 5ADXA 1VJQA 2MDAA 3TJ9A 4H5TA 1KVCA 2AX1A 1TUGB 1KTQA 1CQNA 4LRAA 3E01A 4B1YB 2HFZA 3KUHA 3PKYA 2VG7B 3L2VA 1TELA 1HBMB 3LP0A 3QFHA 2A2DA 1C0UA 4CF0A 4J9SA 2WSFC 2EI5A 4ENOA 4Q43A 4LF9K 4OPJA 3IRWP 2DNGA 2HVEA 3QIPA 2B51A 3QNNA 2COLA 1RDCA 3FK4A 1ELOA 3EDRB 4RL1A 1RWPB 2CKWA 1WG1A 2YQ0A 2JEJA 1QZ6A 2E5GA 4R8UB 3G86A 3N6MA 2ZF5O 3NAHA 4HI1A 1FJ7A 2BE7D 3I32A 4FOEA 2BRKA 3BZCA 4LFAJ 4O4GB 1HNWF 3EL2A 5AQFA 2ZM6F 5AQNA 3PR4A 4FDFA 2KM8B 2VPXB 5E7OB 4KH4A 3OYLA 3CXCR 2R8GA 4X62K 2JWLA 1OSCA 2HNDB 4ED6A 1ASUA 4DV6K 3C0BA 2HS0A 1S1WA 1TR0A 3PLAA 3ETMA 2ZZNA 1JIHA 2YKOA 4J9NA 2O8DB 3PZPA 2QKKA 2BACA 5EWEA 3SQ4A 2W41A 4RW9A 1X5TA 5CXTA 3TWZA 4DV3J 4G1QB 2HNZA 1Q8KA 3ID6A 4KC5A 2AT1B 2E2PA 1TL7A 3WXLA 1CULA 3ILLA 3FFIA 1IBKK 5HVFA 1TUVA 3FC9A 5H9FJ 4HUFA 4H0OA 1SKSA 4NXNJ 1IKWB 1YJ7A 3P49B 1X9WA 4IKFA 1VSMA 1QAJA 2VQFJ 1BO5O 3SQ0A 1WF1A 1OVQA 4JK9A 4TYBA 3PDNA 4FWRA 4RUBA 4HH0A 3CD6N 2XGPA 3AJ2A 3L4BC 1LW2A 1RT2A 3T1HK 4CH7A 3GIJA 3DOLB 1R6YA 5AQUA 3JS9A 5C2CA 1YDLA 1S72S 4L74A 3VQTA 3LP2A 3CPEA 1WHWA 4K5RA 4FBUA 1I94K 3U9ZA 5T7LB 1YIJN 3UD5A 1HLUA 2QEXS 4ZS6A 3OD2A 1RHKB 1RILA 3WQUA 1HQEB 1WC4A 2MZJA 2MLZA 3MM5B 4IO9Q 5I42A 3UCZP 1BQMB 1R0CB 1P90A 3CCEN 4XH1A 2SXLA 2NPIA 2CRLA 5AQKA 2AJ0A 1VK8A 4FLTA 3KJQB 4FYVB 1T6CA 2FVRA 2KO1A 1CZBA 4N41A 1BQXA 4ES1A 3M2VA 1U8WA 1KVIA 5KFBA 2DY9A 1EZZB 3C6TA 4F9OA 5AQXA 4RLEA 1OMSA 3FQLA 3MR6A 3H20A 1RTIA 4WQ4C 3HX9A 2ZNZA 1Q9XA 5HRRA 1XC3A 4CVNE 3LDSA 1RA7A 4QWDA 3H7HB 3HSGA 3ZSYA 3CCLS 3SMSA 3CJCA 3DRPA 4M94A 4K2XA 4ECZA 2IC3A 2ACMA 4NLYA 3ENHA 4DTMA 1U1NA 3P38A 1M1KT 4LF4F 1R7IA 4P74A 3WNFA 3BEGB 3OXGA 4ECRA 2MKIA 4FJHA 1NK8A 1KS2A 2IM3A 1WLJA 3N5FA 2ROPA 4OZ1A 4C2MA 3MXHP 3QT5A 3MHYA 3O08A 4WKRA 1U0HB 5DG7A 2KRBA 3NLCA 2LP4A 1MWYA 3OFHA 4ISGA 2QXLA 3NS5A 3C6HA 1NJZA 4WYBA 1T03A 5F8IA 3ZZZA 2Q43A 5HBMB 2MLXA 3I9V9 2C3OA 1KOOA 2DO0A 4C97A 1NJYA 3I55N 1AB8A 2VASA 3EM1A 3HVRA 2XY8A 1U47A 1S5JA 3A5MC 2GAHC 1T05B 3QEXA 3MPDA 4KHPK 1B64A 4F4KA 4NLRA 1U26A 1RBTA 2LYVA 4JI5J 1GLJO 3NF8A 4FJLA 2LXUA 4MK7A 4CEDA 2CQIA 1XMOF 2WHOA 5L1IA 2OEJA 4FW1A 4D3GA 3PKMA 1WI6A 3CJ3A 3JB9k 1RDRA 2EFQA 3NHGA 1UAWA 2PMHA 1D5AA 1RT3A 2I8EA 4CIEA 4UF4A 2OPSA 4I4BA 2ZBRA 3UE2A 3Q8PB 5LJ5Y 1FVQA 3BF4A 1CG2A 5DM6Q 5DG8A 3NF7A 1UAXA 1XR6A 2F5GA 2HQCA 1PYOB 3HF5A 2DR5A 3HPGA 5KT6A 3H40A 1BWFO 3RJMB 2P9LA 1P1LA 4X65F 4E3SA 1LWFA 4JV5J 1Y5NB 1NBEB 3MMAB 4PPDA 4PKHA 3F44A 4R25A 2V0NA 1WJ9A 4GO5X 5EY4A 1LAVA 2P1JA 5D4LA 2GJIA 2P9IA 2IJRA 4XAKA 2V7YA 4OKJA 5C12A 2XLKA 5ETRA 4H4KA 1GMUA 4JK8A 3FMWA 2DHGA 2V4QA 3MMCB 1TL5A 3EE9A 3W7BA 2DRAA 3ZZ0A 5AXNA 1RABB 1XERA 5BPMA 1L3TA 5A8KA 4CERA 4BWMA 3OJUA 3HSJA 4FWQA 3RMCA 4ZJQA 2VDHA 3LL3A 4L3NA 3SNNA 3QJJA 3DOMB 3RAQA 2PI5A 3CVKA 3LP0B 2QM1A 3CJ9A 1JXVA 1B0PA 3EZOA 4DZDA 5DQIA 3SQ1A 3TZXA 1JQGA 1J27A 2UXCJ 4B1ZA 1S12A 3T41A 3ULHA 3IA0A 4ZCIA 3EXCX 2HHHK 2MKJA 3EX7B 3N4PA 3R8YA 4R5PA 1RB0A 4OI6A 3LH2S 1U0HA 1SQEA 1BIUA 3T5HA 1F6TA 2KKHA 4F4XA 2D1KA 3MM7B 2LDIA 5LJ3Y 4KO0A 4USWA 3GIKA 5BPNA 2RRBA 1N5QA 5F8MA 4K4UA 4CHZA 1K8AT 3W2WA 3C19A 1YT3A 4CK3A 2UUBJ 1KSPA 2BM0A 3D0GE 1N34J 4RR5A 2ETJA 1QVGM 4TQRA 4DR3F 4RNNA 3K5MA 4K50A 1K0VA 4FJ7A 3G25A 3R1LA 5FPNA 1HARA 1MNEA 4DSLA 3H08A 2DPNA 2J4RA 2L9NA 3I87A 2CDRB 3DM2B 2WVEA 5IWAK 3PX0A 1DTTB 4FVMA 3CETA 7FDRA 3S3OA 1AFJA 4C8NA 3LTOA 2B4UA 1N36F 1NKCA 1S4FA 3VESA 2PFDA 2W4CA 3BGLA 1R3NA 1RDUA 1BQNA 1DT9A 3BYRA 2D74B 4LF7J 1H2TZ 1NGDA 3BF1A 4EIAA 3VGTA 1UA0A 2QX0A 1RZMA 2CPFA 1D09B 1MWZA 1XNRJ 8RUCA 2QLFB 1HKBA 2HIQA 5G0RB 4J90A 4CZIA 5HROA 4DN0A 5KAKA 1B0VA 4XTTA 3ZSRA 4NLUA 2N3OA 1UETA 2P9IB 4CEZA 5CD4H 1NK0A 2ZKTA 3DRRA 1X3MA 1LW0B 2WC9A 4IRDA 1T3VA 2IVMA 3HVAA 3VQDA 1NGEA 3C16A 2YHAA 1RLCL 4PABA 2CDQA 3TR8A 4BY9C 2O3DA 5SZTA 5H9FK 2B7BB 4C0HA 3OBIA 3QQCD 2IGIA 1P8ZA 2ZJRL 1X5OA 2LLZA 1M1HA 3FCWA 2DYAA 1KP6A 4ZVGA 1HI1A 3H2UB 1VQ4S 1B4SA 4YDXA 1VI7A 4BRNA 2XY7A 4ZPVR 5B08A 5KFJA 4TU8A 2DR7A 4KB1A 2HK2A 4ECUA 4TU9A 1XN9A 2QT7A 4K4SA 5JJBA 1V9OA 4J5OA 2OTLS 4LBIA 1RCOB 2CG4A 4BC3A 3ZSXA 5GAGP 4YB6A 5KFWA 1Q4RA 4Y3CA 3ZZRA 1IVZA 1KQGB 1UFWA 1NOZA 3WXKA 3BYPA 3K89A 1JB0C 2AKWB 4M5NA 2M88A 4K0KK 1QZ5A 5AE1A 2JDJA 4U96A 4JKGB 4FVCA 5CZVA 4NI2A 1WWHA 4WFXA 4LFCK 2A3JA 3JTOA 3VQCA 3C6TB 2XEXA 1FRMA 3CI5A 4BRAA 4BC5A 1VQ7N 2QA4S 2IDOA 4X62J 2JZ5A 4OI2A 4JRPA 3P83D 3HOSA 1WSHA 2UV8A 4Y34A 4LF2A 2QMWA 4X65J 3IM8A 3OT9A 1TK8A 4DV0J 3FUYA 4EI2A 4DFPA 3THXB 2E7XA 1X4DA 6AT1B 3R6GB 4BGBA 2QL7B 1GLLO 2NUHA 4CLUA 2WVCA 3SCKE 5B0AA 3NBPB 5LMNF 5IT9Y 4IFEA 2P6SA 4M5DB 1VISA 4CZHA 1YTUA 4LFBF 3AO5A 3MM8B 4NA3A 3PIOL 2GV1A 2HRTA 5HSPA 2HSEB 1FKPB 3BPDA 3IRXA 2Y9HA 5C42B 3D45A 3V81A 5E3CA 4QIWD 3V6DA 4WJBA 4DR7F 2G1HA 5GIPA 3AVNA 3HVTA 5GAGU 4FKXA 3FFKB 4LH5A 1B0TA 4W90B 2NSCA 4BR0A 4DS4A 5GAGI 1HLWA 3R6MA 5AQQA 4MK9A 5AQIA 3LWMA 1BC6A 2AJ1A 3W65A 3T7ZA 3FBEA 4DV6F 1TL4A 3D6HB 3QBCA 4K4YA 3OS2A 2PD1A 3OJSA 1A0OB 4CIGA 3NMRA 3WHIA 2C3YA 2NRRA 2D3O1 2DVIA 4EZ9A 4CZLA 3HT3A 3TAMB 3J7A1 5K9FA 1FWLA 2DCLA 2LCWA 1N34F 1UZHA 2UU9K 1D3WA 1SUQA 3O9QA 4JD2A 1H72C 2FB0A 2OFHX 4QW9A 3OVBA 5E2QA 4Z4IA 4MIBA 1WTFA 3PX4A 3SLCA 4RBTA 3EVMA 2H3EB 3ZT2A 3OLBA 4ED7A 4DQRA 4TLRA 2CIMA 3AQPA 1RAIB 4JBCA 2WSEC 4J9OA 5F9NA 3D67A 1M1KO 5HO4A 3BO2A 3MECA 1U48A 3G6XA 1OKJA 1RAGB 2FQQB 5KFZA 3I5AA 1RBVA 2P9NB 1BA1A 3CCSN 2AP6A 5IXUA 3N4WA 3PHTA 3CTRA 1W2BM 3QMLA 2AJ2A 3J7AN 1NU4A 3PSIA 4Y0WA 4J9LA 3TW0A 2R7XA 1Y7PA 4WBFA 4A8OA 3TQ1A 4KPYA 2W9AA 5AQLA 1T9TA 2GGPA 2I0XA 3CC2S 2M3DA 1S1UB 5KFIA 4HTIA 2VWBA 4Y2AA 5KFCA 4YOWA 4HWIA 2E1ZA 3MX5A 3HT0A 3CWJA 1NHUA 4F67A 4L3QA 5CE3A 3DLKA 2NRTA 5F3ZA 1HJOA 3CCSS 1FCAA 4NLDA 3SYZA 2CA9A 3V81B 2IYGA 1JWWA 1ATNA 3MPVA 3TI0A 4QU7A 3GFHA 1MU2A 2YHYA 1HQUA 3MFIA 4LF7F 2IVYA 3NEKA 2UXDK 5J2QB 3T1YJ 5HMWA 4ID1A 1FRXA 3WC0A 2M52A 3MCMA 1U1QA 4ILJA 5CAAA 3BDEA 4CNYA 3QDKA 1TV6A 5FPDA 1UVIA 4IO9L 1QTNB 2O67A 3GR1A 4O44B 4CZFA 4I1TA 3MAQA 4URGA 4CIOA 2VYPA 2YNHA 4BWJA 4BDYA 3LPUA 1LWXA 3SI6A 4V1Ak 2DGTA 1YRTA 2W9CB 4PAAA 1KAXA 3OTOF 3KJNB 4RO0A 1K8KB 2QG9B 2IBOA 4Q44A 1RI7A 2CWXA 2LKZA 3MMJA 2W2OP 3KYLA 4DTUA 4FNHA 5AR0A 3E8OA 3D2FB 2ZH6A 4NWBA 3TARA 1RT1B 3O8MA 1TL1A 2F4FA 4DG1B 4I6MB 1XNQJ 4FWPA 4R0EA 1U2VB 1CJTA 3ET6B 1SJFA 3SXLA 3EO3A 1H3DA 4U67Q 2QYCA 3A8KA 2XYHB 4BE2A 3VCDA 5CYQA 1IXKA 2MQQA 2VA2A 3NWRA 4X66K 3PJXA 3MM9A 2D1CA 1N5SA 1K9MT 3EY1A 5RUBA 3G8TA 4P2FA 4NCAA 3E3XA 3KDOA 4A59A 4I7FB 1YZ7A 1RT7A 3F73A 5KFLA 2JVOA 2YKMB 4KGVB 4CM2A 1GXUA 4I6MA 2EX3A 3D2EB 3R5JB 1SJQA 4DL5A 4HT7A 2BQ3A 2KL8A 2KT2A 2GX8A 2K1RB 4A47A 5LJVA 1OIAA 4QU6A 2MJNA 4B9UA 3TOQA 3FZLA 1X4AA 3O3LA 5TKYA 3ILJA 3N0VA 2QJ3A 4DV0F 5K14A 3CCJN 4OPKA 4QWAA 4W5TA 1W97L 3A8YA 2E7VA 3QAUA 4IG3A 4G1IA 4WYWA 4BC2A 4WK3A 2H4YB 1LCUA 2KDOA 3H45C 4FJNA 3LZIA 2L48A 5M2UA 2CJKA 1MWMA 3IGNA 1ATRA 1HNXJ 4EP4A 1GLAG 1VQ5N 3HDSA 4MYUA 4F04B 3LALA 4FXWA 4BRLA 1XEZA 2NLWA 1TFYA 2VFRA 3I4HX 4RUAA 3KNGA 1HUXA 1BHNA 2BX6A 3ZLJA 3L7PA 2JSXA 1GLFO 4UTGA 4OPHA 3ITHA 1YI2N 4YS2A 2HURA 3KLGA 3Q7BA 5KG7A 1WSIA 1WHYA 2JL9A 4I64A 1TL3B 3JS6A 2VF3A 3CJKA 2G8VA 1R0AA 3E2EA 4QS8A 2GCFA 5KFAA 4PXCA 1IG8A 1J5OA 3W61A 5ETSA 4PG5A 4Z94A 5DQGA 3BQ1A 3AA4A 2FVQA 4O8KA 5I3QA 1Y5LB 1NUEA 1XR7A 4DL7A 2V9KA 1Q8BA 4U67L 4ES3A 5L1LA 5F3TA 3A8EA 1ROFA 4B3RK 2VBWA 1ZAVA 1S3XA 4EK2A 1JMTA 1Z25A 1Y9OA 3TP2A 1Q5VA 3IM9A 4NLTA 4N8OA 3HL8A 4R79A 3SQGB 3CJKB 4LF1A 2Z0GA 1JL1A 5D4NA 1APSA 1V4TA 3NNAA 2E2QA 4XEIA 2CQ2A 2HSTA 2HHHJ 3MCAB 4CZGA 3RB0A 2RQMA 3LGNA 5GMEA 5KFFA 5AQSA 4QW8A 4LBPA 4OJGA 1R0BG 1XNQK 3VQ4A 1JLAA 1QSLA 2XY6A 4YB7A 2IMWP 4KHRA 4QPXA 2V9WA 3RAXA 3G71S 3MCOA 4WFNL 2R2SA 4CI0B 5CCLA 3D0IE 4QAGA 2U2FA 2HBJA 4TY8A 4CJPA 4FWLA 1S1VB 4QWCA 2W7OA 2HF3A 1WOPA 5LT5A 2HVIA 1XTZA 4NZ0A 3ONQA 1RGIA 4DHVA 1HR0K 3NGRA 4BC7A 4ECSA 4GNIA 2UXBK 4CO3A 3NXZA 3DOKA 1VQ9N 1Q82T 3J8AA 1H6KX 1SC6A 4CEOA 3NFAA 2CVIA 4OX9K 3A3PB 2UVRA 1TVRA 3JAMY 1YRUA 1ZS6A 1HMVB 2E9TA 4AHRA 4DI6A 1GFWB 3LGMA 5SWMA 3TYTA 4HTUA 3TQEA 3UCGA 3M8WA 3ZFVA 2X1FA 5KFGA 5MAOA 2QA2A 3HLUA 1JLEA 3J7YU 5KFDA 4AXJA 7FD1A 3K59A 5HBMA 3NWGA 4B3MF 4C8KA 1DGKN 4ID5A 2N4DA 1NH8A 2RS2A 3R97A 4LQ3A 2QRRA 3SV4A 2E2OA 3DFEA 4RBUA 3H2LA 2I9SA 3B6BA 2FHJA 3D9BA 1CLFA 2H5JB 2JFDA 3KLVA 4IDKB 1VLOA 2QWQA 1NSKL 4ED5A 3A0IX 3D6FB 3DLLL 3C94A 3SDEA 3CCLN 4KH1B 2BANB 3MX2A 1FJGF 1A5WA 1VSIA 3Q8QB 1REVB 2G0CA 2R2UA 5DQHA 1F9HA 1S76D 3A2FA 1X1PA 4EHTA 4PWDB 1H7WA 2KXNB 2G9OA 1G6BA 2Y0SD 4CH1A 4N5SA 2UUAJ 2XMTA 1BY9A 2QO3A 1EO1A 3CDWA 4MO5A 1NB7A 4WZMA 2OCEA 3DHXA 2YHXA 2ASOA 1RCXB 2E5LK 2UUCK 4M3RA 4CLLA 2E88A 3M8PB 4A2AA 3BGFA 1L3UA 3G2XA 3IAM9 4OYMA 4UQGA 2HF4A 1O0PA 1JLQA 4NA2A 4NPOA 1SBRA 3PR5B 3MZIA 1S1TA 1NZAA 2PI4A 2V4JB 2XYPB 3D6RA 4Z4EA 1JL2A 3H1QA 5AQVA 4HACB 1P1TA 4GKJF 5KTQA 4F7VA 2J9DE 2P9KB 2G0IA 4HDHA 1C1BB 1H38A 5SUHA 2C2NA 4ZVEA 2Q2RA 4BRGA 1Q79A 2HLTA 3TUPA 3V9WA 4IH5A 1HMVA 4KBIA 4QCLA 2R4FA 3CJTA 3RZAA 3BUZB 2GQCA 4MH8A 3MR7A 3HPHA 3PIOQ 5E3PA 4GC6A 4Y2MA 3T5JA 4GVBB 1U09A 4LRCA 3KOAA 3O1BA 2DITA 4M1KA 1NGFA 1B92A 1EX8A 1UJ5A 3W8GA 1Y4ZB 4CH0S 2RDDA 3X3UA 2OI2A 4RW7B 2C3MA 2HAIA 3Q8SB 2QLXA 1KNZA 2N4CA 5HP1A 3MI7X 5KG2A 5JLFA 3CCWA 4C3MA 3IG1A 4B9VA 5B0GA 2R7YA 4O0NA 3S01A 1QHTA 4NMLA 1YF5L 3ULEB 4ED8A 1CJUB 2FJXA 2GC8A 4FJJA 4ED0A 1TGOA 2LEAA 2QSFA 2BBEA 2E7WA 3QT8A 3ISND 1JLCB 5I3UB 3H90A 2XLJA 4CFAA 3GBTA 1EQYA 2BE2B 1WEYA 4WPAA 4OJ3A 3MEKA 3DXKB 2W2MP 4JI0J 3MWPA 4FM2A 3T19A 5J2NA 4Q7AA 4CK1A 3QSYB 3VAIA 3MDQA 1IR0A 1YBAA 1ZTTA 2O5DA 3AJDA 1TK0A 2XCPA 2POKA 3IDHA 1WF0A 5CHCB 5F8HA 4YOUA 1I5OB 2B43A 2Q97A 1HR0J 2OTJS 4DSJA 1EWQA 4BDZA 2XMJA 1TK5A 4K5SA 4ED3A 1X4BA 4LR8A 2V51B 4CJ4A 2XZWA 4KAIA 1GT8A 2FSNA 3C6AA 2X7IA 3V6HA 2EHGA 3MEDB 1OS5A 4U9RA 2ADBA 2ZVSA 4TSXA 1CS4B 4YFUA 4O3PA 3QEPA 4FYDA 4USIA 3AVLA 3U27A 1T94A 3SCXA 2NUUG 3MWTA 2BJ7A 4JKEA 4DV4J 2HMIA 3SV3A 4A61A 3FEYB 5KFEA 1YKWA 1RDBA 3VQ7A 1HYSB 3QWPA 1RWMB 4N7TA 1JLGA 3AARA 4ID8A 1KD1O 1S6PB 4NYZA 1HHQA 1S59A 2B4PA 4B3MJ 3Q89A 4QYZJ 1K6YA 4ICLA 4DV7J 4JI4K 4FK0A 4K0KJ 3D1HA 4KHMA 3VQ9A 5A8KB 5L39A 3TVZA 4C1NI 1ICEB 4HDGA 1MW7A 1ZM9A 1ZM3A 4QOTA 1T3OA 3PW7A 1ZPVA 1ASVA 3OTBA 3F41A 2QIFA 1JJCB 1RT4B 3VN5A 3QRRA 4FWMA 1OY9A 1CZAN 3ZEUB 4OYOA 2PMZD 2B9EA 5IZHA 5BPLA 4ALZA 4DL6A 4PUOB 2BQUA 4I9LA 3S8SA 1PG5B 1FXLA 2E5IA 4CZJA 4OZ0A 2BEFA 1KQSR 3KTQA 1WBDA 4Z0UA 4ECXA 2AYGA 1O51A 4B3MK 4DV1J 1ZM4A 3T6BA 4X84A 4CEQA 3PJWA 1F2HA 2VJVA 3LO3A 4U7UD 2ILZA 2RF2A 3OYNA 2CJ9A 3LGHA 2MB0B 5IQQA 5L9XA 3IXQA 3KWGA 1H1VA 3OYCA 1FNOA 1QTMA 3U8XA 4DUTA 3VHQA 2A1BA 2VFSA 4OL8A 3A8JA 1EIYB 3KLFA 4KTQA 1NK7A 4JN4A 1IKWA 1J6ZA 3T1YK 4KFBB 3P45B 1RTDB 3MXJA 5JS2A 3HVWA 3D4JA 3OVAA 1XHXA 5C24B 3HFVA 4OX9F 4C3LA 1B99A 2UUTA 3EGNA 4F36A 4DX6A 3HVTB 4A5AA 5GADP 1WDDA 1VK3A 3SMPA 3WT0A 4CZEA 4JI8J 3CC7S 3LPYA 3MMBA 2FDNA 5LMNJ 3MTJA 5E26A 3NCRA 2A0FB 3MAHA 3PW2A 4OYZA 1S9EA 3A5NC 3ZCMA 2X6NA 4YDUC 2Q31A 1RHMB 4MMOA 4RW8B 3MUVP 2YWGA 4KHYA 1S6PA 4ECVA 1NGAA 1HW9A 2YNGA 3GG1A 2O8EA 4RPFA 3RBDA 3QSIA 3VQBA 4FYWB 2E1PA 4O4RA 5GVQA 2C28A 3DAWA 3RR7A 4USMA 2RRAA 4OI4A 4KT0C 3BGUA 2JWNA 3E01B 4LT6A 4GKJJ 3W64A 2AJ4A 3GMGA 1VFJA 2IRYA 3CCRS 1RT5A 2W7AA 3SCJE 4CZKA 3CDEA 3NF6A 2YWWA 1WC6A 4Y2KA 2J6UA 3M30B 2Q36A 3VVUA 2I38A 2P9PB 3UB5A 2KT3A 4CIFA 1RTIB 2QWLA 3H3OB 1SCJB 4O0JA 1JLQB 1N54B 2VPWB 4KY3A 2O8FA 3KUGA 3C6UB 4HLBA 2L41A 2HNYA 2BW2A 4NRUA 2XULA 2IC3B 1KVKA 2XY5A 3AXMA 5JVHL 2P9KA 3MAAB 3AVJA 1GLDG 3L8BA 4DTJA 1NEEA 4JI1J 4KGXB 4H5WA 4QYRA 2JRSA 2A6AA 4F0MA 1Q8LA 4LUBA 1VC6A 2QWOA 1NPPA 3FRYA 2GEMA 4FKYA 2ACYA 4UUXA 3R3LA 1R8PA 4ZDNA 5CZ1A 4YR0A 2ZH8A 5DLFA 3ATVA 1RAFB 3GLJA 1X7VA 3I56N 4F3OA 3AVGA 2AJFE 4Y6IA 2ZBIA 3IBFB 5HL7L 2RILA 2ZUAA 2FLOA 3K0JA 4MIAA 3OHAA 1LV5A 4BRPA 1OY6A 2KKZA 4BHQA 3M7VA 3IG1B 2CNLB 2E5HA 3T1HJ 4G1QA 2RS8A 4CZMA 5DDQC 1TYQB 4ISEA 4CJWA 4FM0A 5CH7B 1NM1A 1IBMF 4NCBA 3MWBA 1N5YA 1NGJA 4U7UK 4CW7B 3FFIB 2HFUA 2OAUA 4EP5A 5KT7A 5C42A 4QIVA 3RMDA 4W5NA 2QXFA 2QWPA 1SH2A 4I2PB 4DV0K 3E9LA 1AZSB 3TZYA 1MMNA 2ASDA 4B3SF 4WFAL 3ENOA 2E1YA 3NOGA 3LZJA 4DCPB 3O3HA 3O6QA 1QJHA 4DXLA 3QNOA 3J81Y 1X9SA 2LQ9A 1D0EA 4BVOA 4YP3A 4NA1A 4PXEA 2YH1A 3JAMO 3NAIA 4PWWA 4LFCJ 5LXYA 3VQQA 2KG1A 2WFBA 1NBWA 4DR4F 1V3RA 5HL7Q 2LU2A 3VQPA 4FF3A 3OS0A 3UKUB 4JI1K 2YNFB 2YY3A 4JV2A 3AV9A 1RU2A 2O4GA 4DPTA 4RX6A 2ZC3A 4CRJA 3PJ9A 4G9ZA 1S5ZA 3US5A 4RWWA 5A0YB 2HHQA 4AHUA 4JK7A 3V4IB 1RYRA 1NSPA 2HHVA 2V2KA 4HYKA 5CZ2A 2GIQA 3S1TA 3G9CA 5AZJB 2DGWA 4G6VB 4NXMF 4AHTA 1P27B 3DHWC 3H6EA 1WSVA 4R5PB 1FI4A 3WDOA 4OJHA 3GB0A 3HOTA 2WVDA 5FPMA 2EXUA 2ZJQL 2R8JA 2XMMA 2I2YA 1NH7A 1G2EA 4RU2A 5KFRA 1HQ2A 4BRDA 1Q86O 3AVFA 3W2WB 1BMQB 2F9TA 4E7KA 1PILA 3A8IA 3VTIA 4JV5K 3IMXA 1YSJA 4LFAF 3M6UA 4M7YA 2DFEA 2ZHBA 5HQMA 5BR8F 1R31A 3O5BA 2D0CA 4PL8A 4IYQA 1EJ7L 1KQKA 4DR1F 2CH5A 2MQPA 1S72N 1WAFA 2EWSA 4GKJK 1N5YB 3SCIE 4PA1A 1VHFA 3EMTA 5HRSA 2OFGX 2KI2A 3OYAA 1X3NA 5M1KA 2GUPA 1FT8A 2ZJRQ 3F9MA 1ZBSA 5AQHA 5JXSA 3QERA 3EWGA 1H73A 1KLNA 2UU9J 4ANDA 2DHXA 3TABA 1XQIA 4OHXA 1D4XA 1KAZA 3D7EO 1RP5A 4KB7A 4CHQA 2R7OA 4CI6A 4CZCA 1WORA 4ZIVA 1SC4B 2OD6A 3FEZA 2E8AA 3VEZA 3B6PA 3R5DA 1LW0A 2ZDOA 2A10A 4M5GA 1EB0A 4CJ7A 3K8VA 2F8TA 3GSIA 4ISFA 2FVCA 1BGXT 2KHCA 1RWXB 4K42A 3CO9A 1NLKL 3C16B 4U8VA 5GMDA 4JYAK 3GFYA 2VQEJ 2QLJB 2ASPA 2HQDA 1VLYA 4PZVA 2CPYA 3OVNA 5BYSA 3T9ZA 4DV2J 4XH5A 2PYLA 4F25A 3NGDA 1IJFB 2VBZA 3QESA 3SSRA 5HVHA 1Y3JA 2VQEF 4B1UB 1CLQA 2FF6A 2OP5A 1A5XA 1RE1B 1ZZFA 4QOZB 4E7JA 1IM4A 2HHXA 4QYZK 2LA6A 1IBKF 4BR4A 4FWKA 5M1OA 1NJWA 4MFBB 2IA0A 1WF2A 5E84A 4GY2B 2Q1LA 2YCHA 3L7UA 4A8YA 3NH1A 3D3BJ 4GW6A 1A9NB 3P4UB 3L9ZA 3OSNA 2K3KA 1RACB 1N5TA 2CUYA 1JLBB 2DB1A 4KYZA 1VBZA 2H65B 2G8IA 4KV8B 3CJ2A 3GJQB 2YV0X 4B8AB 3O4WA 3OPKA 3V4MA 1AXQA 4FJMA 4ZVRB 4P75A 2J7KA 4QBUA 5DDPC 3PYDA 1U1RA 4DV4F 4CECA 4NCGA 1H2UX 5CCMA 3CF5L 1X4FA 3RRHA 2CZ4A 3B6OA 5J2MA 1U45A 2Y1LB 2QLWA 3W1YC 5I9EB 4YOXA 1XMQK 3VMFB 2L9DA 3HSCA 3M2RB 2NLXA 4Q0BB 3PM9A 1X5PA 4CESA 1MMLA 2HNYB 1TMJA 1B7YB 4DUYK 4ZJLA 1TMMA 1A5VA 3HYFA 2IHR1 4ZP9A 3NBPA 3Q2TC 2MYFA 4YUDA 4A8WA 3F5TA 2AGPA 1OO0B 1P9QC 3QMQA 1IKYB 1NGCA 5AXMA 1ULRA 4KHSA 4YN3B 3ZETB 2OTLN 2NR