1HQEA

Human immunodeficiency virus type 1
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
554
structure length
554
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords POL POLYPROTEIN
publication title The Lys103Asn mutation of HIV-1 RT: a novel mechanism of drug resistance.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 135
structure length 554
sequence length 554
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2000-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1hqeA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1hqeA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1hqeA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1hqeA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1hqeA05
5E41A 1RYRA 1WSEA 1RNHA 1DTQB 3I0SB 1WSGA 4YFUA 1CSJA 3RMDA 2XI3A 4XPEA 1IKWB 1UWBA 4F2SA 1S1WB 4ID5A 1SH3A 1KVCA 4IG3A 2W9BA 1VK0A 2O4GA 4E7JA 3DOLA 4YP3A 4ED3A 2R8HA 4O5BA 2WK4A 2ZQBA 4CF0A 2JC1A 3GILA 4N76A 5SWMA 2E9RX 1TL3A 1RBRA 4W5NA 5CYQA 1VSLA 4Z4FA 3QZ8A 5KT3A 1SH0A 3SQ0A 1NK5A 1KLNA 4CE9A 3QEWA 4NRUA 5HROB 3KLEA 5KFTA 5KI6A 5KFOA 2R8IA 1LWEB 3VQCA 4Q43A 4RW6B 3DRPB 2DTUA 4WZQA 3FQKA 4KHYA 3LP2B 2O5DA 4B9SA 3TWHA 2XGQA 4GC6A 1IKYB 2VG7A 4IRCA 1S0OA 1JLFB 3RRGA 1D5AA 3UDLA 5JS2A 4LH4A 1YTUA 2VG6B 4CJPA 4DQRA 4Z4CA 4TY8B 4EBEA 4RW9A 3G0ZA 3MEDB 1NJXA 2KQ2A 3ZT1A 4EYIB 3AVMA 3RB6A 3LALA 3OYEA 4CGGA 2R2SA 3QEIA 3JYTB 3QEVA 4KB0A 4O0JA 5J2PB 3DRSA 4DTUA 3LZIA 1RDCA 1JLGA 1JKHB 2BQUA 4EBDA 3CWJA 1EKEA 4KHSA 1WSJA 2F96A 3I8DA 4I9QA 3S3NA 1UWBB 2HWHA 4ID5B 3HP9A 2IC3B 3S9HA 5L9XA 1KVBA 4B9TA 2D7SA 4CEOA 5KFPA 4CJ3A 4FM0A 4JRQA 4FJKA 3P1GA 3LP1A 4I2QB 3QGHA 1TV6A 1GX5A 3IAYA 1HMVB 1JLQA 5KFFA 1L5UA 5CYQB 2V4RA 4ZVFA 1LAVA 2BRLA 4TY9A 1TKZA 1TK0A 5KG6A 3PX0A 1S1XB 4EZ9A 3IG1B 3HYFA 4IDKA 2B6AB 4B9VA 4FW1A 4YR3A 1BL3A 3AVBA 3WNEA 1U4BA 3KLEB 5KFBA 5F8LA 5CZ2A 3G10A 1QHTA 2FBYA 4NCAA 4FBTA 3QLHA 1ASUA 4EP5A 5FDLB 2XWYA 4ECVA 1NK0A 3V1OA 4GMJB 4Y2CA 1JXLA 2XY6A 2IJNA 1U04A 4J9KA 1S10A 2FVCA 5KFKA 2OZMA 4M3XA 1DLOB 3C95A 4YR2A 5KFRA 3L2RA 4RW9B 4XIUA 1SKWA 4NLUA 4FVMA 3HM9A 4KTZA 1S9GA 3CDUA 1CXQA 4CIGA 1HPZA 1QSSA 4KFBA 5JUMA 3MEEA 4JRPA 4DF8A 3NH2A 4O3NA 1RTHB 4DMNA 1S6PB 2XI2A 4CHOA 4DTSA 3PO5A 4ECSA 1SV5B 3VQDA 2G8IA 2ZE2A 3DRSB 3SUNA 4IFYB 4N47A 2YNIB 2ASLA 5KFZA 4IH5A 4KTWA 1QQCA 1K6YA 2YKNA 1C0MA 4X2BA 4OGEA 4ZP8A 4Z4IA 3BSOA 2ATQA 4IR9A 2QE5A 5KT6A 3HP6A 1LWCB 3WNGA 4CERA 4KKOA 4DTPA 3LP1B 4DL3A 4ECWA 1TV6B 2C28A 1QE1B 4QWAA 4DU4A 1JLQB 4JV1A 3KLGA 2P51A 4M95A 3KHGA 3H08A 3SPZA 4DTNA 1RT4A 2HHTA 2E9ZA 1YT3A 4RW7A 5CYMA 3SPYA 3SI6A 1HRHA 3QLHB 4CK1A 4NYNA 4OGCA 2OPPB 1RDBA 1S1VA 4ZPCA 4OKEA 1FKOA 1XWLA 4LH5A 4TXSA 2ALZA 4YQWA 3PW5A 1IG9A 1BI4B 1GX6A 4NLGA 4JS4A 3MEGA 5KGXA 3THVA 4FK0A 5L1LA 3RB3A 4K4YA 3MXIA 1HPZB 4KFBB 3MEEB 5FRNA 4CGHA 1C0UA 2RDIA 2AJQA 4PY5A 2NUBA 3BDPA 4DQQA 1S9EB 3TAMA 4JUZA 3SNNA 1LW2A 2ZE2B 2D41A 3QGIA 3TANA 4MIAA 4NCGA 5J1EB 4Z4GA 1ASWA 2P1JA 2E4LA 5EWFA 3T1AA 4QWCA 3NF6A 3V4IA 1ZBLA 1N5YB 3V9UA 3KLVA 2EC0A 4C8LA 4ZTJA 4NLTA 3NBPA 1NHVA 2FVPA 3VQ7A 4BWJA 1XHZA 3M8QA 3V6DA 3PHEA 1A5XA 1RT3B 1N6QA 3HSTB 5HLFA 2AGQA 1RT4B 3V1QA 4I9LA 4KSEB 3QIDA 4CGJA 1JLCA 4RW7B 1JXEA 4CJQA 3RTVA 2JEJA 3IS9A 3KLIA 4OKJA 2RDJA 3LANA 3P83D 4FLZA 4IH6A 4K50A 3HVWA 3QO9A 2XCPA 2IM0A 3CJ2A 2ASDA 3NMAA 3CO9A 3V6KA 1S1VB 4Y2AA 4DFPA 1C1CA 4H4MB 4R5PA 3MFHA 3RAXA 5EWEA 1I3AA 1HNVA 3L2VA 4J9LA 1RTJA 2G8KA 5KFVA 1VRTA 4DL6A 3K57A 1SKRA 4QW9A 3OLBA 4WYLA 3L8BA 4KV8A 1FK9A 2YKMB 3RWUA 1SL0A 4FJ9A 3MEGB 2HWIA 3HVRA 4Q5VA 4O3OA 4N5SA 3HVAA 1IKVB 1U09A 1C0UB 2OPQA 2FBVA 1HYZA 4OJRA 2AWZA 3AVAA 4F4WA 4R0EA 3QGGA 3TAMB 2FVRA 1XR7A 4Q0BA 2GIQA 4FJ8A 3IGVA 5KT2A 3F9KA 2HHQA 4NLXA 2WONA 1J53A 1T8EA 1GOBA 4NCGB 2D0CA 5DG9A 3CDWA 1T03A 3ZT3A 1WN7A 4PQUA 3VQEA 1RDRA 4HUGA 4NRTA 4WZMA 3DLKB 3LDSA 3V4IB 3GV5B 3EYZA 3GYNA 4O4GA 4FM1A 4TYAA 1JL1A 3CFOA 1RAJA 4KREA 1EP4A 3NBPB 1XR6A 4ED8A 3G6XA 4O3RA 4J9NA 3V6DB 1HYSA 4MK8A 2HNZA 3CVKA 3RR7A 4ZP9A 1RYSA 5HLFB 1JLCB 4C8OA 3KHHA 4KHMA 4CIEA 2KZMA 2UUTA 2IOCA 3IS9B 3KLIB 1VSJA 2IS3A 4CF1A 4EYHB 1S49A 3VQ9A 4OVLA 3CG7A 1RT1A 4XO0A 3Q8QB 4U7CA 4F4KA 1NK7A 3QO9B 3OL9A 4DL2A 4CF2A 2OPRB 3AO4A 1VRUB 3AO5A 1BCMA 3H98A 1S48A 2JC0A 1RBUA 3BJYA 3PUFA 3A2FA 5KFLA 4IQXA 3OS0A 4E7KA 1HNVB 1R0AA 1U48A 4CCHA 4I7FA 2XRIA 4Y1CA 4ELUA 4DU3A 4FLXA 1S1TB 5KG7A 2AGOA 3RB0A 5KFUA 3FQLA 4O3SA 3G6YA 4NLYA 4DTXA 2G8WA 5KFHA 3V9WA 3ICLA 5JS1A 4DTMA 3DM2A 4I2PA 2HW3A 2G8UA 3OL8A 1RT5A 3ZSQA 3SUOA 1KVAA 4WFXA 3CQ8A 4JV2A 5KT7A 4Q0BB 5C25A 5JXSA 4YR0A 4K4SA 3FDSA 3V6JA 1C0TB 4H4OA 3KMSA 4KHRA 3G6VA 4CFBA 4FM2A 2WONB 3U3YA 2P5GA 3KHLA 1XI1A 4K4XA 1LWFB 4LSLA 1NK9A 3Q8RB 3O3GA 2ZD1B 3DLEB 3E01A 2D3ZA 1S6QA 4FS1A 4O4GB 4DSLA 1IKXB 1VSKA 3HJFA 3N6NA 4ZHRA 4FJJA 4ICLB 5KFDA 5KFXA 4PWDA 4LY7A 1JLEA 4CJKA 4DFMA 3LP0B 1HYSB 1EXQA 4K4TA 2DFHA 3QEXA 4E19A 4PUOA 3HT3A 2X6NA 1BQMB 4RNFA 1SUQB 1RTIA 4CECA 3PW0A 4ECUA 4DS4A 3EPIA 1L3VA 5KG0A 1RT2A 4NLVA 3CYMA 3HK2A 3CJ5A 1ZBUA 4BE0A 3QZ7A 4J2AA 1RBVA 1BISA 5F8NA 3PW7A 4W5RA 1J5OA 1QSLA 3MR6A 1R0AB 1HJRA 3H5UA 5DG7A 4I7FB 3RBEA 4CHZA 1MU2A 3AO2A 3H59A 1NHUA 3SYZA 3LP3A 3NF9A 3TARA 3RB4A 4B9UA 4KAZA 3GV7B 3T5HA 1ZBIA 1NK4A 4B8CA 4FXDA 4QWEA 4IG0B 1VSEA 3DLGA 5I42B 1S0NA 1JLAA 1HNIB 1WSIA 4WXOA 4BACA 4OPKA 3DM2B 4R8UA 4EBCA 5KFWA 4I2PB 3SUPA 2W7PA 1RT5B 3NF7A 4F4ZA 2B5JA 2UVRA 5C25B 3M8PA 3FRZA 5EU7A 1FXXA 3NH1A 4HUFA 4H4OB 4RW8B 3LWMA 1TL1A 5DG8A 2CKWA 2C2EA 2FBTA 3VQPA 4QAGA 2PYJA 4CK3A 4ZPBA 4IKFA 4IG3B 2W9BB 4DLGA 3DOLB 3AA2A 3ZSWA 3QESA 3V81A 4B3OA 3D0PA 1TL3B 4FW2A 1LW0A 1TQLA 5KFEA 3ZSXA 4B9NA 1S1UA 4HHTA 4CEEA 1NJYA 1RTIB 4WFZA 4MKBA 3E51A 1RBSA 3HO1A 2FJVA 2KW4A 3PR5B 3I5AA 1RT2B 5HP1A 3MFIA 1Y97A 1HARA 4IR1A 3GQCA 4J2BA 2YNFA 4FLVA 3OL6A 2YHBA 3MXJA 3KKSA 5DGAA 4NLSA 3IN5A 4M3TA 4CJRA 4K4ZA 2VG7B 3QINA 3KK3A 3SI8A 1I6JA 5KT4A 3NKYA 3NGZA 2WB4A 5EWGA 3AA5X 3DRRA 3D45A 3AVFA 4GVMA 1NK8A 4RG8A 3MR3A 3KIOA 4DTOA 4Z4HA 3DLGB 5KT5A 3H2LA 3DMJA 4CFCA 1JLAB 3AVIA 5KGWA 4CF9A 2C22A 1JLBA 4R8UB 3OYJA 4CJVA 2Q3SA 3DOKA 4KHQA 3FFIA 2IBKA 3G86A 1UA0A 4CHNA 1HQUA 5F8MA 2RN2A 1ZBFA 3PV8A 3HVTA 1MMLA 1JLGB 1TL1B 3MECA 4RU9A 1KLMA 2YNGA 1VSHA 4M3RA 3VN5A 3EPGA 1RCHA 1FKPA 3BREA 2RF2A 3SCXA 1B9DA 4F4YA 1RT7A 2KFNA 2VG5A 2FLNA 3OYBA 3K5MA 1NK6A 3V81B 3AVLA 1GOCA 4CFAA 4CJFA 1LW0B 4CEBA 3C94A 1TKZB 1W9HA 1S1UB 1WSFA 3HKWA 4M3ZA 2FJXA 4NLPA 5KRTA 4IDKB 1RT6A 3OY9A 5HBMA 1X9WA 4FJ7A 4QOZB 4CJ5A 1NOYA 4M45A 3AVJA 4FYDA 4CJSA 5F8GA 5HP1B 3QETA 4CF8A 2R8JA 2VWKA 1NJZA 2YNHA 1J54A 3KTQA 4M42A 3IGNA 2HHVA 4DWIA 1NKCA 4TN2A 5L1JA 1VSDA 1C1AA 1IM4A 4MKAA 4CJUA 3KK3B 5HRSA 3KLFA 3N6MA 4OLAA 3OLAA 3V1RA 3K59A 4AHTA 4O3QA 1EX4A 1L3SA 2W9AA 4FZXC 2BQ3A 4G1QA 4DLEA 4O44A 1ZTWA 5DQIA 1XR5A 4OLBA 4NZ0A 4WE1A 4LSNA 1QAJA 3CFPA 2XC9A 3LAMA 1S9GB 2PY5A 1JLBB 4ZVEA 1Z4UA 1BQNA 1RA6A 5C24A 3TVKA 1UOCA 1KSPA 1ASVA 4CEQA 1WNSA 5J2NA 1TKTA 1UAXA 1T05A 1OS5A 1LV5A 4J9MA 4ZP7A 2ATLA 4DSFA 3DLBA 2GIRA 3PJXA 4WXWA 4JV0A 2X78A 3MECB 4L8RB 2YNGB 4FJLA 4KRFA 3AVKA 2PZSA 1FKPB 1K1SA 3PVXA 1Q9XA 4FJMA 1D9DA 2BQRA 2YKNB 5J2QA 4RNNA 3TI0A 1D1UA 3I5BA 4RNHA 1TP7A 5CY4A 3OS1A 3TR8A 1BIZA 2XHBA 4FJXA 4KKOB 5T7BA 5I3UA 4BE2A 2DFFA 3GIIA 4CJLA 3KLGB 3OS2A 3PY8A 3KK2A 2KFZA 4NLWA 4ECYA 2I1RA 2IGIA 4QPXA 3H5SA 5HBMB 4Q45A 5CYMB 4J9RA 4IBNA 3NH0A 3QIPA 1ITGA 3VQ5A 4E7HA 3K5NA 1NJWA 2HNYA 3L2QA 2XO7A 3RMAA 4KHNA 4CJ4A 2YNHB 2XGPA 3DYAA 4W5OA 2ZKUA 5C42A 1SKSA 1L3UA 3KD5E 3PX4A 2BR0A 2O4IA 4PA1A 1KFSA 1Q8IA 4DG1A 1FKOB 4M3UA 5D3GA 4ID1A 3DLHA 3TAGA 4RW4A 1B92A 3NHGA 3IRXA 3H4DA 4EEYA 1SH2A 4O44B 2IAJA 1ZTTA 4LSNB 1S5JA 3OJUA 5KFMA 3NF8A 4NLRA 3VQAA 3F73A 3JSMA 5C24B 3QYYA 3M9MB 4OL8A 3RAQA 3OL7A 1TVRA 3K2PA 1TAUA 1SL2A 2HMIA 2E9TA 5J2NB 1Q9YA 3O3FA 2UUWA 3Q8SB 2FC0A 4AILC 1LW2B 3SQ1A 2F8SA 1U49A 2LSNA 4DQPA 2UVVA 4MK9A 3KD1E 4IFVA 3NFAA 3CFRA 1REVA 1U45A 4BDPA 4CESA 2JLEA 1L3TA 4KB1A 3KHRA 4IRDA 4KI4A 2Z1IA 4CIFA 3ZT4A 3OHAA 3AO3A 4ED0A 5EDWA 2JEGA 5I3UB 3SQ2A 1N4LA 2WOMA 3DLRA 2V0NA 3KK2B 1TKDA 2KTQA 4J2DA 4ECTA 3I0SA 3M8QB 1VSIA 3ZT0A 2OA8A 1IKWA 1N6QB 4Y3CA 1S1WA 1TKXA 4B08A 1B9FA 3ZT2A 3BQ0A 3PZPA 1VSMA 4TYBA 3QIPB 3U6FA 1RBTA 2WRMA 2HNYB 3QEPA 3ISND 2X74A 3S3MA 4W5QA 3QERA 1O1WA 2BRKA 4DS5A 4TQSA 4DFKA 5KFGA 3AO1A 3ULDA 3RBDA 3GV8B 3BSCA 2GBZA 5J2MA 4KTQA 4DL5A 4ELTA 5CZ1A 1C1CB 4R5PB 4FLTA 4ZPDA 5HROA 2W7OA 1RTJB 1VRTB 3OYGA 1XC9A 4E0DA 4RW4B 3HPHA 3DRPA 2BANA 2OYQA 4KV8B 2P5OA 1A5WA 1FK9B 3AVNA 3IRXB 1QSYA 2E6MA 4AH9A 5DLGA 2W8LA 5DGBA 2R8KA 4C8KA 4ELVA 3SUQA 4EP4A 3UQSA 4URSA 1ZYQA 2UVUA 4CJWA 4RUCA 2OPQB 1BHLA 3SFUA 4CFDA 3N6LA 4QWBA 2G8FA 2HMIB 2VG6A 3NE6A 1WAFA 4KO0A 1TAQA 4IFVB 1TGOA 1REVB 3PW2A 2BGGA 4TLRA 3CM6A 1X9MA 3PO4A 1T03B 3K5LA 4PQUB 3KLHA 4KPYA 3U3GA 2XCAA 2Y1IA 4F8RA 2DFEA 5J2PA 4U6PA 1T94A 1JKHA 4H54A 4K4WA 3SFGA 1EP4B 2WOMB 3MR5A 2QK9A 3V6HA 3NL0A 2FLLA 3AA3A 2RPIA 4FLWA 2HNZB 4AHSA 2IC3A 3D5MA 2IM3A 1TKXB 2HVHA 3KOAA 3HXMA 4ECQA 3K5OA 4M41A 1EETA 3ZCMA 3O4NA 2HAIA 4I2QA 1RT1B 2Y1JA 1BCOA 1HMVA 5KFCA 3H5YA 2FJWA 4OPJA 4MFBA 1G15A 2IDOA 2B4JA 1S1XA 4DFJA 5J2MB 2W42A 3IG1A 5KFNA 2B43A 2B6AA 3M9NB 5HRNA 2J6TA 3LPUA 4B9LA 4WYWA 3V9SA 3Q8PB 2BANB 3NAIA 4DSIA 2VWJA 2C2RA 3HHKA 1TK8A 3BGRA 5FDLA 3AV9A 3HPGA 4NYZA 2JGUA 5T14A 4FLUA 2KZZA 4FK4A 4F2RA 5FRMA 3SV4A 2AX0A 1N48A 5KG5A 4J2EA 4E3SA 3OHBA 1N56A 1CXUA 1D9FA 2IM1A 4XPCA 4E89A 1F21A 2D0BA 1DLOA 3OSNA 4KO0B 3I5CA 3ISNC 3CJ3A 3HL8A 2HHWA 1HYVA 5F9NA 4YMEA 3NCIA 4LQ3A 3TAPA 1RTHA 1S6PA 4HVJA 3KLHB 3RMCA 2HB5A 3AVHA 4AHUA 3NGDA 2AGPA 3D28A 4ZMMA 3SV3A 1SV5A 4N41A 4Q44A 4LSLB 1QTMA 5KFAA 3E01B 4IFYA 1S6QB 5K14A 4J9PA 2GV9A 3OYMA 3L2WA 5KFQA 2YNIA 2F8TA 4NLQA 4ZHRB 4KE5A 4PWDB 4BDYA 1JLEB 4HYKA 3CJ0A 3BQ2A 2W9CA 4CHQA 3S3OA 4RNOA 3UPFA 4PUOB 1EETB 1LWCA 1S4FA 4Z4EA 4URQU 2A1RA 5KFYA 1QE1A 1NOZA 4CEDA 2YHAA 4URGA 5F8IA 4FK2A 4MFBB 4Q8EA 4G3IA 3EY1A 5F8HA 4E7IA 1KHVA 3L3UA 3OYNA 1J5OB 3ZSVA 3OYDA 3QNOA 3H4BA 5DMRA 1JL2A 1C1BA 5EUHA 4CHYA 4FBUA 1W25A 1MU2B 2AU0A 3NAEA 1KTQA 1QAIA 2OPPA 3BGRB 1IH7A 3B6OA 2XY7A 3TABA 1IO2A 3CJ4A 3P5JA 4O4RA 4M3YA 2BDPA 3H5XA 1W0HA 3ALYA 1DTTA 1BI4A 2R7YA 3OYKA 2B5JB 4AHCA 3LZJA 5FROA 2Z1GA 3M8RA 3PW4A 4CJTA 2R2RA 3M8PB 2HHXA 4KAIA 4HUEA 1C2PA 1KRPA 1BIUA 2R8GA 4FJ5A 4F3OA 4KI6A 3PX6A 1WNEA 3B6PA 2QKBA 5C5JA 3QIOA 3AVCA 4LD0A 1S9EA 1NKBA 4KHUA 3I0RA 4Y1DA 4FZYA 4E1MA 3TAQA 2J6SA 1YTAA 5K14B 3VA3A 3O4QA 1RILA 2FVSA 2G8HA 4B9MA 4LQ9A 4O0IA 4B3OB 4DU1A 4ZVHA 3EZ5A 2D5RA 4UQGA 4QWDA 5J1EA 2W9CB 3TQ1A 3ZSRA 3V9XA 3VQ8A 2IJFA 4FJHA 3NGIA 3OVNA 1N5YA 4Z0UA 3MXMA 3M9OB 3T5LA 3KNAA 4NYFA 4H8KA 4DL4A 3GIJA 5KFIA 4MIBA 3RR8A 2XY8A 4JLHA 3VQ4A 1T3NA 5KG1A 3L2UA 2YNFB 2VA3A 4IKAA 5DQHA 1XHXA 1RT3A 2CJQA 4FCYA 4CEAA 3OSPA 4ECXA 1QS4A 4C8MA 1RA7A 4QCLA 4C8NA 2WTFA 1C1BB 3GIKA 1RTDA 2HHUA 2YV0X 4DEZA 4N56A 2QKKA 4F3TA 2QXFA 3DRRB 3T19A 4O3PA 3DMJB 3KKRA 4H4MA 3MTKA 5KFJA 3LWLA 1KCFA 2V4QA 4BWMA 1X9SA 3CM5A 2ETJA 2R2TA 1DTTB 3DOKB 5KRSA 3FFIB 3CIZA 1HQUB 2YKMA 3GIMA 4DQIA 3UR0A 4CK2A 4ED6A 1D8YA 3HVTB 4K8ZA 3ZSYA 4HCCA 3KJVA 4CHPA 2ILYA 1UA1A 1X1PA 1IKVA 1CLQA 1KLMB 2E6LA 2RF2B 2D0AA 4CGIA 4ZTFA 2DPIA 1Z26A 2HVIA 3I0RB 1SL1A 2GC8A 4ED7A 3T5KA 1RT7B 3DI6A 1QUVA 2VG5B 3ITHA 2EHGA 3HPOA 3TAFA 2Z1HA 3AVGA 3V9ZA 3BSAA 3BSNA 2FLPA 2JEFA 3OYFA 3H40A 4DTJA 3QNNA 1HQEA 5KG2A 3VQSA 1RT6B 4OKKA 3DLKA 4CGFA 2ILZA 2HNDA 4DTRA 3TAEA 1S9FA 2OPSA 5HRRA 4F50A 4DF4A 2VA2A 2HHSA 1NNDA 2FVQA 4TQRA 2V9WA 3LPTA 1J9AA 2C2DA 4FJNA 2F8EX 2IA6A 2A1SA 4J9SA 2R2UA 4EZ6A 1ZETA 2W8KA 4GC7A 4IH7A 4FJGA 3AA4A 3KLFB 1RTDB 5F9LA 1JIHA 2I5JA 4DSEA 1WAJA 2AQ4A 4WFYA 2PYLA 4RZRA 1KFDA 2OPRA 4G1QB 1VRUA 4J9OA 2AX1A 4IOBA 4WE1B 1Z25A 3C6UA 1A5VA 1ZBHA 4FJIA 2DPJA 2QV6A 1BQNB 4DL7A 3ASMA 3WNHA 4MK7A 3VQQA 2XY5A 4Q8FA 3ZSZA 4KHWA 1TKTB 3OYHA 3NGYA 4GW6A 1S1TA 3C6TA 3O3HA 1T05B 4ECZA 1GOAA 4ZVGA 5L1KA 2RKIA 1D0EA 5DQGA 4EO6A 2UVWA 3KK1A 4CEZA 3SJJA 3KJVB 4IRKA 2GUIA 3K58A 2BE2A 4J9QA 1RDAA 2ITGA 3LAKA 5J2QB 3MF5A 1WSHA 4CGDA 3UIQA 5DK5A 4BE1A 4MH8A 3DDKA 3EZUA 4MQ3A 4M3WA 3OYCA 2JEIA 3DI6B 5KFSA 3T3FA 4W5TA 3VQ6A 3ITHB 1CZBA 1C0TA 4KBIA 3SQ4A 4NLOA 4FLYA 3NAHA 1NKEA 3VQBA 4RUAA 3MAQA 1DTQA 4K4VA 4AHRA 4Y34A 3VA0A 1JXBA 1HQEB 3MR2A 4ZPAA 2J6UA 3OYAA 2IM2A 1LWFA 1CZ9A 2HNDB 1BGXT 2ZD1A 4AHVA 3DLEA 3BR9A 2EX3A 1IKXA 1I39A 2OPSB 2OH2A 4YNQA 2D3UA 1C6VA 4NLDA 2G8VA 4ICLA 4M94A 1K1QA 1RDDA 2DY4A 3DYAB 3LP0A 1LAWA 5C42B 1KHWA 2WCXA 4TSXA 3FSIA 4HKQA 2ASJA 1BQMA 4DSKA 1SUQA 4F4XA 4DG1B 3CDEA 4BDZA 1JX4A 5D3GB 4QW8A 2WHOA 3PR4A 4ED1A 4EO8A 3RMBA 1LWEA 2FBXA 4RNMA 2I5JB 4B8AB 3SZ2A 3RRHA 4RW6A 3L3VA 4DSJA 2OZSA 4ZP6A 5SZTA 4NCBA 2IAJB 4O55A 4ECRA 3LP2A 1U47A 3C6UB 3OYLA 4CEFA 1IKYA 3OYIA 3BQ1A 3ZSOA 1VSFA 3JSMB 4FZZA 1TVRB 1S0MA 1JLFA 3T5JA 5KTQA 4K8XA 3WNFA 4DQSA 4HCBA 3C6TB 4CJEA 2RKIB 4TY8A 3KMQA 4IG0A 3PJWA 5KG3A 3OJSA 3KK1B 3NDKA 5I42A 2BE2B 1HNIA 3MEDA 4JS5A 5KG4A 1S97A 4FS2A 2X6SA 4KB7A 2Z1JA 4E1NA 3M8SA 1YVUA 5F8JA 1T7PA 4E7LA 3JYTA 1TK5A 4K4UA 5HRPA 1WLJA 5DLFA 4HTUA 1YVFA 4ED2A 4RW8A 2IMWP 5L1IA
chains in the Genus database with same CATH superfamily
1WSEA 1HW9A 4DR2J 3I0SB 1HKBA 1WSGA 1CSJA 1UWBA 2UV8A 4F2SA 1S1WB 4BY9C 3A1YG 1KVCA 2XLIA 3OPKA 2W24A 1Q8KA 2VFTA 4E7JA 3WX8A 3TWZA 4YP3A 4ED3A 4O5BA 2WK4A 4NMXA 4WTOB 4N76A 1RBRA 5A2QY 1KWMA 2NSBA 3FZLA 3P49B 1HNWF 4ALZA 1YDLA 1HNZK 3NMUA 3L4IA 1NK5A 2GJFA 1ZZFA 4CE9A 4IOAQ 1OPZA 3G8SA 2H9ZA 2R8IA 2HSEB 4Q43A 3DRPB 3ZZOA 3LP2B 2DNYA 2O5DA 4B9SA 3P6YC 3TWHA 3AGKA 5C2GA 2XGQA 2FSNA 4IRCA 1S0OA 4D3GA 1JLFB 2IIRA 3UDLA 5AQQA 5JS2A 4ZITA 2VQEK 3DXMB 2CGJA 4CJPA 1NSKL 5J1PA 2XZTB 4RW9A 2F7TA 4ZS6A 3MEDB 2XZWA 2VDIA 1RWUA 2I9SA 5M2UA 3QEVA 5AQPA 1IR2A 4O0JA 3MMAB 4NXMJ 5DZ7A 1WUUA 5KPRA 3O3LA 1JKHB 2AP6A 6FD1A 2UXBK 5BYQA 4KHSA 3D54A 3S3NA 2EFGA 1UWBB 3SK3A 3HP9A 2YTCA 2ZM6J 2QWRA 3S9HA 5L9XA 1PO6A 4E1JA 5CHIA 1VQ8N 4YOWA 4OYMA 1KVBA 4CEOA 4JI1J 4FM0A 1MA9B 1CJUA 1PCAA 1GQEA 4B1VA 5KFFA 1N34J 1L5UA 2V4RA 2V7ZA 4TY9A 1AA1B 1TK0A 2R7VA 3OTOK 3UD5A 1C0GA 3OUYA 1NPRA 3QMLA 4B9VA 4YR3A 1BL3A 2JLFA 2NRWA 5KFBA 1S3XA 1YF5L 1DURA 4F0HA 1PYTA 3QLHA 3NGTA 3FKBA 2C2ZB 2C3YA 4FWKA 4EP5A 2XWYA 4ECVA 3V1OA 2VHGA 2XLJA 1U04A 1P27B 1W7AA 2FVCA 5KFKA 2GHVC 1NG9A 4DR4K 4U8YA 4M3XA 3MURP 4P52A 1T11A 5LMUJ 4B3MF 2RDDA 4DL0C 1A7GE 4AT1B 5KFRA 3SMPA 5JVGQ 2E1ZA 2DT9A 4RW9B 2YWHA 1SKWA 4FVMA 4IFEA 1S9GA 2HLTA 1WOSA 1JJ2R 2AEJA 4CIGA 4KFBA 1FF2A 4OHYA 1X3MA 4CHOA 2XG8A 5GAEI 3G4SS 1VQ7S 3PO5A 3VQDA 2DNGA 5B8HA 4CLFA 4BC9A 2G8IA 4WPAA 1MG7A 1EX8A 1RWXB 3KUEA 1H6KX 2J0WA 1QQCA 3MM8B 1LEOA 1G99A 5GAHI 1C0MA 4X2BA 1VIXA 1RK8A 2XS2A 1AXQA 3DXKA 4IR9A 4QZVB 2QE5A 1CJUB 2VCPA 3IP0A 4CERA 4ECWA 2J76E 1VQLS 2GNKA 5F1XA 2VONA 3LH2S 3OUYB 3QQCD 4DTNA 2HBJA 1VGYA 3ZTRA 2Q6BA 3VZIA 3QNWB 4M8LA 4JI6J 3QLHB 3I33A 4CK1A 3FK4A 1QD1A 3VERA 2OEKA 2NRVA 1JJHA 3CC4N 2O8BA 1U7LA 1RDBA 2GIFA 2E2PA 4OV1A 1FRKA 3MUVP 4CZFA 5CD4A 4UOHA 1BI4B 3BF3A 3RU0A 2J9DE 1KQGB 5KGXA 5C2CA 1M5SA 3Q2TC 1B7YB 3RB3A 3U9DA 4KFBB 3QRQA 3EXCX 3AY9A 4PY5A 2UU9K 3BDPA 4DQQA 3MCNA 1WHXA 4JUZA 1U2FA 2PGCA 2FJEB 1RUSA 5FIIA 3QGIA 4JK8A 5AJ3F 1CG2A 1W2BR 4MIAA 4C4WA 5K8OA 2MKJA 2YY3A 4M5JA 2K8GA 2MZQA 2E4LA 5HQLA 1NXIA 3DXKB 1ATNA 1SBRA 4A8YA 4TU8A 3V9UA 2MJNA 2QA4N 2VKRA 5GIPA 4NLTA 3J8AA 3NBPA 1NHVA 4JV5K 2FVPA 4IOAL 3V6DA 2NXJA 4OZLA 3E9LA 4YOTA 1ATSA 4CJQA 1XQIA 2VYPA 3LANA 3P83D 1KC8O 4FLZA 4BRMA 1HUXA 4B02A 4NEZA 3J80U 4CLSA 2Z2ZA 4XH1A 4CZHA 4J9UE 3MM9B 2ASDA 2HHHJ 4JKCA 4Y2AA 2AJ1A 1C1CA 4H4MB 4DR6F 1I3AA 1HNVA 4J9LA 3OW2R 1RTJA 2G8KA 2CG4A 3K57A 3UDCA 2ZFHA 4QW9A 4WQ5A 3U4LA 4WYLA 4KV8A 1FK9A 3RWUA 2HQCA 1TL5A 4C48A 4O3OA 2VZ9A 3W65A 4DV1F 2CVEA 5D4LA 3G2XA 1N32F 4OV6A 5DRKA 4USIA 2YJEA 1HBUA 4Q0BA 5HANA 5KT2A 4M5NA 3CXCR 2HHQA 2YVSA 2WONA 1T8EA 2D0CA 1T03A 1WN7A 4DV2F 4ZVUB 4PL8A 1BWVA 2HURA 3EYZA 1NBEB 2R3VA 2NYHA 4TYAA 3OR2A 3CFOA 1B0TA 1EWQA 3NBPB 2ZHAA 1XR6A 1LCUA 3V6DB 1HYSA 2JH3A 1PBAA 1M5PC 4BRGA 4C8OA 1RCOB 1YITS 4CBXA 4CF1A 3VQ9A 4PYDA 3Q8QB 4F4KA 1R89A 5HOOA 3EO3A 1BY9A 3I55N 2OPRB 3AO4A 1VRUB 4ZVTB 2FY8A 2JC0A 5FPNA 1RBUA 4U67Q 2PAVA 3R5BA 1NGHA 4E7KA 3GTYX 1HNVB 5A8RA 4B1WB 3AJ2A 2XRIA 5JVGL 3R8EA 2ZC3A 4DV0J 5KG7A 3CJCA 5CQGA 2JFKA 4P71A 2VUGA 2G8WA 4LF7J 3MPYA 3V9WA 3HOSA 3OT9A 5JS1A 4DTMA 4GV9A 4FN5A 4DV6K 3M8YA 3QAUA 3GE9A 3W61A 3D3BJ 1CS4B 3DGPB 4IEEA 1X0PA 4Q0BB 5C25A 3UFCX 5D4OA 3FGUA 4FM2A 4ERDA 2WONB 3OA9A 3U3YA 4GKKJ 3HFKA 9ATCB 1EKRA 3V2UC 1LWFB 1ELOA 4UY8T 4FWNA 2DO0A 4ZLNA 3OR2B 3LF0A 5BR8K 2XHCA 1I94K 1HYSB 4K4TA 1V4SA 2DFHA 3QEXA 1EHWA 3HT3A 2X6NA 3MD3A 4RNFA 1SUQB 1YHQN 3EICA 1XMQK 4P2MA 1RZMA 1UFKA 3CYMA 1GTHA 2F8MA 3NS5A 3QZ7A 1A9NB 2QLXA 3OBIA 2CH5A 4W5RA 1S72N 2J8AA 2KH9A 2MDAA 1ATRA 1VMBA 4L76A 5DG7A 2GZOA 1DFDA 4CHZA 1MU2A 2MLZA 1NHUA 3WXIA 2RUSA 3ZETA 3GV7B 3SSRA 4FXDA 2CNKB 5L38A 1VSEA 4UZCA 4OX6A 2RHQB 1JLAA 1XUPO 5BRDA 4WXOA 2KT2A 4BACA 1Q0NA 4BQZA 4U7BA 4R8UA 4EI2A 5KFWA 4NXNJ 2NRRA 4RWXA 4B3TK 3BO3A 4CO1A 3A8YA 1JCFA 2UVRA 5C25B 1VFJA 3PKYA 3CJRA 1HIYA 4IYQA 2A40A 2BABA 4RW8B 4BRLA 2BJDA 2CKWA 5JLHA 2C2EA 4PG5A 4OI2A 2FBTA 1Y5LB 4PXBA 1E4FT 4PR6A 2ZH2A 4DDFA 2XQCA 1TUWA 4F4AA 2BA9A 4KJIA 2QI2A 2RQCA 2DGXA 4MDBA 3QESA 3CTRA 2OSQA 4FW2A 1LW0A 2E7WA 1U1KA 1F3FA 3DOMA 5HSPA 3W3SA 2BTFA 4CEEA 4WFZA 3E51A 1RBSA 3T69A 2FJVA 2WVFA 2KW4A 1ZAWA 2YNFA 4FLVA 3EGWB 4X4UA 3UNYA 2ZHOA 2A0FB 2L9NA 5DGAA 1X8DA 4M3TA 4CJRA 2VG7B 3QINA 4C1NK 2O8EA 2H4WB 2DNKA 3HSDA 5EWGA 3ZETB 3D45A 2IBOA 3QMQA 2F1FA 4QR0A 2RMLA 3L7PA 3DMJA 1JLAB 5KGWA 4X64J 3KG1A 4DZ6A 4R8UB 4HH0A 1RWVB 4EFHA 2CQ4A 2RN2A 1Y00A 1NPPA 1PG5B 1BWFO 3CCLN 4KH5A 1MMLA 1JLGB 1H2UX 2GQQA 4MMOA 2GVZA 1HPMA 1KLMA 2XMTA 2F63A 1YK9A 2OUGA 2RF2A 4JKBA 5K9FA 4YDUA 1HQ2A 3SCXA 1ZOTA 3DXBA 1O13A 4NX9A 4F4YA 4Y65A 3SCIE 2B4OA 4B1YB 2VG5A 3U1NA 2FLNA 2M8HA 5D0EA 4F0MA 1LW0B 2U2FA 5E3AA 4CEBA 3C94A 4DV7K 4RL1A 1WSFA 5EY4A 2C42A 5JLFA 4IDKB 8AT1B 4FJ7A 4CJ5A 1NOYA 2J9CA 1O5JA 4ILJA 3M6VA 1HBNA 2K06A 4DUYK 3AVJA 4CJSA 1IQZA 5F8GA 4DV4J 4CF8A 2VWKA 2ZOFA 4DI6A 4H0XB 4K5SA 4U67L 3ILLA 4EHUA 4M42A 5BYSA 2HHVA 2VFUA 2NXUA 5ETMA 1Q7LB 1IM4A 4MKAA 1NCLA 5DDQC 4CM0A 4X62K 3CD5A 2GFFA 3KLFA 3CMAS 3V1RA 2AF6A 4C3MA 1G1XA 3WIUA 4NI2A 1TU0B 1XMOJ 3J80Y 4QBUA 4DLEA 4PKGA 1XR5A 3TPQA 3CETA 1SCJB 1OVQA 2XC9A 3LAMA 2VPZB 3CC7S 2PY5A 4ZVEA 5C24A 2B7CB 5A6PA 3PTWA 1UOCA 2V67A 1IXKA 3PYDA 1U1MA 3ZTSA 3LGHA 3NLCA 1D9AA 1LV5A 3Q8VA 4J9MA 4B3SK 2ATLA 3PJXA 4WXWA 2ZH6A 3AJ1A 3U7JA 3CCQN 4FJLA 4KRFA 4ITSA 1Q9XA 5AFUA 3HHLA 4DR5F 3TI0A 1D1UA 3W62A 3HHDA 3BM7A 1QVGM 1K73T 2Q1LA 2WSCC 1M1KT 2E5IA 3TR8A 1CQMA 2MKSA 1LK5A 5C2DA 4K25A 4BQLA 5D4NA 2R4FA 1TFWA 1R8HA 2DFFA 3FUYA 3KLGB 1CC7A 3OS2A 3NWGA 3R2CJ 2KFZA 1G7CB 4NLWA 3BKTA 4QPXA 2Y1LB 4NPOA 3OTCA 2WAQD 1GLDG 3MM5A 4WFBQ 1N5QA 4J9RA 4WBFA 1ITGA 4YHHJ 3K5NA 2MQOA 1Y3JA 2XO7A 3GJSB 4CJ4A 3ADAC 2DRBA 3M8ZA 1RGVA 2XGPA 2D9OA 3A5LC 3DYAA 4MKVA 1JCEA 4LF2A 2ZKUA 2BR0A 4C23A 5LJVA 4LRCA 1RWNB 2QEXS 1Q8IA 4DG1A 1TFYA 4A61A 1HFEL 3J7YU 4ID1A 1N54B 2M5YA 1PGZA 1VK3A 4NI2B 3NHGA 1SH2A 1RADB 4ZCIA 1BUXA 1ZTTA 1B0PA 4K2JA 3RVCA 1FRHA 5BPMA 2HVEA 3H1VX 5DDRC 3KWMA 3JSMA 5C24B 3M9MB 4OL8A 3RAQA 1M90T 3OL7A 1NGFA 4ZVQB 1SL2A 1XC3A 5IZHA 4RU2A 2EG1A 2F8SA 4DQPA 1PC5A 3WQTA 3KD1E 4IFVA 3ENAA 4ZIWA 4BR4A 1U45A 3BF1A 4BDPA 3NXZA 4J91A 4CESA 3IC1A 3WEEA 1X4CA 3HHLB 4I64A 1FJEB 4M5GA 3C15A 4IRDA 4IOCQ 5HL7L 1GLLO 1BLUA 2P9CA 1PC4A 3F41A 3THXA 5CA5A 1E6YB 3G9CA 4DHYA 2NPFA 4OZ1A 4ED0A 2KT3A 3MR7A 1N4LA 2V0NA 3HZ6A 2KTQA 3MX2A 1P8GA 3DN9A 3M8QB 1VSIA 1DRZA 1IKWA 2B8QA 2KYZA 2J0QD 3ZT2A 3BQ0A 1HNZJ 2WRMA 3QEPA 1OMSA 2BRKA 3AO1A 3M7VA 3POTB 3MM7B 2GBZA 2QSFA 2LEBA 1YRUA 4DV3K 2RS2A 4ELTA 4R5PB 2HRYA 5LSLA 3I31A 5HROA 1AT1B 3PEHA 1VLOA 4ISFA 4UY8O 3H20A 1XC9A 1N33F 3HPHA 5IWAK 2BANA 4P9SA 2E1PA 1QSYA 4AH9A 2UXCF 3SDEA 2A6MA 5DLGA 5DGBA 1VQKS 2KDOA 3DHWC 2R8KA 4BC3A 4ELVA 1AUSL 4EP4A 5K8MA 4URSA 3D68A 3FZBA 2FHJA 4JI2F 4CJWA 3MMBA 2G8FA 2QN6B 3FZKA 1GXUA 2VG6A 4WFAQ 1RDWX 2LQBA 1TAQA 2RRNA 2DR6A 4IFVB 1TGOA 4ER8A 1CVJA 2XNQA 5EHHA 3R3LA 3MCMA 3K5LA 1SJFA 2VQFK 3MCSA 2XCAA 3I87A 2Y1IA 2DFEA 2CNOB 4U6PA 1HR0F 3E1YA 4DR3K 1XERA 1AZSB 1IJFB 5IT0A 4K4WA 2V2QA 3GMGA 2QK9A 3AA3A 1DAXA 2XWXA 2IC3A 2V2ZA 3Q0AA 2IM3A 4H5NA 4RTFD 4PXDA 3KOAA 2IRYA 4L3QA 1X4BA 2MMYA 5D15A 1L3KA 3NGUA 2XULA 3ZCMA 2KB2A 3O4NA 3OTOJ 1HMVA 2DJWA 4XK8C 4MFBA 3EE9A 1G15A 2IDOA 4DFJA 5H9EK 4OYZA 5AQNA 5B0BA 4I69A 4B9LA 3TEHB 1T9WA 3V9SA 1PJ7A 2BANB 3UN5A 3N4QA 5AE3A 3BGRA 4LFCK 4NYZA 2JWKA 2JGUA 3KXDA 2EK6A 4DR4J 5T14A 1QTNB 2RRBA 4FLUA 4OJ1A 3CC2N 3MMBB 4IWVA 1N48A 3N28A 2DR5A 3U1MA 2D0BA 3RGIA 4QS8A 3K0SA 1S6UA 2U1AA 3HL8A 2HHWA 5F9NA 4MAKA 5DJBA 3RRKA 3TAPA 1RTHA 4HVJA 3VEZA 3AVHA 4H5RA 4AHUA 3SV3A 2C3MA 4Q44A 4P75A 2X3GA 4X84A 3O8WA 4DN9A 3UN3A 3HHLC 3DHXA 4OX9F 4IFYA 5K14A 2RILA 5LMNK 3SSQA 3O08A 2CVIA 3IR5B 3KKFA 5AQWA 3P4UB 4HYKA 3BQ2A 1Z2ZA 2UUCF 4WFBL 3HOTA 4RNOA 3UPFA 1VQNS 3E2EA 2ZUGA 1ESVA 1X7VA 4UOFA 2DHGA 3QBXA 1G2EA 2XLKA 4BRFA 1LWCA 1QE1A 4CEDA 4MFBB 3CJKA 4JKAA 4G3IA 3NEKA 2CQDA 2KG1A 2Y3YA 3PJ9A 5ITHA 1KHVA 2Q79A 2YWFA 3VEOA 3R6MA 1J5OB 3K0JA 3ZSVA 4X66K 3QNOA 2PSZA 3H4BA 1VBKA 3OTBA 4ZCKA 5IC6B 1B99A 1JJCB 2E88A 4FL9A 3BGRB 4LREA 3THTA 5GAEU 1IO2A 3CJ4A 3VAIA 4DN0A 2DGWA 5HAOA 3R5CA 3HFVA 2BDPA 3H5XA 3ALYA 2QA1A 3OYKA 2B5JB 4AHCA 3N79A 5FROA 2PN6A 1PSDA 2UU9J 2A2CA 4IOCL 1KRPA 4GVEA 3IM9A 4FJ5A 4F3OA 3KG0A 3PX6A 1WNEA 3B6PA 1DY3A 2QKBA 4LD0A 3SJHA 3R8YA 2ZOMA 1IUJA 2J6SA 5K14B 3O4QA 1CQNA 3GE1A 2GWKA 4B17A 5JVHQ 3MM6A 2LVWA 4OI6A 4LQ9A 3H8YA 4DR2F 2D5RA 1X4HA 4QWDA 4BRQA 5J1EA 2F4VK 4JYAK 2FGCA 3ZSRA 4OZNA 2ZITA 1R0BG 1NGEA 4JV5J 3OVNA 1RWKB 3M9OB 2PT0A 3EXYA 3PFOA 4H8KA 1PYOB 4DL4A 3GIJA 3ENQA 2N82B 3RR8A 4JLHA 4WQ4A 1T3NA 5KG1A 3VQ4A 5HJXA 4LF9K 1U6BA 2CJQA 4L6V3 5M1QA 3MN6A 3OSPA 1RA7A 1M1KO 2WTFA 1VQ8S 3SQGA 2L41A 4LVNP 4YUDA 3C0BA 1WSRA 1WC5A 3N4PA 2CIMA 1P9QC 4L74A 4O3PA 1R6VA 2RSQA 2GAGC 2HK2A 1F5AA 4BWMA 3VGVA 4WFAL 1QAXA 1HQUB 4DQIA 2DY1A 3UR0A 3GFXA 3FCWA 4KY3A 1SJRA 2FY1A 4CHPA 2ILYA 3UE2A 3AXKA 1KVJA 2IYGA 2AZ1A 2D0AA 2P9NB 2HBQB 1Q86T 1UEUA 1SL1A 2GC8A 4CDIA 1U1OA 3MI7X 3OD2A 3T5KA 3EUNA 4Z37A 2BW2A 3CCWA 2ZH7A 3ITHA 2EHGA 3MM6B 2ZH8A 4RBVA 3JS9A 3AVGA 1IBKK 4ED5A 3NNHA 3V9ZA 1G4CA 3BSAA 2PBDA 2W25A 3BSNA 3OYFA 1M90O 3H40A 1DZ5A 3QNNA 1HQEA 4JI1F 3ILJA 1OH7A 4CGFA 2UV8G 2ILZA 2HNDA 1ZXOA 4DUZK 1MROA 4CYUA 1N34F 1YRXA 2HFOA 2ATCB 2VA2A 2MZSA 3JXUA 3LTOA 1FW6A 1TTHB 2DGTA 1RXOB 1MW7A 2W8KA 4M7XA 1JIHA 2HQDA 2I5JA 5DETA 5AR0A 1U2CA 3IFEA 4DU7A 4CD3A 1XJWB 3U9ZA 2PYLA 4J9OA 1RACB 4A8MP 4EHTA 4AQYK 5AQOA 1S12A 4O5FA 4NOHA 1EARA 2KHDA 4FWRA 2MGZB 2ACMA 3VQQA 5A2QO 3U27A 1S1TA 2CA9A 2LXFA 4ZVGA 5L1KA 1RSCA 1RDUA 1D0EA 3QATA 3MWPA 2Q6CA 3VQTA 3CC4S 4CEZA 4IRKA 3AGRA 2GUIA 2BMBA 2CJKA 2YQ0A 3LAKA 4G1PA 2FQQB 3TO8A 3UIQA 2B4VA 4CT8A 4W5TA 3ITHB 4OFZA 2F9JA 3SQ4A 4DPWA 3ULEA 2FHOB 1NAQA 3HSGA 2MLYA 2B9WA 1VHXA 1GLJO 3VQBA 2BJ1A 3MAQA 4AHRA 1FRXA 4Y34A 5BJRA 4OLPA 1HQEB 5BR8J 3G8TA 5E84A 2QJ3A 2HNDB 1BGXT 4OZ5A 1I94J 3TX8A 1C6VA 4MIWA 3IR6B 4ICLA 4FPAA 3OXFA 1YQHA 4BCAA 2MZJA 1XMQJ 5M2RA 2LDYA 3M2UB 4NYPA 3FEZA 2IYIA 4JI6F 5D3GB 3T7ZA 2QMWA 2I5JB 5E2QA 2ADBA 3MGJA 3L3VA 4JI3K 3ELHA 4O55A 4K0KK 4P2FA 3OYLA 2MKYA 5LXRA 2E5HA 1IKYA 2O66A 3BQ1A 3ZSOA 1BG3A 2QWPA 5KTQA 3ZC4A 3HX9A 3WZ0A 2VV5A 2VJVA 4HTIA 3BKUA 4TY8A 4OQJA 3UE5A 2AYEA 3C16A 5I42A 1YGYA 1Q79A 4B3TJ 4JI7K 4NZ6A 1S97A 2OKQA 5H1SQ 1RLCL 5BN9A 1GLFO 5F8JA 5JVHL 1R8BA 1SC6A 4R79A 2EKYA 2YBVA 4LF5K 2P6TA 2J9EA 2Z30B 1UTAA 2VPXB 3SPYA 5E41A 1RYRA 4FYVB 1CULA 1KTVA 2ZC4A 4ENOA 2G2ZA 4PL7A 2DGSA 4ES1A 3G8QA 2W9BA 3N01A 1ZBTA 2JVRA 4CF0A 2JC1A 3TUPA 3CJ8A 5SWMA 1RFQA 2XSJA 4W5NA 3TTFA 4YOXA 5CYQA 4Z4FA 2DEIA 2NRTA 3GLJA 4F0KA 3BB5A 3AAWB 1HNXK 3KLEA 1Q5VA 1FJCA 3IXQA 3W1YC 3VQCA 4RWTA 1NGIA 4WZQA 2YJFA 1ZM4A 3HTVA 5ETTA 2HHHF 3GCWP 1UEVA 3D1OA 4PWUA 5B0DA 4GC6A 5AQXA 1IKYB 1TMJA 1VJWA 1WG1A 4AXIA 3TYTA 5IV3A 1D5AA 1P9YA 1WOQA 3BGFA 2JDJA 1YTUA 4Z4CA 4USMA 4TY8B 3KK7A 3C16B 4Y0FA 4ZPTR 3G0ZA 2Q66A 4LSZB 3I55S 2ASOA 2KQ2A 3Q8YA 3JXOA 1RKJA 2M0GB 3TSQA 4DR7K 2CWKA 3DRSA 1FEHA 1RDCA 2YQ3A 3TA0A 1G3OA 3CWJA 4A2AA 4X65K 3W8PA 3I8DA 2KJWA 2ZOGA 3BS9A 2V94A 4KH0B 2FSJA 2V4JA 3RJMB 3ET6B 3O4WA 1OYDA 4CJ3A 2DNLA 3CJTA 4DV7J 3C2PA 1YJWN 3P1GA 4JEPA 1RBOB 2XSJB 1JLQA 5CYQB 1J5EK 2BRLA 1TKZA 1WG4A 1S1XB 4EZ9A 1GMWD 4OI4A 1RWOB 3IG1B 4DUYJ 3HYFA 4JBCA 4U8VA 5H9FJ 3MN5A 2B6AB 3AVBA 1U4BA 4PPZA 3KLEB 4BC2A 1QHTA 2OTJN 4NCAA 4FBTA 4FKYA 3D6MB 4OMFG 5K8NA 4X62J 4C9DA 5IS2A 1RJJA 5FDLB 1VQ9S 4ZJOA 1U0HB 4F04B 4GMJB 1VS3A 4Y2CA 2NLWA 5F3TA 3WC0A 3VF6A 1RBLA 1S10A 1VQOS 2DNHA 1YHQS 2OZMA 4DV0F 2HHPA 4USKA 1FD2A 2QIFA 1DLOB 1SB6A 1NH7A 4LF7F 1YUWA 3R5AA 4PG8A 4NLUA 1X4GA 1FE0A 2PMWA 2GX8A 1SC4B 3NH2A 4DMNA 2XI2A 5AXLA 1S72S 3THWA 2A10A 3T6JA 3H1QA 3L4QA 2JNJA 3OVSA 2ZE2A 1X60A 1VQPN 3DRSB 5IOLA 4WYBA 2ASLA 1WEXA 4GKKF 5CCLA 3O5TB 1K6YA 1FVSA 2YKNA 4NZ7A 3ISZA 4OGEA 3W9HA 3EDRB 4ZP8A 2X1BA 2QYGA 5KT6A 4IQMA 3WNGA 4ZA1A 4KKOA 5T7LB 2WBMA 2C28A 3O5BA 3VAKA 1JLQB 4GO5X 2VOPA 3AQPA 5ELZA 3JTPA 3MPUB 2LKZA 4LBPA 2B9XA 3SPZA 3SIPB 1Q86O 4P72A 2VU5A 3WUHA 2E9ZA 2DR8A 3VWSA 2W4CA 3OFFA 2EEYA 2JOQA 4O0NA 4UOGA 3R7SB 3SI6A 2FHMA 1HJOA 3FFKB 4OGCA 1MNEA 1HWIA 2GMHA 4M63A 3Q86A 2YKOA 3AA8A 1FKOA 4L3KA 4UTGA 4LH5A 1R7IA 3KJQB 2G1DA 4E8UA 4JD2A 1RTZA 1IG9A 2GVDA 3PLAA 2LXUA 4MKYA 3MEGA 5K20B 3MWBA 4NL5A 3NOCA 1BQXA 3VZHA 4K4YA 4NXNF 1GTEA 4CGHA 1RWMB 5HMWA 4JHDA 4BGBA 2RDIA 2NUBA 2DNMA 2QWQA 2PI5A 2EXUA 1S9EB 1FXDA 1UZDA 3TAMA 3BO4A 1FVQA 1LW2A 2ZE2B 3JSYA 5A8KB 2MQQA 1PAEX 2EK1A 3TANA 2XEXA 3E8OA 3I96A 4Z4GA 3J7Z5 3UWTA 4B1ZA 4EU0A 3QT6A 5EWFA 2WBRA 4QWCA 3UDEA 4LFAJ 3BKFA 2KXNB 1ZBLA 3KLVA 2EC0A 4C8LA 1K8KA 3T6BA 4ZTJA 3CCLS 4N8OA 4WK3A 2G0CA 3HDSA 4IO1A 4BWJA 1U0SA 3H0PA 1Q4RA 3FZMA 1N6QA 3HSTB 4I9LA 4KSEB 3QIDA 1VHFA 3IAS9 1JLCA 1JXEA 3RTVA 3ZEUA 4CO4A 4DV3J 3TVYA 1RHUB 4IH6A 1SKUB 3HVWA 3QO9A 2FDNA 1PJ6A 2M4MA 4A46A 1Q82O 3J81U 3D2EA 3V6KA 4C0BA 4HDGA 4DFPA 5IWAJ 4P2XA 3MFHA 5L46A 3J7ZT 3H2VE 1VOMA 1KXPA 3UNGC 2GGPB 2HQFA 5GMDA 2Q97A 4ANEA 1T0TV 1DQ8A 2GVDB 2G4BA 3H42A 3M2VA 3IAM9 2OCEA 3MEGB 3HVRA 4Q5VA 1GEHA 2GQ2A 4WCEQ 3QSIA 4N5SA 4ANDA 3HVAA 3DAWA 2ZBCA 3Q22A 2OPQA 2FBVA 1HYZA 4JHDB 4OJRA 4F4WA 3QGGA 3TAMB 2FVRA 1MWMA 2V2KA 1WC6A 1H0HB 5IC4B 2GIQA 3DLJA 2VQFJ 2CQBA 2UXDF 4H0VB 3AAPA 5DM7L 2K1RB 4NLXA 1J53A 1GOBA 3M1FA 3DDIA 1WI8A 4DR3J 1BDGA 2DHHA 4NRTA 4JKHA 2KLAA 2PFFB 3DLKB 2WC9A 2GCFA 3PSIA 3GYNA 4ZLPA 4FM1A 1SZ2A 1RWPB 5IQ6A 1TELA 3J7AN 1FNMA 3G6XA 4O3RA 8ATCB 4J9NA 4PXCA 2IPOB 2PDAA 3CCQS 2DPNA 3CVKA 1ZM2A 4FOEA 2WUSA 3C65A 3R9PA 2WB1D 1JLCB 4AM6A 3I6PA 1IWAA 1VSJA 3TVZA 2IS3A 4DV4F 1S49A 5H9EJ 3CG7A 4XO0A 2P9PA 3TZZA 2ZJRQ 4C8ZA 1NK7A 3QO9B 4CF2A 3D2EB 3MCPA 4FF1A 3MCOA 4IQXA 3W2VB 1LOUA 5GADI 4FF2A 3BV8A 4LFCJ 1Y3KA 3K17A 1T9TA 4DPUA 2FF6A 4ED4A 4JI0K 3RB0A 3R6LB 5EX5A 3G6YA 4NLYA 2H54B 1VQ4N 3MOZA 3KHYA 3VVUA 3CERA 3DM2A 1YWXA 1HL6A 4I2PA 2P9LA 2LQ9A 4WIIA 2IIHA 3WXLA 1NMDA 1RT5A 3ZSQA 2O1PA 4XH5A 4Z2XA 3C46A 1S99A 4K4SA 3VR1A 1C0TB 4PG6A 4F26A 3T1YJ 1P8ZA 4JAXA 3BH6B 3TUZC 2UUAK 1K47A 3LDQA 1H98A 5LMNJ 1GK8A 1VHIA 1EZZB 2ABYA 2FZGB 1OKJA 4CNYA 4B1XB 2CWXA 4LSLA 2ZD1B 4OYIA 3DLEB 1WHVA 2VPWB 1IKXB 2FHKA 2HS4A 3O9TA 2P9SB 3HJFA 1LKZA 4A8QA 3N6NA 2DNRA 4ZHRA 2XMWA 5KFDA 1JLEA 4DFMA 3LP0B 2CZVC 3CCZA 4E19A 2ZH1A 4F3MA 4PUOA 1BQMB 5HK4A 1TUVA 4F9OA 1RTIA 3PW0A 3W8GA 4YHHF 2HFUA 2EBGA 4MO5A 4JP8A 1VC6A 3TA1A 3AH6A 3OR1A 1DGKN 2P9PB 1RT2A 1WBBA 1OQ3A 1F6TA 3F2KA 4X66J 3J7A1 3AXMA 3CJ5A 1YIJS 4I6MA 1UPMB 2EC2A 3N9UC 1U24A 4U7UK 3H5UA 1HJRA 1U2VA 2HS0A 3H59A 4CLZA 2RHKA 2IJRA 2VASA 4KAZA 3NMRA 2HIQA 3T5HA 1ZBIA 4B8CA 1BOTO 3HLUA 3VGSA 1RU2A 4NMLA 5LY3A 5JJBA 1YKWA 4Y2IA 3NOGA 1QUPA 4ES2A 3DM2B 1WF0A 4I2PB 2P9LB 2R9LA 1RT5B 2R7QA 7FD1A 1GMUA 2MZRA 4Q7AA 3FRZA 5EU7A 1FXXA 3DU5A 3D9BA 3VGKA 3VETA 1HA1A 3B8HA 3DGVA 4A2BA 2PYJA 3PCOB 4IKFA 4IG3B 1ZC6A 4ZLJA 5M1PA 3J80O 5LL6d 3DOLB 2F4VJ 3PSFA 4JYAJ 3CHWA 3P31A 1OO0B 4M5DA 1TL3B 3DNCA 1TQLA 5KFEA 4NYOA 1SJ3P 2QL9B 3T1HF 3QT7A 4WJBA 3B8AX 4JKDA 1NGBA 3M30A 1RTIB 3DLLQ 2CPDA 3HO1A 1HWJA 4LF9J 4FXWA 1NB2A 3AJDA 3I5AA 1RT2B 1JCGA 2R42A 2MJUA 3TJAA 4J90A 2YHBA 3L6QA 3MXJA 1FTRA 3CD6N 2E8AA 3KKSA 2M8DB 1LXNA 1FRMA 1CEZA 3GJTB 5AQRA 4WCEL 3NKYA 4A4JA 2ZUAA 1WDTA 3DRRA 4GVMA 3TTCA 2ROGA 4RG8A 1U25A 3KIOA 2CG8A 1VQMN 3H2LA 2PEBA 3R1HA 2HZVA 4CF9A 2NCKL 4ZVRB 2XYPB 2C22A 2IVOA 2OHDA 1XN9A 3OYJA 3PRDA 5AQZA 3DOKA 4KHQA 3FFIA 1UA0A 1ACMB 3J7AP 1N5SA 4QU6A 1VISA 4LIWA 4PHTX 5AQHA 3CDBA 3KVGA 3B4MA 2I38A 1SIZA 3CC2S 2GJ2A 1U02A 2CJ9A 1IBKJ 1DEJA 3O80A 4WP3A 2QM1A 5LT5A 5AZIA 3TX0A 1GOCA 4W92B 4QQBA 5JMVA 2FZCB 3EKUA 2HZCA 1DBDA 2CZ4A 4BROA 4DUZJ 5MLCQ 3CIMA 3HKWA 1YJRA 3HF5A 5KRTA 1RT6A 3OY9A 5HBMA 1BMQB 2ZJRL 1R3NA 3OTOF 4LFBJ 4M45A 4MJKA 4WK1A 1VR6A 4FYDA 1WDDA 2R8JA 1NJZA 2Y8WA 4RO0A 3IGNA 4DWIA 5KPTA 3GONA 5L1JA 1VSDA 2ZNYA 3VV2B 4ILMA 4DR1F 3N6MA 3CEDA 3M4XA 3OLAA 1H74A 4AQYJ 3ZTOA 4AHTA 3EJMA 4G1QA 4O44A 1ZTWA 2YX4A 1UW4A 4OLBA 3MAHA 3WDOA 3J81Y 3BBBA 1QAJA 1T9UA 2PMHA 4I6WA 3BDEA 2DCLA 2DISA 3PHTA 2X3DA 4CO0A 2RB7A 4FPBA 4CEQA 4RKUC 1TKTA 3OXGA 4ZP7A 4DSFA 3DLBA 1OH6A 2GIRA 3VCDA 2K7KA 4L8RB 1QY7A 2Q0UA 3PVXA 4DCHA 1D9DA 3IO1A 5J2QA 2QWLA 4RNNA 1VQ5N 2E7XA 1WTFA 3I5BA 2NRZA 3CCJN 3VGMA 2EBEA 5CY4A 2JL9A 2AP1A 2NRHA 2PE8A 1Z2LA 3C8YA 3KWIA 3BGOP 5AZIB 1FWLA 5E26A 4CJLA 4UF4A 3PY8A 1LOTB 4ECYA 3QFHA 1EAYC 2PFUA 2IGIA 3CT9A 5HBMB 4Q45A 1EO1A 5CYMB 4FF4A 1WELA 3VQ5A 4E7HA 1NJWA 3L2QA 3RMAA 5IQQA 2CQIA 4FYXB 1SQEA 1UP1A 3NS7B 1L3UA 3KD5E 2MTLA 4A47A 2A1BA 2O4IA 1S4EA 1KFSA 4PA1A 2YPYA 1LK7A 1T02A 1KAZA 3PIPQ 4JI3J 3VTIA 1BO5O 3KDOA 2H3EB 4K0KJ 1PKUA 1YJVA 4RW4A 3S01A 1R27B 3FRYA 2NZ4A 4JI2K 4O44B 2IAJA 3WT0A 3TP2A 2G0JA 1A0OB 1WTBA 5KOXA 1U2RA 1E6VA 1TVRA 2ACYA 3CSKA 4K8RA 2IHR1 2KVQE 3Q24A 3Q8SB 4JI7J 1E4GT 2XTJP 3SQ1A 1U49A 2LSNA 2MSTA 2UU9F 4N77A 1I5OB 2UVVA 3WQUA 5A8WA 1REVA 4X4TA 2NUHA 2QSWA 2JLEA 1FX4A 5HO4A 3KHRA 5M1NA 2A41A 4LF5J 2IRXA 4CIFA 4DX8H 3GZ7A 5FPEA 5GINA 3OHAA 3KJFB 4JI5K 5EDWA 2JEGA 1R8AA 1B70B 3ZZZA 3DLLL 3I0SA 3CMQA 2ZZMA 3ZT0A 4Y3CA 1S1WA 1TKXA 3N4WA 4B08A 4JV5F 1B9FA 4A5AA 4OYXA 3PZPA 2BOAA 2ZWOA 1VSMA 4CO5A 1UVNA 1YRTA 2DH9A 5BRHA 3S3MA 3A5OC 4C11A 3QERA 1O1WA 3WXMB 1HNXJ 5J2MA 1H2VZ 3BYRA 5CZ1A 4CLTA 1AUDA 4ZPDA 1VRTB 2MZTA 4QPTA 1S22A 4E0DA 4W90B 4RW4B 3IRWP 3MUMP 3DRPA 4EWTA 2P5OA 4B3RK 1Q81O 1A5WA 3BBCA 3H3NO 1IVZA 2DB1A 2E6MA 2W8LA 2EG2A 1LFWA 1O8BA 3SUQA 3MUTP 3UQSA 1BE4A 1ZYQA 1UJ4A 4RUCA 3GOIA 1BHLA 4L72B 4QWBA 4X4SA 3DXMA 5B0AA 4YY3K 2ZDOA 4CH0S 5A8WB 1REVB 1VLYA 2RE2A 4TLRA 2B4PA 5HN0A 5C2FA 1JJ2M 4DR7J 1X9MA 3GYXB 4QIEA 4PQUB 3LM9A 3U3GA 4W4MA 2HOEA 2MQPA 2BE7D 4F8RA 4ZIVA 3ZX3A 4X65J 2OIHA 1HLUA 1T94A 2V68A 2UUCK 1DARA 1JKHA 4H54A 2ZWHA 3EGNA 3NCPA 3SFGA 1EP4B 3V6HA 3NL0A 2FLLA 4TU7A 2RPIA 2B56A 1SAZA 2HNZB 4KHPJ 4AHSA 2OD6A 1TKXB 2QYCA 3JQKA 2Q0RA 1J5EJ 2Q36A 3ZFVA 4U96A 3CQYA 3A8EA 2W6LA 1RT1B 2CYYA 4C11B 2XBPA 1WWHA 3H5YA 2D0PA 5J2MB 2CQ3A 1KKHA 2W42A 5KFNA 2B43A 2HQGA 4KH4A 1EQMA 4WYWA 2DVIA 3GFYA 4DSIA 4BGAA 2SXLA 3HPGA 1NGCA 3AB4B 3GSIA 3GSDA 2ZBPA 2EFNA 4HI2A 3UO0A 3M1VA 1UEKA 2VBYA 2AX0A 5KG5A 4J2EA 1N56A 1F21A 5CABA 3QDKA 3ATVA 5GIOA 1SPBP 2XZDB 2BKOA 3VF0B 4H4KA 2PO4A 4YMEA 3D4JA 2FC8A 4LQ3A 3RMCA 1ICEB 3NGDA 3D28A 1Q5YA 3NGRA 3R6GB 3L4BC 1SS6A 4N41A 2AYGA 1KN6A 2LQ8A 2QZ8A 4LMZA 3E01B 1S6QB 3L2WA 5KFQA 1F5CA 4DPTA 3CJ1A 1W2BM 3CCEN 4PWDB 3MM8A 3CJ0A 5BR8F 3S3OA 3MOJB 5GMKa 3AD8C 2FSKA 1UZHA 1I94F 5DM6Q 3QT5A 4JI8J 3LL3A 3TA2A 2QWMA 2GW8A 2RE1A 4KR0B 4Z4EA 1S79A 4K42A 1NOZA 2YHAA 2OP5A 1XMQF 3L7OA 2BXJA 4PQAA 3PEJA 5F8HA 3PIPL 1CJKB 4OYWA 4R25A 3L3UA 3OYDA 5DMRA 1X5SA 3PNIA 2HFNA 1JL2A 5EUHA 3WXKA 4CHYA 3K9JA 2NNWA 1K9MO 2AU0A 1KTQA 1QAIA 1SI9A 4RX6A 2UYTA 2W4DA 5H1SV 3MPDA 1VQYA 5CE3A 3RSEA 2DHAA 3D0GE 1X5TA 3P5JA 4ISGA 3SMSA 3OW2M 3HULA 3M1VB 3R5JB 2E1AA 1DTTA 1BI4A 2R7YA 5GAEP 3M8RA 1HHSA 3M8PB 2QWOA 4B3TF 5AQIA 1C2PA 1NGDA 2R8GA 2AD9A 4BRCA 1D4XA 2HLUA 3FJ2A 5C5JA 3AVCA 1H2TZ 3I0RA 4Y1DA 2J7KA 2Q2RA 3HKZD 3GCXP 1K8AT 2RQKA 2G8HA 2YHWA 4B9MA 3CXCM 4O0IA 4B3OB 3K7RA 4UT4A 4FOIA 4MTPA 4X4RA 3UKRB 4GKJK 3HHNB 2Q43A 2VC1A 3PYEA 2IJFA 3PRBA 2ZVIA 2KFYA 3G96A 1RHMB 1W97L 4ES3A 3T5LA 3KNAA 3A13A 5EX3A 1NU0A 4NYFA 2DNQA 4FP9A 5AQJA 1N36K 4IKAA 5DQHA 3SBMA 3CUNA 5AQUA 4USHA 2VPYB 1JK9B 4ECXA 1QS4A 3RZAA 4EIAA 4KQZA 2Z2MA 2WBNA 3GIKA 3P4IA 2HHUA 2Z8QA 3TSPA 1SXLA 2QKKA 3GU0A 1YJWS 1NGJA 3KZBA 2CNLB 3MM9A 2DH7A 5B0CA 3BY5A 1NPKA 3RSEB 2VJUA 4UW2A 4K2XA 1GH8A 4ILHA 4H4MA 1U1LA 5KFJA 1RHJB 4ZOSA 2V4QA 5AZJB 1X9SA 3PDNA 2R2TA 1DTTB 4Y2KA 4R0JA 2H5IB 2OTJS 1FEEA 4ED6A 1D8YA 3IMXA 3HVTB 1H1VA 3NS6A 4FNHA 3ZSYA 4HCCA 3GJRB 5AQVA 3KJVA 1UA1A 1X1PA 2VF3A 1TUGB 2RIJA 2E6LA 2IVNA 4XH4A 2CQHA 3HM8A 2HVIA 2VODA 2C3PA 3I0RB 1RT7B 1NDLA 3DI6A 3AOBA 1CC8A 2Z1HA 4OZJA 1PIEA 1KBRA 2E1CA 2OELA 2FB0A 5KG2A 4OKKA 3N5BA 4DV7F 2CDRB 2UUBK 4DTRA 3S6EA 4Y00A 2D1KA 4F50A 1VQPS 3SAGA 3DCAA 5D78A 2HHSA 1IN0A 1OY6A 4P10A 2LEAA 3LPTA 4DUYF 3PYFA 2RHSB 2DRDA 2UZAA 4GC7A 4FJGA 4CBUA 2UP1A 2FZKB 3O2IA 4DSEA 5DS7A 2KHCA 4GVBB 1WAJA 2AQ4A 4X62F 4RZRA 2QC3A 3VPZA 1EB0A 2OPRA 1VRUA 3HI9A 1DJ0A 2AX1A 2DNZA 4WE1B 4EAHD 2MKCA 3ILOA 2QV6A 3SSSA 5U47A 1BQNB 4JI0J 4DL7A 1XNQK 3GL1A 4WKRA 2HG4A 4KHWA 3FSYA 3OYHA 1IBLF 4GW6A 3C6TA 3O3HA 1T05B 2LU1A 2CADA 4EO6A 3VAFA 4IJAA 3I4HX 5IV4A 2HBKA 2ZVSA 3KJVB 2B4UA 4F67A 1NM1A 2GMJA 1RDAA 4K43A 4GV6A 3MF5A 2CQPA 3MTJA 4DX6A 1XIQA 4CGDA 4CBWA 2XB2D 4MH8A 1CS4A 3DDKA 2YQ1A 3DGPA 3EZUA 3NCRA 4H4KC 3OYCA 3DI6B 2EWSA 3T3FA 3JAMU 3VQ6A 1CZBA 2UUAJ 3ID8A 4NLOA 3VMFB 3BF4A 3MCAB 2IVYA 1GLAG 4RUAA 1DTQA 4K4VA 5DM6L 3M32B 1JXBA 2KL8A 2NR0A 2HS3A 5EGYA 3UCUP 3OYAA 1LWFA 1JB0C 3ZZTA 4ZJLA 4AHVA 4TKTA 2WSFC 2P9UA 3W64A 2VB6A 4YNQA 2DO4A 5D0RA 2DY4A 4OJ3A 5C42B 1WKLA 3FSIA 1R43A 1V3SA 1SUQA 4DSKA 2GHWA 2J7UA 2CPEA 2X51A 1YBUA 2Y0SD 1FDAA 1JX4A 4ED1A 3PR4A 4EO8A 2XNRA 1LWEA 3TQEA 4A8WA 2FBXA 3FZHA 1ZA1B 1J6ZA 3RRHA 2FJDB 4RW6A 2GTDA 3VAMA 1IBMK 3ZTPA 3GR1A 1KQSR 2CJAA 5SZTA 2QLBB 1W7WA 2L3MA 5HQMA 1VBXA 1QDUB 2E2NA 3CPEA 2AHOB 4PYAA 4CEFA 4W98A 3OYIA 2ZH5A 1WG5A 4P7VA 2VC0A 2OANA 1S0MA 4H0YB 3THYA 3T5JA 1U1QA 1IM6A 1NJIT 4WF9Q 4DQSA 3C6TB 4CJEA 3L9ZA 2O8DB 3PJWA 5KG3A 1V5IB 3OJSA 2VBXA 5ADXH 3M6XA 4CLKA 1RBAA 3EVMA 4KRWA 3AHPA 1OQ6A 4C8YA 1TYQB 1F0XA 3C3LA 1OWXA 3A3PB 2X6SA 3MAAA 4U95A 4KB7A 4E1NA 1RU1A 3M8SA 5LM7E 1TK5A 2DR9A 1X5PA 4HTUA 4RW8A 3ZZ0A 2W6KA 2GA7A 1DTQB 2MHNA 1RHKB 1F9FA 2XI3A 4XPEA 2LLZA 2J8SA 5DZ6A 4LFAF 4FWSA 3HHEA 1JMTA 1VAZA 1SJ4P 3T9ZA 3W5XA 3J81j 2R8HA 2P9UB 1IQTA 3VOVA 2ZQBA 4CP5A 3MMCB 5ETRA 2ROEA 1VQ9N 2E9RX 1VSLA 1YSJA 3QZ8A 1SH0A 3ENOA 2H65B 3SQ0A 5EX0A 1VQON 4NRUA 2O67A 2NRXA 5KFTA 4DV3F 5KI6A 5KFOA 1FNOA 1LWEB 4HDHA 2VWBA 3W63A 4RW6B 1QQNA 4FWQA 2WZ1A 3WIVA 3C19A 3FQKA 3TUJC 5IWAF 1R6YA 4GRSA 4DV0K 3ZNJ1 5ETKA 2ZZNA 2VG7A 4CZIA 3NCQA 4QYZK 3THYB 3RRGA 3CGIA 3AOAA 4LH4A 1UVIA 3BUZB 4DQRA 3ZLJA 2HMPA 2BW7A 3ZNUA 1NGAA 1QZ6A 4D3HA 4G1IA 2AIRB 4FWOA 3CCUS 1NJXA 4DCPB 2XS5A 3DJCA 3ZT1A 5CCMA 4EYIB 3MAAB 5TKYA 3LALA 3JQMA 2XMUA 3OFHA 4AXJA 2L9WA 1IV0A 4JI4J 1VRQC 4LC9B 5J2PB 2VQFF 1JLGA 4EBDA 1AFJA 4WWSA 1EKEA 1VQ4S 1WSJA 2F96A 2C1EB 2WFBA 4I9QA 4DR3F 4ZK7M 3OHRA 2K2PA 3HSZA 2D7SA 2O8FB 3EGZA 1J2VA 3LP1A 4I2QB 3QGHA 4LRAA 1GX5A 2CPJA 3IAYA 2ASMA 1LAVA 5KG6A 3FMBA 1WD6A 4IDKA 3ZYYX 4FW1A 3WNEA 4JKFA 3EMTA 3GG4A 5F8LA 5CZ2A 3G10A 1Y10A 1K8AO 3LDNA 2B51A 3VGLA 1NDPA 4C97A 1ASUA 4KGVB 2XY6A 2IJNA 2KRBA 3I32A 2NQPA 2WW4A 3KUHA 4X4PA 4DQ8A 1HW8A 2CNNB 3C95A 2DXEA 4I56A 4NXNK 4NB4A 3L2RA 5B09A 4XIUA 3P45B 4DBQA 3HM9A 3CDUA 3LQVA 1T9XA 3D6TB 1HHQA 5F0WA 1HPZA 4BR5A 4DF8A 4JRPA 1OY9A 4O3NA 1S6PB 4CLPA 1JXVA 5MAOA 4RPFA 4MYUA 4X4VA 4DTSA 2AYBA 4ECSA 1SV5B 2QFIA 2HFSA 3NRBA 3QWUA 1NHKL 3T1YF 2FJBB 3PFEA 2YNIB 3PIOQ 2ITMA 5KFZA 1M1GA 3QRRA 4CVNE 4DX5A 2MHEA 3HD2A 5LMNF 4ZN1A 2QTWA 2CQGA 2LFVA 2ATQA 1P6TA 3CCMN 2Z4PA 4BG8A 2R7RA 2YCHA 3HP6A 3LP1B 2NYIA 2FTRA 4JV1A 3NNCA 4DU4A 2RT3A 3KLGA 4J7CA 5C12A 2QL5B 3H08A 2GMLA 1D3WA 1RT4A 2HHTA 3MN9A 1YT3A 3UD3P 4PCQA 1F3VA 4LF8F 5GAGU 4I1TA 4NYNA 3UR3C 1KQKA 3JQJA 2OPPB 5TKWA 1NLVA 4BR9A 2ZZTA 1S77D 3CPWR 3LGMA 4ZPCA 4WF9L 1XWLA 4TXSA 2CPYA 2V50A 1T6DA 4YQWA 2BEFA 4CW7B 2QG9B 2MZ1A 3T9NA 6FDRA 3M6GA 2VDHA 1EJ7L 4NLGA 1NU4A 1WUAA 2X7IA 3Q2SC 3THVA 1GXLA 2LCWA 4C3KA 2RVJA 4FK0A 2BBEA 1HPZB 3CD6S 1FXLA 2AJQA 2HGLA 1ILYA 2QGFB 3SBGA 2ZGZA 2UXDK 3SNNA 1OSDA 2ZBQA 1GNKA 4AF1A 2D41A 2PEHA 2GHPA 4LRDA 2ZHBA 4IO9Q 3S1TA 1FX2A 1VQMS 4NCGA 2MPUA 2HPUA 2LEPA 2P1JA 5K5MA 3T1AA 4JI5J 1RAHB 2F4VF 3NF6A 4HTLA 4JK9A 2KG0A 4JYAF 1N5YB 1E6YA 4AFFA 4DV5F 3QJLA 3JAMY 4QYRA 2HWTA 1NSPA 3SCKE 4BC4A 2D0OA 3VALA 1B64A 2KHOA 1PAUB 3VQ7A 1XHZA 4CD1A 4L3NA 3M8QA 2O3DA 4CZEA 1RT3B 4JN4A 3VEVA 4ILLA 3W5YA 4BS2A 4LR7A 1RT4B 2XMJA 1FDBA 4CGJA 2V5HG 2JEJA 3I9V9 3IS9A 3EVWA 4OKJA 1PJ5A 3ETMA 1JWWA 1YLXA 1UVJA 2YKPA 3OVBA 4C1NI 3FZFA 3POTA 3MM7A 1REGX 1WF2A 3CJ2A 2FJAB 1OY8A 3O9QA 3NMAA 3GP9A 1IR1A 4R5PA 5EWEA 4B3RJ 4Y2MA 3L2VA 5KFVA 4DL6A 2C2KB 4H5WA 1YXQA 1KEKA 3L8BA 1DQ9A 3BZQA 2YKMB 3CCTA 2DTJA 4FJ9A 3J7YI 2HWIA 2IMOA 3KFWX 2C3OA 2W2OP 5BN8A 1QVFM 1IKVB 1U09A 4CZLA 1QZ5A 3QJPA 3R1XA 4FKXA 3AVAA 4YY3J 4R0EA 1FWKA 4OHXA 2KXHA 2PMZD 4FJ8A 3IGVA 5ETLA 1M5KC 3QT8A 5MLCV 1V5VA 3F9KA 4BRKA 1Q95G 5E33A 4NCGB 2CQ1A 3CDWA 3ZT3A 4C98A 5JMNA 4IO8A 1IBKF 4HUGA 2UUCJ 1NJIO 2QWNA 3GB0A 4OYOA 3W60A 1SQKA 1RHRB 3MHYA 3C6AA 1HBOB 4O4GA 1AZSA 2KM8B 3ENHA 1YIJN 4DUZF 5C7PA 4UUXA 4MK8A 4YHHK 3RR7A 4ETXA 2D3OR 1RYSA 2G9OA 2FXUA 1RAIB 2QW9A 1VQ5S 4LFBF 3KHHA 4KHMA 4CIEA 2UUTA 3IS9B 3FCHA 3CCJS 5D6GA 5CR4A 3K2YA 4OVLA 1N0VC 1UKUA 4DL2A 1HI8A 5FLXU 2KKZA 2JLGA 3I56N 3H98A 1S48A 1HKCA 4UOCA 3PUFA 3A2FA 5KFLA 3OS0A 3TW0A 1HI1A 1R0AA 1NB7A 3VEYA 4AQYF 2MQMA 4I7FA 4CLLA 2OJ3A 2E5LK 4Y1CA 4DU3A 1YVNA 5HMXA 1WC3A 1OH5A 1F9EB 4YDDB 3L0QA 3S41A 4O3SA 4DTXA 3ZXWA 1TL7B 2VQEJ 3ICLA 5B08A 3HRGA 2Z58B 3AOCA 3ENWA 3OL8A 1CJTB 1OH8A 2L08A 4WFXA 3CQ8A 4ZKAA 5JXSA 3AAQA 3D1HA 3FDSA 3CIPA 3SBTA 1D09B 5HMYA 3D66A 3GG1A 1KQFB 4GMKA 5AQSA 2VICA 4QR1A 5G4DA 4LF4F 3HMJG 3PM9A 4K4XA 2DD8S 2DR7A 3Q8RB 2UXBJ 3O3GA 3IUCA 2CH6A 3D7EO 4FS1A 3CF5Q 3C14A 4O4GB 4DSLA 2F9WA 3T1HK 3A4TA 1H7XA 2MQLA 4FJJA 1D8ZA 5KFXA 1FI4A 1W2IA 1X4EA 1EXQA 2LA6A 2QT7A 1WKKA 2BACA 3MPVA 2X1FA 4A8OA 4ECUA 1QLNA 3GG0A 5KG0A 5LL6Z 2HBMA 4CTAB 4NLVA 3HK2A 4BE0A 2RQ4A 1RBVA 2HBZB 1BISA 3BGUA 3RYLA 5F8NA 1J5OA 3EDQB 4JI3F 3MR6A 1R0AB 2QO3A 4JOUA 4K0KF 4I7FB 5EVZA 3AO2A 1KAYA 3SYZA 3NF9A 3TARA 3RB4A 4B9UA 1NK4A 1S0VA 3D2FA 4IG0B 2CAJA 3VGTA 3CNQP 1HNIB 1WSIA 4OPKA 1R59O 1P1LA 2E1YA 3NVMA 5IM0A 4X4OA 2W7PA 4JI7F 2N4CA 2N3OA 3NF7A 4NO7A 4F4ZA 5D0GA 2B5JA 4UZBA 4IO9L 2CQ0A 2E5GA 2YX1A 1M5VC 3OFEA 1ZAXA 5LSOA 1WC0A 3UCZP 2JHEA 2QA2A 3US5A 2W2MP 5FPMA 4JKGA 4LF5F 2HBRB 3Q23A 1HKAA 2MY8A 3HFZB 2R7UA 4IJNA 5E7OB 2A6OA 3C14B 4GKJJ 3J81O 3AY0A 4DB3A 2B0GA 2EPIA 3ZSXA 3DC2A 3MN7A 2GWJA 5CD4H 1NJYA 2KM8C 2V7YA 2ROPA 1N36J 2G2OA 5L8RC 3PR5B 5HP1A 5D8HB 3QBCA 1Y97A 1HARA 1Z6RA 3GQCA 4J2BA 1HNXF 2BKPA 4F25A 3OL6A 2DH8A 3IFRA 4DR1K 4NLSA 3IN5A 1K44A 1MN9A 4UQTA 3WBZA 2KYXA 1GXTA 3QPIA 5KT4A 1DT9A 2C2NA 3AT1B 3AVFA 1NK8A 2DGQA 3D2FB 4EFAC 1XNRK 3MR3A 2GELA 2NS1B 3ID6A 3AVIA 1Z1ZA 2RD5C 1JLBA 5IM0B 1VBYA 4BRAA 1FXRA 3MPWA 1YAGA 2Q3SA 4MO4A 3JSBA 1HD1A 2IBKA 3G86A 4PZVA 1HQUA 1JNRB 5GAHU 1ZBFA 3PV8A 2XM3A 2V69A 4DR7F 4RU9A 3EE8A 1VSHA 4NASA 3LPEA 4JKGB 4M3RA 2QLWA 1EQ0A 1F9HA 2E2OA 2P9NA 4LRFA 2Z57B 4CWBA 1Z05A 5HVGA 5AQTA 1AB8A 2V9KA 4X65F 4WKYA 2KFNA 1XMBA 3CO0P 2E7VA 3OYBA 3BR8A 1NK6A 3AVLA 1ZA2B 4CFAA 4I67A 2MKHA 4KHPF 2Z56B 2UUBJ 1M5OC 3FZ2A 1J5EF 5EN1A 5RUBA 3LA0A 5A6WA 1YJ7A 3F44A 1NZAA 3MWTA 5HP1B 2EVZA 2RU3A 3U02A 2HSTA 2GUPA 1J54A 1VI7A 3KTQA 2DGOA 1TZ0A 1RKIA 4LF6K 3CCES 1C1AA 1VYAA 1K73O 3GIRA 2NZCA 2H3GX 4OLAA 2KU7A 5HVHA 1WB9A 5ETPA 2MY7A 4O3QA 2NXEA 2B9YA 1L3SA 1EX4A 2W9AA 1FO1A 5AQGA 4FZXC 4M5MA 1XNQJ 4LSNA 3GFHA 3CFPA 1S9GB 2VIHA 1JLBB 2P9GA 4CZKA 2MGZA 3TVKA 1KSPA 2C2OB 2HEKA 5J2NA 1VBZA 4J9VA 2YWEA 1SC3B 2V2VA 3E9PA 1OS5A 3IDHA 1S59A 4YOYA 1FA0A 3O44A 2AJ2A 1FJGK 2X78A 3AVKA 3FBCA 2PZSA 1K1SA 4FJMA 3BP8A 3NG8A 3CF5L 2OO4A 2NXCA 4RNHA 3W7BA 3B4DA 2VKZG 2QRRA 4NXMF 1T3VA 1AROP 1BIZA 4FJXA 3O1WA 3JTOA 4USVA 5I3UA 4BE2A 3K5PA 3GIIA 4HACA 5ADZA 2FYXA 2ZM6F 3Q89A 1RLDA 3ZZRA 3CCVN 4LT6A 8RUCA 4Y0WA 3EWGA 4JI8F 3R7NB 2E29A 2VOOA 2OFHX 3TJ9A 2ALYB 1CZAN 3QIPA 3CULA 3VEWA 2HNYA 2OEJA 4XDDA 4YOVA 3WC2A 2O8BB 2EFVA 1Y4ZB 3PX4A 4NA1A 3G87A 3GYGA 3M2UA 1VQ6N 1IBMJ 5D3GA 1WHYA 4NEYA 3DLHA 3KJNB 2CXEA 4ISEA 3TAGA 1E3MA 3A8JA 2XYGB 4BHQA 3H4DA 5FLXY 1WHWA 4PKIA 4LSNB 4I68A 5CHCB 3LDOA 3Q83A 3NF8A 4NLRA 3F73A 1H73A 5BPNA 3QYYA 5LMUF 4AYBD 1TAUA 5J2NB 3Q7CA 1Q9YA 3H3OB 2UUWA 4AILC 2QFJA