1HQEA

Human immunodeficiency virus type 1
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
554
structure length
554
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords POL POLYPROTEIN
publication title The Lys103Asn mutation of HIV-1 RT: a novel mechanism of drug resistance.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 135
structure length 554
sequence length 554
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2000-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1hqeA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1hqeA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1hqeA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1hqeA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1hqeA05
1L3TA 3DYAB 4AHUA 4OLBA 4EYHB 1C1AA 1JLCB 4O0JA 3QO9B 1NJWA 3VQDA 1IKVB 4QAGA 3V6DB 4FJHA 1KVAA 2FJVA 5C5JA 3OL9A 3OVNA 5KI6A 5DMRA 2DPJA 4O5BA 4NYFA 3RAXA 4B9LA 1Q8IA 2E9TA 4HCCA 3DRRB 3TVKA 2GUIA 3ISND 4JV0A 1IKYA 4QPXA 2EHGA 3N6LA 3LZIA 3SPYA 1U04A 4J9LA 2ASDA 3ASMA 4U7CA 2XY8A 1D0EA 4KB1A 4H8KA 2WCXA 5DGBA 4J9PA 3AVBA 3E01A 3AA3A 2GV9A 1VRUB 4TY8A 4DG1B 3FQLA 3PX4A 1F21A 4CEDA 4DL2A 4F3OA 3N6MA 4CERA 5I3UB 3V9SA 1HQUB 4KKOB 3P83D 3BSNA 4E89A 4C8KA 4KHQA 4HTUA 5C25A 1VSHA 2D5RA 3CDEA 3SUPA 1LW2A 4Z4EA 1S9EB 3LP1A 2FBTA 3QIOA 4WE1A 1HYVA 4J9NA 2BQRA 4NYZA 1FK9B 2YNIA 4BE2A 1T05A 5KT3A 3LALA 4B8CA 4IH5A 2AGQA 3ZSWA 3BQ2A 4IRKA 4Q43A 1RTHA 3ISNC 4CHPA 4NCGB 4Q0BB 4QWCA 4WZMA 4IRCA 3LDSA 1ZTWA 4K4WA 2E4LA 4FZZA 3KJVB 4YNQA 1LWCB 2UUTA 4FJMA 3M9OB 3SQ2A 4DL3A 2ATLA 1Q9YA 2BR0A 2YHBA 3S3OA 3KD5E 3BSOA 4EP4A 4RNMA 5KFPA 4LQ3A 3OLAA 3SFUA 3H59A 2D7SA 1TK0A 2G8UA 4CJ3A 1SH2A 1KFSA 1EP4A 4F2RA 4FLTA 2RDJA 4ZPDA 4GC7A 2AQ4A 3G86A 4I9LA 3RR8A 2HHWA 3D45A 4QWAA 2FJXA 4CEBA 4YQWA 3CFOA 3T1AA 4N41A 1NK5A 5K14B 5L1JA 4YMEA 4AHVA 4NLVA 3PZPA 5KFRA 5EWEA 3I5CA 2YNFA 4U6PA 4W5NA 3MEGA 1RTJA 1S6QA 1WNEA 3IGVA 2IM2A 3I5BA 1S48A 2HNDB 4ID1A 2R7YA 4FM2A 4OKJA 1LWFA 2YNGA 4ELUA 3KLEB 1R0AA 3H4DA 1J9AA 3NBPB 2IOCA 1NNDA 3ZT2A 4DSLA 1N48A 1X9WA 4J2DA 1S9FA 4FW1A 1SKSA 3DLKB 4L8RB 4RNFA 3RR7A 1N56A 4OVLA 1S1UA 2D0CA 4N76A 4TY9A 4BE1A 3OLBA 3RMDA 3SQ0A 3HKWA 1I6JA 3C6TA 2ZE2A 4EZ9A 4H4MB 3DRPB 4ED0A 4IOBA 5F8IA 3G10A 3NF6A 3PW7A 1QAIA 1BQMB 1RTIB 4RU9A 4DTPA 1SV5A 1NHUA 4C8MA 4PWDB 2BE2B 4CIEA 4RZRA 2FJWA 3AVAA 4NRUA 3VQ9A 1UWBA 3V6HA 1KLMA 4FJLA 3CO9A 4JS5A 3CYMA 3NH1A 4FS1A 1FKOA 2VA3A 5KG7A 4FM1A 2HWHA 2G8WA 5DQIA 4ZVFA 1XR7A 5KRTA 4EO8A 2R2UA 4JV1A 1LW0A 2W7PA 1IG9A 4IDKA 4ED2A 4J9SA 4CGJA 1RBVA 4CHYA 1RAJA 4HYKA 4FK2A 3OJSA 1T7PA 4URGA 2JC1A 4TQSA 4OGCA 3K2PA 4O55A 2W9CA 1TKXB 3M9MB 3CQ8A 3BREA 3QZ7A 3LP2A 4AHSA 2IA6A 2IC3A 1KHVA 4E1NA 3CVKA 2QXFA 2FBVA 1KSPA 4CJRA 1C0TA 4CGHA 1TV6A 3PV8A 2FBYA 4I9QA 4WZQA 4DTNA 4DS5A 3ZSZA 3OYCA 4G1QB 4NLQA 2G8VA 4WFYA 4DTUA 5JS2A 4OL8A 3V6KA 1FKPB 4TN2A 1NKEA 3V9ZA 4DU1A 1HQEB 5T14A 1RDRA 4CJQA 1QTMA 3K5LA 3T5HA 3KHGA 3U3YA 4CJWA 3SUNA 3OS0A 4ECSA 4K50A 5HBMA 4PQUB 3PR5B 2R8HA 2WHOA 1Q9XA 4LD0A 5F8LA 4RNNA 1QS4A 3GIKA 2D0BA 4J2AA 5HRNA 3I0RA 3E01B 1T3NA 3DYAA 4DFJA 4MQ3A 1SH3A 1JLCA 3RMBA 3QO9A 1C1CB 5KT2A 4M42A 2ZQBA 1B9FA 1HPZB 3V6DA 3RB6A 3AVFA 5C25B 3NCIA 1HNIB 3TAEA 1NK7A 5HROB 5DLFA 4IR1A 3AVIA 3LP1B 4CFBA 1VSJA 3HJFA 4IG3A 3LP0B 1NK9A 3K5OA 3LWLA 1T05B 2AGPA 3OYAA 4RW8B 3QNNA 4CEOA 3DRRA 5FRMA 4QCLA 2Z1HA 4I7FB 2DFFA 2P1JA 3H4BA 4KHRA 4ED8A 3RB3A 5F8MA 4XO0A 3U3GA 3C6UB 1SH0A 3PY8A 2R8JA 4IKAA 4M3WA 3NGZA 3D0PA 1VRUA 4DG1A 3KD1E 3TAPA 4MH8A 5KFKA 1IKXA 4KHWA 3KK1A 3PUFA 4KKOA 1S5JA 3H5XA 4H54A 2C2DA 3CDWA 2ETJA 1S4FA 3HK2A 3GV8B 1U4BA 3L2QA 2O5DA 4PY5A 1RYRA 1UAXA 4CFDA 1FK9A 1RILA 2XCPA 4ZPAA 5KT6A 5KFGA 1QSYA 4EBDA 4K4TA 3QEXA 2GBZA 3WNEA 3NL0A 2W9BB 2WB4A 3KJVA 2AX1A 3CJ0A 1LWFB 4MKAA 4CJFA 4MIBA 4R8UB 4ECZA 3QINA 4F4YA 3NGDA 2EC0A 3O3HA 4DSIA 3IG1A 2YNHB 4CJLA 3L2VA 3HP9A 3K58A 4RW9A 4LY7A 2F96A 2J6SA 1WSFA 2FBXA 3LWMA 1ZBFA 4ZHRB 4K4XA 3BSCA 3QYYA 3LPUA 2OA8A 2VA2A 4B3OA 4NLWA 3M9NB 5K14A 4UQGA 3NDKA 4F2SA 2Y1IA 3M8PB 2VG7B 2FLNA 3BSAA 4EO6A 4R5PA 4PUOA 4AHTA 4Q45A 2HNDA 4DTJA 3ZT1A 5DQHA 1SL1A 4M3TA 5KG6A 1FKOB 3VQ8A 4M41A 5KG1A 2C2RA 3KLEA 4Z4CA 3V6JA 4NCBA 5F9NA 3NBPA 3PX6A 1SKWA 1K1SA 4GW6A 3PX0A 4IBNA 1S0MA 4LSNB 4C8NA 3LAKA 3DLKA 1W25A 1HNVB 4FLWA 4FYDA 2HHQA 2ILZA 2XC9A 1BISA 5DK5A 4K8XA 1RNHA 3T3FA 4IFVB 3LANA 1WSGA 4F3TA 4H4MA 4ECRA 3DRPA 1S49A 1T8EA 2XHBA 1BQMA 1RTIA 2BRLA 3N6NA 4DTMA 4FJIA 4J9RA 5J2PA 4B9TA 2C28A 4KTZA 4PWDA 1WLJA 3AVHA 2BE2A 3AVLA 1TV6B 3C95A 4ID5A 5KFLA 4B8AB 1JLQB 1XR5A 2UUWA 2UVWA 1G15A 3RMAA 5L1LA 3S3NA 5JUMA 4CJ4A 5F8GA 3UDLA 3D28A 4NZ0A 5KFQA 4GC6A 2I1RA 2J6TA 1S0NA 3RBEA 3F73A 4MK7A 4RNOA 5HBMB 3HP6A 4R0EA 4M3RA 2HVIA 4O3PA 4E7IA 1TKXA 3OHAA 2C2EA 3NGYA 4J9QA 3MXMA 3I0RB 4N47A 3SFGA 3KOAA 1VSEA 1S1XB 1BQNB 3NMAA 4O3QA 4J9OA 3CDUA 1WN7A 2X78A 2UVVA 4CFCA 3OYHA 4E7LA 4ZTJA 5KFVA 4CJVA 1RT4B 1KHWA 2RF2B 3KK3A 3NKYA 3V9XA 4Y1CA 3AA4A 4CGFA 4WYWA 1L3SA 5EDWA 3WNHA 4G1QA 4W5QA 5KGXA 2FVPA 2QK9A 4ZP7A 5DG7A 2RN2A 4DSJA 1FKPA 4IG3B 4F4XA 2Z1JA 1HQEA 3ZSXA 2ITGA 3V4IA 4E7KA 4CHZA 2QKBA 3TANA 1RTDA 3ULDA 3OY9A 1TKDA 1JLEB 4CJPA 3RRHA 4PQUA 4DLGA 4KFBB 3OYJA 2D3UA 4HUFA 1KRPA 3OL8A 1LAVA 4B9MA 4QOZB 3MTKA 1S1TB 3NGIA 4BDPA 4IH7A 3P1GA 3QGHA 3HVRA 3HVAA 3ICLA 3VQ7A 1IKWB 4EEYA 1IKXB 4K4SA 2JEFA 1C1CA 4O0IA 3KK1B 2XY7A 3CJ3A 1HPZA 1ZETA 3KKRA 3KLHB 4RW7B 5KTQA 3SI6A 1EKEA 5HLFB 1HNIA 1ASUA 1MU2B 4FBTA 5HROA 1SUQB 3MR2A 3OS2A 2ATQA 4DF4A 5KFAA 4OGEA 3LP0A 1J53A 4LSLB 1EX4A 3SZ2A 1JX4A 3GILA 1BGXT 4O3OA 4RW8A 3DLGB 3EPGA 4DTXA 4FJKA 4I7FA 3F9KA 2HVHA 2DPIA 1ASVA 2UVUA 1LAWA 1D8YA 2P5OA 2OPPB 3C6UA 3UR0A 2IAJB 3L8BA 1WNSA 4TSXA 4ZVHA 4Z4FA 2DY4A 1ZBUA 3SCXA 3LAMA 5KFBA 3PW5A 1VSMA 3K59A 3D5MA 1RA6A 1XR6A 2OZSA 3IG1B 2WK4A 4RW9B 1RBSA 3I8DA 2YV0X 3GIJA 1SL0A 1XHXA 3QERA 3SV3A 1KVBA 4KHYA 3RTVA 5HRRA 1ITGA 1ASWA 1JXBA 1S6PB 1JLAB 3OYFA 3H5SA 3G6YA 3DRSA 4B3OB 4DU3A 4ZPCA 3H2LA 1TK5A 2HW3A 3C94A 2W9BA 3AVNA 5HP1B 4CEQA 3OS1A 5KG5A 4R5PB 4PUOB 1REVA 2IJNA 1RDCA 2VG5B 2VG6B 3O4NA 2FVSA 1RBRA 3CJ5A 3M8QB 5JXSA 4FK4A 4R8UA 3NH0A 3RWUA 3L3VA 4MKBA 4DSFA 3TAMB 1WAJA 3VQBA 2YNHA 4DQQA 2OYQA 2IBKA 3MXJA 1YVUA 4KB0A 1JLBB 2ASJA 4HCBA 4OKEA 1JKHB 2GC8A 1W0HA 4BDZA 1ZTTA 1N4LA 1MMLA 4Y3CA 3DM2B 4ZHRA 4XPCA 3CG7A 1TL1B 5J2PB 3ZSYA 3M8PA 1VRTB 5KFNA 2VG7A 1YVFA 3LPTA 4ZTFA 4ID5B 3EZUA 2AWZA 3NF9A 3RAQA 5KFCA 2KFNA 1RT5B 2HHVA 4DFPA 2JEIA 4B9UA 1VSLA 4ICLB 1RT6B 4OPKA 5KFHA 4MFBB 4CHQA 4BE0A 1LWEA 1JL1A 3NAIA 4LSNA 1CZ9A 1XC9A 3SUOA 2GIRA 5EU7A 1HNVA 4XIUA 3CM5A 3V1QA 4TYBA 3HPOA 1D9DA 3QGIA 1DTQA 4CEZA 1JLFB 4IFVA 4KHMA 3HL8A 3CJ4A 4F4ZA 3LP3A 3TI0A 5DG9A 4CJEA 1DTTA 5EWGA 1IH7A 1L3VA 5KFYA 3KK3B 4ECWA 1NOYA 2Z1IA 3DI6A 3M8SA 4Q44A 1WSEA 1ZBIA 4CHOA 4EBEA 1JLQA 1VSDA 4CF2A 4CF9A 2BDPA 4CJ5A 4CEFA 2VWKA 5J2NB 3V4IB 3L3UA 4FCYA 3K5NA 1RTDB 2B6AB 4FM0A 1L3UA 1NJYA 3EYZA 3KIOA 2HHSA 1BIUA 4TXSA 5HRSA 2OZMA 3A2FA 1BI4B 1QQCA 1C0UB 2AGOA 1S1XA 1BQNA 3TR8A 2XI2A 2AJQA 2ZD1B 2XI3A 2LSNA 1RT4A 3BQ1A 2RF2A 4EP5A 3HO1A 3VQ4A 4RW6B 4FJ8A 3KMSA 1QSLA 5CYQB 1K6YA 3AA5X 3G6VA 4DF8A 4NLTA 2O4GA 3QZ8A 4Y1DA 1RT1B 2BQ3A 2V4RA 3QGGA 3V1RA 1TGOA 2QV6A 1TK8A 4YP3A 3KHRA 4WFZA 1QE1B 4HHTA 4CF0A 2IM1A 3MEEA 5L1IA 3H08A 4J2BA 2NUBA 3KK2A 2RDIA 3SQ1A 4ZMMA 3PHEA 1YTUA 1JLEA 4CESA 4KFBA 1RT7B 3ZSOA 4KHUA 4YR3A 3I0SA 2HMIB 3Q8PB 3OYBA 4NCAA 4NLOA 2W8KA 1N6QB 2ZKUA 4ECQA 1S1TA 3JSMB 5CZ2A 1IKWA 3DLRA 4QWEA 1ZBHA 4JS4A 3KLHA 4RW7A 5HLFA 1S9GA 4WFXA 4X2BA 1MU2A 4NLXA 1SUQA 3HYFA 3O3GA 3CM6A 4CJKA 1NK8A 4I2PA 4C8LA 4LSLA 3ZSQA 3DLGA 3DRSB 3MXIA 4CEAA 2VWJA 4CFAA 2G8FA 1U49A 5KFDA 4ZVEA 1QAJA 2OPPA 1GOBA 5J2QB 1REVB 4O44A 3TQ1A 4EYIB 3THVA 5L9XA 2IAJA 4Z4HA 2HAIA 2OPQB 3OYNA 4DS4A 4ECUA 3DOLB 4ZVGA 3AO5A 4BACA 3H5YA 3T5KA 4DWIA 4JRQA 1N5YB 4DL6A 3KLFB 3QNOA 4E7JA 3NF7A 3KNAA 3NH2A 3TABA 1RBTA 4IG0B 4AHCA 4E19A 1NK6A 1S0OA 3T5JA 1TVRB 1TP7A 1S6PA 3AO2A 1JLAA 3ITHB 3CFRA 3PJXA 3MR6A 3OYLA 1W9HA 4CK3A 3BGRB 3OYIA 4CGIA 4RG8A 4EBCA 3DLEB 3CJ2A 5HP1A 3EPIA 3PVXA 2JGUA 1IO2A 4IR9A 2VG6A 2VG5A 2F8SA 3RRGA 5KFIA 4F4WA 3M8QA 3IRXB 2XGQA 3HVTB 3AVKA 1LWEB 3MEDB 3V9UA 1D1UA 4MK9A 5KG4A 4DEZA 3AVJA 3SV4A 1U48A 3TAQA 3TAMA 1T94A 5J2MA 5KT5A 1ZBLA 2C22A 4NLRA 4GMJB 3UPFA 5E41A 4KREA 2R8KA 5JS1A 3RB0A 1DTQB 3DDKA 2BANB 3G6XA 3DOKB 3HPHA 3OYGA 1JLBA 1JKHA 4ECVA 4ED3A 3EY1A 5KG0A 3DM2A 3VQ5A 1TL1A 1DTTB 3SUQA 3K5MA 1NKBA 5KGWA 2XY5A 2EX3A 5KFZA 1HRHA 4CEEA 4ZP6A 1VRTA 3DI6B 1BL3A 1SKRA 2QKKA 3L2RA 3H40A 1LV5A 3S3MA 1RT5A 4ICLA 4WXOA 3MR5A 1RT6A 3VA0A 4DFMA 4W5TA 3O4QA 1JL2A 4MFBA 3MAQA 3BDPA 1XWLA 2YHAA 2WOMB 3KLIA 1S1VA 4RW4B 1QHTA 1RDAA 3CFPA 4PA1A 4MIAA 2E6MA 5KFTA 3NAEA 4QW8A 4W5RA 1XI1A 1C1BB 2X6SA 2Z1GA 3KLGB 1JLFA 4TYAA 1S97A 4O3NA 4E0DA 2RKIB 2E6LA 1CXUA 3FFIB 3KTQA 4BWMA 3FQKA 5KT7A 1A5WA 4FJJA 2X6NA 2FVRA 4CCHA 3CWJA 2FC0A 4DFKA 3VQSA 5DLGA 4JLHA 2YKMA 2XY6A 5J1EB 4AH9A 2X74A 4KE5A 1RYSA 2V9WA 2E9ZA 4IKFA 3MECB 5J2NA 3G0ZA 5SZTA 4DQRA 3LZJA 5KFFA 3MEEB 4CJUA 1J54A 4M45A 3KK2B 1T03B 3SQ4A 3QIPB 3KHLA 4NLSA 4FXDA 3DMJB 3FDSA 2B6AA 1BCOA 3V9WA 5I42B 2HNYA 3TAGA 3I0SB 1RT2B 3WNGA 5T7BA 2XRIA 3OYDA 1KTQA 3HSTB 3QLHA 3SNNA 4KHSA 1CXQA 1BI4A 1C0UA 4IFYB 3PW2A 3EZ5A 4B9SA 2HB5A 2A1RA 1NK4A 2ZD1A 1HJRA 4C8OA 2XCAA 5SWMA 5C24B 2WONB 3S9HA 5CYMA 2YKNB 4RW6A 2OPRB 3HT3A 1S9GB 1NJXA 3ZT4A 1RT3B 5DQGA 4F50A 4KV8B 5CYQA 4HUGA 4ED1A 4KBIA 4FJGA 1RT1A 4IH6A 2KZMA 4I2PB 4DL4A 1SL2A 2WRMA 4DQPA 2CJQA 2OPSB 5CZ1A 4KO0B 4NLDA 1QE1A 4URQU 3FSIA 4K8ZA 1KLNA 4M94A 2I5JB 3E51A 5KRSA 1DLOB 3QEPA 1RT7A 4CF8A 4O44B 2JEGA 1U09A 3CIZA 3VQAA 3RB4A 3KLVA 4ECXA 3KMQA 2HMIA 1WSJA 2HNZB 2ALZA 3OJUA 1N6QA 1U45A 3JSMA 5D3GB 2V0NA 4Q8EA 1YTAA 1EETB 4M95A 4FBUA 2B4JA 3SYZA 1A5VA 4ED7A 1JLGB 1Z25A 3AVMA 1HYSB 1X9MA 4FJ5A 2KZZA 3AO1A 4DQIA 1NOZA 2HWIA 1BCMA 1K1QA 5KFOA 3GV5B 4M3YA 4Y2AA 3BQ0A 4NRTA 2ASLA 3U6FA 4EZ6A 5L1KA 5DG8A 1VK0A 4FZYA 3MFIA 1BHLA 3GYNA 3OYMA 2AX0A 5FDLB 4OJRA 1B92A 4DSEA 2IS3A 3V81B 2R8IA 4DL7A 1XHZA 1D9FA 2G8KA 4WYLA 1EXQA 1X9SA 5J2QA 5F8NA 4ECYA 4I2QB 1QSSA 4NLYA 5EUHA 4IRDA 3NHGA 5EWFA 4RUAA 4QW9A 4Q8FA 2OPQA 1D5AA 2DTUA 3BJYA 4YFUA 3DOLA 2O4IA 1S1WB 3I5AA 3OL7A 4LH5A 4FLYA 4FJ7A 1N5YA 4W5OA 4J9MA 3KLFA 4RNHA 5J2MB 3VN5A 1TKTB 5KFEA 3L2UA 3DLBA 1ZYQA 4CF1A 2WTFA 2R2RA 4ED6A 1TKZB 5KFSA 4IG0A 3WNFA 4KAZA 1O1WA 4OKKA 1TVRA 1UOCA 4OPJA 3TAFA 3ITHA 2PYJA 3O3FA 4CJTA 4O4GA 2RPIA 3VQQA 1C2PA 3BGRA 5C42B 1HMVB 3ZSRA 4DTRA 3DLEA 2CKWA 1L5UA 4FLVA 3T19A 3VQ6A 3VQEA 4KAIA 5CY4A 4CIGA 4O3SA 1Z26A 3QEIA 2OH2A 3IRXA 3HVTA 3KLIB 2R2TA 3MEDA 1S1VB 3IS9A 3H5UA 3T5LA 3MF5A 4DMNA 1OS5A 1TL3B 4BDYA 1GX5A 1HARA 4CGDA 3PO5A 3HHKA 4K4UA 2BANA 3DOKA 3MFHA 4HKQA 3BR9A 2Y1JA 3SJJA 4H4OB 2QE5A 4B9VA 1J5OB 3JYTA 4RUCA 4QWBA 2V4QA 3GQCA 4URSA 1WSHA 2PZSA 5KFUA 2JLEA 4FJXA 2XGPA 4WXWA 5KFXA 2YKMB 4Y34A 3K57A 1A5XA 2B5JA 2W42A 4BWJA 2FLPA 3Q8QB 2WOMA 2IJFA 4FS2A 3HVWA 4RW4A 2W9AA 1TQLA 4OLAA 1HYZA 5HRPA 1VSIA 4KHNA 1JXEA 1YT3A 3QETA 1CSJA 4ZPBA 4CK2A 1C1BA 2HNYB 3KLGA 3QEVA 4FW2A 4M3XA 2J6UA 1GX6A 2FVQA 1C0MA 3QLHB 2RKIA 3ZCMA 4O3RA 2FLLA 2IMWP 3SPZA 3FFIA 3VA3A 1IKYB 2GIQA 5CYMB 4M3ZA 3KKSA 3HPGA 3OHBA 4DU4A 3FRZA 4TY8B 1RBUA 5J1EA 3HM9A 3VQPA 4KRFA 3GV7B 3MECA 1IKVA 4JUZA 4Q5VA 4IQXA 2E9RX 2IM0A 2JC0A 3ALYA 3Q8SB 1T03A 3NFAA 3QIPA 5F9LA 4K4YA 3DMJA 3IAYA 5FROA 1JIHA 1LW2B 3QIDA 4WE1B 4DTOA 5I42A 2YNIB 4XPEA 4LQ9A 4F4KA 1RT2A 4DLEA 2IDOA 2KQ2A 4FZXC 2D0AA 4IFYA 1U47A 4ELVA 4J2EA 4KI6A 1RTHB 1KCFA 3PW4A 5C24A 2ILYA 2WONA 2YKNA 4ELTA 2OPRA 4JRPA 2D41A 3MR3A 2F8TA 3PW0A 1RT3A 5KG2A 3AO4A 4KV8A 4TQRA 4KB7A 5KFJA 4CHNA 3RMCA 4E7HA 1CLQA 3PJWA 3GIMA 2OPSA 5I3UA 3OYEA 2G8IA 1S10A 4E3SA 3AVCA 4KO0A 1HQUA 1Z4UA 1JXLA 3PO4A 2IGIA 2KFZA 4Y2CA 4CECA 4CIFA 1EP4B 2I5JA 1NK0A 1DLOA 2PYLA 1S9EA 4FLZA 3VQCA 4M3UA 4NLGA 1FXXA 1NKCA 3GIIA 2G8HA 4NLUA 2HHUA 2KTQA 4Z0UA 1GOAA 2PY5A 2HNZA 5F8HA 2AU0A 2FVCA 5D3GA 4ZP9A 4CE9A 3Q8RB 5KG3A 1TAQA 1EETA 1UA0A 4NCGA 4Q0BA 2YNFB 1JLGA 1RDDA 2A1SA 3MEGB 1IM4A 1RTJB 1S6QB 1HYSA 3AA2A 3IN5A 1VSFA 4YR0A 4QWDA 1KVCA 2W8LA 2P5GA 3AO3A 3TARA 1WSIA 3KHHA 4NYNA 1LWCA 4KTQA 4DSKA 2YNGB 1R0AB 1KFDA 3HXMA 3QESA 4DL5A 4DTSA 1NHVA 2BRKA 2UVRA 4DQSA 1X1PA 4O4GB 2IM3A 2Q3SA 2R2SA 4YR2A 5FDLA 1S1UB 3AV9A 4LH4A 1CZBA 3H98A 3V81A 2D3ZA 1RA7A 3QEWA 4K4VA 3OYKA 3C6TB 3B6PA 2ZE2B 4E1MA 4Z4IA 4I2QA 3RBDA 5KFMA 5F8JA 2XO7A 4G3IA 3TWHA 3OL6A 4N56A 1SV5B 4J9KA 1QUVA 1RCHA 2HHTA 4KI4A 1TAUA 1S1WA 4KPYA 5DGAA 3IS9B 3AVGA 4FVMA 1UWBB 3ZT0A 1BIZA 3ZT3A 1TKTA 4F8RA 1KLMB 2KW4A 4TLRA 4JV2A 4FLXA 3V1OA 1TKZA 1Y97A 1C6VA 4HVJA 4HUEA 2DFEA 4Z4GA 4B9NA 1NJZA 1WAFA 1LW0B 2DFHA 4IDKB 3JYTB 4CGGA 1I3AA 5C42A 2W7OA 4B08A 3M8RA 4AILC 1HMVA 3P5JA 2W9CB 1B9DA 2P51A 4CK1A 3NE6A 2BGGA 3B6OA 3LP2B 1I39A 3SI8A 2IC3B 3PR4A 2B5JB 1VSKA 2JEJA 4N5SA 1C0TB 4NLPA 2F8EX 3DLHA 4FJ9A 4KTWA 1TL3A 4ECTA 3ZSVA 4K4ZA 4FJNA 2R8GA 2B43A 4MK8A 4O4RA 1UA1A 2HHXA 4H4OA 2XWYA 3UIQA 1J5OA 4GVMA 4AHRA 3L2WA 5KFWA 5KT4A 3OSNA 4ZP8A 3NF8A 3OSPA 3UQSA 1RDBA 4FLUA 4KSEB 3IGNA 2BQUA 5FRNA 1GOCA 3NAHA 4CJSA 4FK0A
chains in the Genus database with same CATH superfamily
1VK3A 4OLBA 2MHNA 5LXYA 2VPYB 3NRBA 2ASMA 2B4OA 2FJVA 3OL9A 2KFYA 3OVNA 1RHMB 2V68A 4Z7CA 5AXLA 2DPJA 1VQNS 2V8DA 3IMQJ 3UFCX 3RAXA 1NSPA 2E9TA 2CQ3A 3TVKA 3ISND 1KDNA 2WUSA 2XHWA 2RQKA 2WBMA 3SCJE 1KD1O 3CPWM 4KB1A 2WCXA 3SMSA 3E01A 2RNEA 3FLCO 4A62A 4NXNK 4DPYA 4AUKA 3D7EO 1J6ZA 4DZ6A 3JAMU 2HHPA 4X66J 4KHQA 1OWXA 4U7UK 5IC4B 4AL7A 2DO4A 2XSFA 1HBNA 4X4RA 2H4YB 2O1PA 1UW4A 2U2FA 1LEOA 5LOQA 1OH8A 4Z37A 1MROB 3QIOA 4WE1A 1HYVA 4J9NA 3CMEN 4LF2A 4BE2A 2QEXN 2POKA 4LRAA 3HX9A 4B8CA 1SC1B 2AGQA 2HYIB 4ITSA 4Q43A 4Q0BB 4QWCA 4FF2A 4WZMA 4BRKA 3KUEA 3B4DA 1ZTWA 4K4WA 2E4LA 2IYIA 5GAHP 1LWCB 4JNEA 1OSCA 3M9OB 3AA8A 2ZNZA 1Q9YA 2ATLA 3ID8A 3E66A 2Z4PA 5BJRA 1X0PA 2K3KA 2YHBA 4LQ3A 5KFPA 3OLAA 2GJ2A 3A3OB 1SH2A 2K1RA 2ERRA 1B0PA 4F2RA 2RDJA 3IAS9 1M1HA 1UTAA 1T9WA 4K5RA 2P9KA 3AFGA 5AQSA 2FJXA 4CEBA 3S8SA 1NM2A 2P6SA 5K14B 5L1JA 4AHVA 5KFRA 5EWEA 2YNFA 3DCAA 1GXLA 4W5NA 4DR7K 3R6MA 3HD2A 1S48A 4IO9L 4OKJA 4DX5A 2YHXA 3ZTOA 3UE2A 4WFNL 3VETA 1S9FA 4FW1A 4OVLA 3AJ2A 2D0CA 4M8LA 2DD8S 4K8RA 3WEEB 3DC2A 4XEIA 3OLBA 2HSTA 4PYDA 2KYXA 1I6JA 3TQEA 1YAGA 1GLCG 2ZE2A 3DRPB 2XNQA 5CR4A 1BQMB 4C1NI 2F4FA 1NHUA 1RWMB 4CH1A 3H42A 2BE2B 5D4PA 2GVDA 1RWWB 2FJWA 3AVAA 2DGQA 3VQ9A 1RU1A 4CI0B 3CI5A 1E6YA 1KLMA 2YKAA 4JS5A 2E5JA 2FJEB 4O5FA 1R8PA 2O8BA 4FS1A 4WFNQ 2QL7B 4JI5F 4FM1A 1WF0A 4DCJB 2CJ9A 2G9OA 3QPIA 1YJTA 2BTFA 2G1DA 3ULEB 2R2UA 3TJ9A 1XMBA 1LW0A 4JV1A 4FNIA 4IDKA 4WP8A 1QUPA 3OJSA 2VD3A 2PI4A 2FLOA 5IM0B 4OGCA 2P9UB 4JI7F 4FP9A 3NP5A 2HBLA 2APOA 2ZBPA 4PG4A 3LP2A 1VR6A 3BV8A 1M5OC 2F63A 3H2UB 4E1NA 2IRUA 1KSPA 3H0PA 6FD1A 1D8ZA 3MX2A 3WQTA 3ULHA 1Q5VA 4I9QA 4WZQA 2ZWOA 4K5SA 2OI2A 5HVGA 3D6FB 2G8VA 5JS2A 3NOCA 1Q86T 5ETRA 1FKPB 1NKEA 1F9EB 2CNNB 3V9ZA 2MY8A 5T14A 3FZHA 3K5LA 1HHTP 3PYGA 2OELA 1NCLA 4TNOA 1KQFB 4ECSA 4OLPA 4K50A 4PQUB 3PR5B 2G0CA 2PMZD 2AJ2A 4LD0A 1RISA 3OHRA 4RNNA 4MO5A 4L73A 2MXYA 2D0BA 1SI9A 3E01B 2OLWA 2E1RA 1T3NA 1NZ8A 4YDUA 4DFJA 4MQ3A 3QO9A 3MD1A 4M42A 2N4DA 1B9FA 5A76A 4PWUA 4A2AA 3Q22A 1HBNB 1LFPA 4IR1A 4CH7A 5D0EA 1VSJA 3W5ZA 2I2YA 3LH2S 4JI8F 1VQ5S 4WQ4C 2ROPA 4CEOA 3DRRA 2JHEA 2P1JA 3H4BA 4NWBA 1O5JA 5CABA 5F8MA 4XO0A 3C6UB 1VQ6S 2D74B 2F1FA 1YHQN 1BHNA 2HGLA 4QS9A 2KDOA 2D69A 1VRUA 2PD1A 3G8QA 2E7WA 3KD1E 3H1QA 1LK7A 4MH8A 5KFKA 2QFJA 3IWXA 4JOUA 3PUFA 4YOUA 1HD0A 1HR0J 4KKOA 4FN5A 2EFPA 4M5JA 1TFWA 2M9KA 4KHPF 4PXEA 2ETJA 3LDPA 3HK2A 1RYRA 2KT2A 1UKUA 4KC5A 5GINA 3CJAA 5KT6A 4LVOP 1Y3KA 4X4UA 2GBZA 3WNEA 3H46O 5IS2A 3UKRA 3AGRA 5L9NA 3VEYA 3DXSX 3EN9A 4KGZB 4L3QA 2DISA 3CCLN 4AT1B 2KVIA 3E9PA 4JI4F 2H9ZA 3PTWA 4GRSA 2M8HA 3BS9A 3O3HA 3HP9A 2O8EB 4LY7A 2A1BA 3WXKA 1TUUA 3BDEA 1OQ3A 4K4XA 4HL9A 3QYYA 3LPUA 4X84A 3JTPA 3M2RB 3W8PA 4F2SA 1FJGJ 2GVDB 5AE1A 3QFUA 1WC3A 4R5PA 5AQKA 2HWTA 4JN4A 5CZXA 3G2XA 2DHAA 4DTJA 5KG6A 1NB7A 3VQ8A 4M41A 2C2RA 3V6JA 3MPDA 5FLXY 5F9NA 4LRCA 1RHQB 2XMVA 3PX6A 2R7WA 1K1SA 1RP5A 3BH7B 3DLKA 4FLWA 2KRRA 1MA9B 4K8XA 3HFKA 2KM8B 3PYDA 4KIAA 4F3TA 2DHHA 1T9XA 4H4MA 2A3JA 4ECRA 4PXCA 4YOVA 2E7XA 2LECA 2XHBA 1HWJA 2F9WA 2F4VJ 4OI3A 2C28A 1SJ1A 2B7BB 1Q8LA 1WUAA 5GIPA 1WLJA 3AVLA 1H0HB 2R3VA 5C2CA 2Z2YB 4PG5A 4HHHA 5KFLA 1TUWA 1LOUA 1JLQB 4K0KJ 2UVWA 3HOTA 2XZWA 4E98A 1XMOJ 2Q0RA 1HR0K 2CPHA 3T9ZA 5AZJA 5KFQA 5DETA 1RUSA 3D67A 3D7SB 2BACA 3THTA 3E9LA 2NYHA 1U1PA 3BP8A 2HVIA 5E26A 3MTJA 3MXMA 2A6OA 4N47A 1VSEA 2YXLA 4J9OA 4O3QA 1U6FA 2BX6A 2X78A 2MKYA 4CFCA 1IXKA 3OYHA 4E7LA 1FKAF 2E1ZA 3NKYA 1NRKA 3V9XA 4Y1CA 4WYWA 1HBMA 3D6RA 4JI3F 3WNHA 3CJKB 4W5QA 1WORA 1YITN 3QB0A 1ICEB 4NZ7A 4OZ2A 3U9ZA 1HQEA 3FUYA 4HI2A 2QKBA 3KG4A 4OI6A 1VFJA 2N7CA 4J8FA 3I96A 3PCOB 1K8KB 3OY9A 1TKDA 1JLEB 3GTYX 2AJ4A 1B4SA 2D3UA 2VZ9A 2R7OA 7FD1A 2V2VA 1DHMA 3OL8A 4QOZB 3MOJB 3NGIA 1OY9A 1Y9OA 4CT9A 1FJGK 4K4SA 4TU9A 4IJNA 1C1CA 2DPNA 2NSCA 1QZ6A 2P9PA 4ES3A 5JMVA 3QICA 4QIEA 5KTQA 4LF5F 1EKEA 1ASUA 2AMCB 5E0OA 5HROA 1SUQB 4B3MK 3W66A 1VC6A 1SJQA 2ATQA 3SJHA 2QA4G 5A2QO 3LP0A 1EX4A 3GILA 1BGXT 1VQ9N 1VBZA 4HDGA 1TL7B 3FEXB 1U1LA 2HVHA 1D8YA 3UKRB 2ZBRA 2YX4A 5E3RA 4LFCK 3BBCA 5IC6B 4UY85 1U1MA 2IAJB 3ZZRA 1WNSA 4UY8O 4HEA9 5AQMA 4Z4FA 2ZC3A 2F4VK 3TPQA 5HO4A 1X60A 4WCEL 5AJ3F 2EFVA 2V50A 3Q83A 2FHJA 4C0HA 4K0KK 1T6DA 5D0RA 2B9EA 1RBSA 2YV0X 3GIJA 2PSZA 3UD3P 5HRRA 3OVSA 3K5PA 2V6AA 4OYOA 1RKIA 2XEXA 2GMJA 4MKYA 3OYFA 3UVJA 2YH0A 3HSCA 4DV1J 1CQNA 2KJVA 3DHXA 1BLUA 2WC9A 2ZM6J 2GO9A 2CADA 2FYXA 3H2LA 4JYAF 3AVNA 4R5PB 2GX8A 2IJNA 5JLHA 1N32J 4L3NA 1FA0A 2VG5B 2HF4A 4WCEQ 1RABB 3CC4S 5L46A 3QWUA 1IWGA 2CGLA 3O4WA 3BUZB 1NH7A 5GAGU 1U26A 1LXNA 4BRAA 5CCLA 1WAJA 2YWEA 3VQBA 2AZ1A 2G2OA 1PYOB 3IBWA 1RLCL 2OYQA 3M05A 3MXJA 4KB0A 3BZCA 1JLBB 4M7YA 4HDHA 4BDZA 3I6PA 4KGXB 4NYOA 3DM2B 4ZHRA 3BB5A 4RO0A 2YY3A 4ISGA 2F7VA 2Q66A 4ATNA 2VG7A 1M1KO 2AWZA 4I6MA 3W2WA 2KFNA 2HHVA 2Z2LA 3FGVA 2XG8A 2JEIA 3GFHA 1SJFA 2ASPA 1W26A 4F9OA 4U7UD 5F0WA 5AZJB 1HUXA 1JL1A 3NAIA 3TVZA 3PIOL 4LSNA 1CZ9A 2FTRA 2M0GB 4XIUA 3A8YA 4NPOA 5EX5A 2CQ2A 4DI6A 2EEYA 2QLBB 3M6XA 3LP3A 4AM7A 3TI0A 1VDHA 2HAFA 4K7QA 5EWGA 5C15A 5KFYA 4ECWA 4PRFA 1YJNN 1NOYA 1FO1A 2YKPA 2Z1IA 2YX7A 5H1SV 2B8QA 2VYPA 4CHOA 3ENBA 3QBCA 4EBEA 1VSDA 1GMWA 4DX7A 1YDLA 4Y65A 3PIOQ 2VWKA 1QLNA 3MN6A 2CQBA 2W1BA 4K59A 2HBJA 5DZ7A 2DIVA 3EL2A 1P8ZA 4FM0A 1YLXA 2DRBA 2FJBB 2RE1A 4P2MA 1ZZFA 2OZMA 3I87A 2DRDA 2J9DA 4DV1K 4C8ZA 1QQCA 1C0UB 5LJVA 2ZM6K 3MM7A 3TR8A 1ITPA 2AJQA 2OEJA 4X65K 3JSRA 2BYCA 2P9PB 3HO1A 5M1PA 4RW6B 4E2FB 5B0GA 5JJBA 4IDHA 2QM1A 5KPZA 4PKGA 5CYQB 1T02A 4YN3B 2KJWA 3Q8VA 2V8VA 3QZ8A 1RT1B 3B6BA 2K8GA 2HMPA 2KL8A 3V1RA 2NRTA 5LMNF 4JEPA 4LFBF 4CRJA 5BR8F 2P9SA 1QE1B 4A8QA 3MEEA 1M5PC 1ZBSA 4J2BA 2RDIA 4L6V3 3SQ1A 3TNVA 1LWXA 3H2VE 1YTUA 1EZZB 1A6LA 4FPIA 3EVOA 3ZSOA 3O44A 1F3VA 1YJWN 4YR3A 3I0SA 2HMIB 3FZMA 1Y3JA 4DN9A 3AXKA 2W8KA 2BH1A 1N6QB 1ACMB 1OIAA 2IIHA 4ZVQB 3DLRA 2R4FA 1CBKA 3O8WA 4JS4A 3IM8A 4GY2B 4LFAF 1KQSR 1X4HA 5HLFA 1S9GA 2UUCF 1NG9A 4KQZA 4C8LA 4ERDA 1F5BA 4LSLA 2DHXA 1V3ZA 1UVMA 2RIJA 1ZBTA 3CCZA 2I9SA 4CEAA 3LPYA 3GE1A 5LJ5Y 4LF4J 1QAJA 2OPPA 4WFAL 1GOBA 5J2QB 4O44A 2X1BA 4EYIB 4A59A 4CLUA 2OIHA 4NEYA 3M3ZA 3CGIA 3CETA 1JB0C 2R7TA 3H5YA 2V94A 4OJ1A 5HVHA 3HMJG 2I7NA 4JRQA 2PA3A 3ZZYA 4DL6A 3EXYA 2BJ8A 2W25A 3SAGA 3QNOA 5MLCQ 3TABA 2WSEC 4HHUA 4NXMJ 4ZLLA 3VGUA 2MJNA 4QR1A 3PJXA 3TJ8A 1UMJA 3OYLA 1IBLJ 4WFAQ 1YGYA 2HPUA 5CE3A 2AEFA 4DPXA 4EBCA 2ABYA 2BJ1A 5C2DA 3DLEB 2PC6A 5A8KA 1MWYA 5CYJA 4I6MB 2FJDB 2OEKA 4IR9A 1BXNA 4DR4K 3QFPA 1M1GA 1XMQJ 3RZAA 3M8QA 1RHKB 4P74A 1WOOA 3BGLA 4YB6A 2QWNA 3TAQA 1OYDA 3TAMA 3MMVA 1URNA 1KNZA 2W01A 3RB0A 2HFSA 3HPHA 4DHVA 1NGAA 1M5KC 3EY1A 4JAXA 3VQ5A 1TL1A 3SUQA 4E1JA 5KFZA 3A5NC 3M30B 1U0HA 1LQ9A 2NNWA 5IT9U 1BL3A 2QKKA 2R7RA 3O5TB 2NRHA 3AQOA 3H40A 1LV5A 2K7KA 1DY3A 4DU7A 1RT5A 4JI2J 3S3MA 2CPXA 4CYUA 1X4FA 3MR5A 3MWTA 1YIJS 3O4QA 1BWFO 1XWLA 2YHAA 1PCAA 3JS6A 2DGWA 1SAZA 5HMXA 4PA1A 3NAEA 2RU3A 3WC0A 4HTLA 4BC2A 2GJIA 2E2QA 3IR7B 1S5ZA 2DH7A 2ZH7A 1S97A 3M1FA 2P9IA 5IWAF 2RKIB 2ZJRL 4LBHA 3C46A 1T95A 1S57A 2PDAA 3FQKA 3OPKA 5KT7A 3L9ZA 2FVRA 2AD9A 3CWJA 4OHWA 3RSEA 4DV7F 1ZAXA 4GV3A 2HRTA 1T9YA 5D4OA 1YJUA 1KWMA 3WC2A 3HSZA 1VQ4N 2CQ1A 4AH9A 2X74A 1SIWB 4FDFA 4USJC 2AP6A 4UY8T 5J2NA 5JVHL 4PHTX 1XNQJ 2JL9A 3MEEB 3O08A 1T03B 4A57A 3D2FA 3KHLA 3RGIA 3U9DA 4USTA 2NUHA 3K17A 2BJ7A 1CC7A 1EARA 1KKHA 3M6WA 5AQFA 2ZJRQ 2QI2A 3I0SB 4UF4A 4PZVA 1RT2B 3WNGA 3OFFA 1KTQA 1IBLK 3EZ5A 3DAWA 3PW2A 3MX5A 2ASOA 3G96A 4B9SA 4LT6A 3M1VA 1HJRA 1DQ8A 2XSJA 2XCAA 1K0VA 1ZC6A 4BQLA 2KHDA 5F3ZA 1S9GB 1SJ4P 1N33F 4ED1A 4KBIA 3KUGA 1XMQK 4OI2A 5JVHQ 1Q7YO 4IH6A 2MLYA 3ZYYX 2GHWA 2WRMA 4DQPA 2OPSB 2FB0A 3OTOF 1NMDA 4BC9A 4NLDA 5H9EJ 1KLNA 4M94A 1S76D 2I5JB 2NRRA 1I1GA 3PHTA 1RT7A 3HM8A 4O44B 3LO3A 4Y2MA 2JEGA 1U09A 1S99A 3EZOA 2Y3YA 4KGVB 1ILYA 1MWMA 2EXUA 4USIA 2DGVA 2OD4A 3MMCA 4BRNA 5CHCB 1A5VA 4RX6A 4ED7A 5ETVA 1X9MA 2HZCA 3TZYA 2F40A 4ZPWR 4JI2K 4DQIA 1NOZA 5FPDA 1FVSA 1JQGA 4OYZA 1K1QA 3GV5B 4Y2AA 2COLA 3BQ0A 2ASLA 2BKPA 1N34J 4OX6A 5DG8A 4JI6J 1J5EK 1X4DA 4QJVA 3MFIA 4G9ZA 2ALYB 3GYNA 1HBUA 4OHZA 2NQPA 3ENAA 4DSEA 2IS3A 1MDUB 2R8IA 1D9FA 3LOUA 4GKJF 4ECYA 1FFSB 2LP4A 4NLYA 2BJDA 3NHGA 4WIIA 2BJ9A 2YWFA 4QW9A 1D5AA 1VRQC 4X4PA 3DOLA 4H0TB 4USHA 3I5AA 4LH5A 4H0PA 3KLFA 4RNHA 2NREA 3UO0A 4DV3F 2ROGA 3VCDA 4V19S 3R97A 2AV5A 1WTBA 4CF1A 2WTFA 4ED6A 1FXLA 2C3YA 4GV6A 2JDJA 1HJOA 1YXQA 3D0HE 3VTIA 4FPBA 2XO6A 1WSRA 1XNQK 3ITHA 3TSUA 1R0CB 1O13A 4DUYK 2OP5A 1HMVB 2XB2D 3CC2N 3ZSRA 4DTRA 3R6LB 4M5MA 1L5UA 3T19A 4XAKA 3VV2B 3ZTQA 3KXDA 5K8MA 1FRJA 2MLZA 2NRXA 3A5OC 1B7YB 1FRLA 5G4DA 4O3SA 4LF7F 1X5PA 2OH2A 2D3O1 1UZDA 2A41A 3HVTA 4IYQA 2R2TA 2B9YA 1ZAWA 3IS9A 3H5UA 2QIFA 1H73A 1OS5A 1GX5A 4NMXA 1AT1B 3PO5A 3HHKA 3M2VB 2BANA 3DOKA 4UQTA 4HKQA 4TLQA 4DV0J 4ZPTR 2QE5A 3LM2A 1ZS6A 5H9EK 4EWTA 4B9VA 1Y5IB 1JJ4A 3PLAA 5BRDA 3QBWA 2EFQA 2MQNA 3WHIA 1OH7A 3OQ2A 2QWOA 3TUIC 4LF9K 4JI1F 2FY1A 3HF5A 3M2UA 2CG8A 2MZTA 4FKYA 3TWZA 3AY0A 4CLPA 3D2EA 2DCUB 4XH1A 3TP2A 1A5XA 1CJTB 4AFFA 2W42A 2UUBF 2MQPA 4C3MA 4OLAA 3K8WA 4LIRA 5HRPA 1VSIA 4BR4A 3A5LC 5BYQA 1C1BA 1OO0B 2V63A 4Y00A 1N34K 3T1HK 2J6UA 2HGMA 2RS8A 4JI6K 2IBOA 5E3QA 5LXRA 5F41A 2IMWP 1APSA 4AQYJ 1HW9A 2GIQA 2LKZA 4M3ZA 3GSDA 3HPGA 1VQSA 3JQJA 1G2EA 4RWXA 1H2VZ 3T7ZA 3HM9A 4M5DA 2RRAA 3IP0A 1IKVA 3BZKA 4JUZA 4USUA 4NI2A 4IQXA 1ZZNA 2IM0A 2ZC4A 3VGMA 2JC0A 1CULB 3ALYA 5LMUF 3QIPA 3HZ6A 5F9LA 3DMJA 1VQ7S 4FVCA 3ZTRA 4DR5J 4PL7A 4XPEA 4DLEA 2IDOA 2HGNA 1U47A 4ELVA 1U2VB 1KCFA 4YORA 2WONA 4WP9A 4I6WA 4JRPA 2O66A 1VCTA 3A8EA 1RT3A 5KG2A 4KB7A 1TYQB 4CHNA 3ADAC 3JXOA 1CLQA 2UXCJ 2H65B 2ZNYA 3IXQA 2G8IA 1DGKN 3DWLA 1S10A 5I3PA 4E3SA 1RCOB 1S7IA 3L7OA 3AVCA 1HQUA 2PMWA 5C2FA 3RJMB 1EP4B 3P4UB 4OHXA 4DV0K 5KQDA 4P9SA 2VPWB 4M3UA 3THWA 2UV8G 3I8BA 3EKUA 2QWQA 2PY5A 5B7WA 4DV6J 1RWXB 1XNRF 1CZAN 5D3GA 4JKCA 3HHLB 1W2BR 2J7WA 5KG3A 1EETA 3R1HA 2ZHBA 3OUYA 3EUNA 5AFUA 5M1FA 1S6QB 3AA2A 3CT9A 2RQMA 2GMHA 4QWDA 3AD8C 3SLCA 2HBQB 3KHHA 4KTQA 2YNGB 1RDWX 2NLXA 1R0AB 4DL5A 5D77A 1RWOB 3QDKA 1R0BG 2Y0BB 2IM3A 5HSPA 1OVQA 1V4TA 1S1UB 2DGSA 4LH4A 4WQ4A 1CJVB 4ZITA 3PKMA 3QEWA 3C6TB 3B6PA 4AD6A 1KAYA 4DR7F 3PDNA 3UNGC 2J8SA 4AQYK 4QQBA 1FX2A 4IOAL 1QUVA 1WF2A 1N5VA 1TAUA 3DHWC 3AVGA 3IS9B 2UXDJ 1UVJA 5F1XA 1UWBB 3OA9A 4A8OA 4ZLPA 2DCLA 5BREA 4K25A 3ZT3A 2ZH6A 1M90O 1XTZA 4W4MA 3J7YU 5KAKA 1X7VA 1VI7A 2DFEA 4HT5A 3ZNJ1 1PSDA 4Z4GA 1WC4A 1SJRA 1KC8O 2LA6A 4JHDA 2CQPA 5C42A 1BD6A 4DR5K 4LREA 3MM9A 4OMFG 3CD6N 1QZ5A 3UB5A 1DKGD 2BGGA 1VHFA 3R5GA 3NNAA 2HG4A 1NWKA 3QJLA 4IOAQ 3D2EB 1UVNA 2CNOB 4LBIA 3PR4A 5HAOA 4CLFA 3BO4A 1XC3A 2B4VA 4NLPA 3CCEN 1IBMJ 1TL3A 4ECTA 5C10A 3ZSVA 3SIPB 4D3HA 2RILA 4I56A 1V4SA 2UXCK 2V8HA 4LR7A 4K4ZA 4FJNA 2R8GA 3H45C 1SBRA 3GONA 3CJ7A 4JKGB 3H25A 2GELA 1REGX 2EWSA 4K42A 2Y1LB 2XWYA 3A8IA 4GVMA 4BC5A 2M52A 5KFWA 1Q7YT 2Q6BA 1HNWF 2ATCB 2MLXA 3OSPA 3CCSS 1JCFA 2BQUA 5FRNA 1RWVB 2ZH4A 3NAHA 3AODA 4BG8A 3H8YA 3DYAB 3MWBA 4GKKJ 1C1AA 1AXQA 3TEGA 1NJWA 3VQDA 1HX1A 4O8KA 1IKVB 1OKJA 1KVAA 5C5JA 1B7FA 4RBUA 4ZVOB 1NLKL 5DMRA 3CJ8A 2LEBA 1EX8A 2MZJA 2GHVC 1EAYC 1SZ2A 4JKBA 2ACMA 2GTDA 3I56S 3HJVA 3G82B 5BXIA 4JK7A 4QPXA 3BYRA 5GAGI 4CO1A 1GMUA 3MN5A 3ASMA 2V2QA 1NDCA 4U7CA 4PPZA 3J81O 1R43A 4H8KA 1PBAA 3EDQB 3L09A 5GADU 2GV9A 1VQPN 3OTDA 1WOQA 1IV0A 5HQMA 2UXDK 2QSFA 3UKUA 2X1GA 4F3OA 4CERA 1KAXA 2V69A 1HQUB 1S12A 5LL6Z 3K8VA 4CLTA 3NXZA 1EWQA 1Y00A 3LP1A 5KQ8A 2CPDA 3THWB 2QFIA 2GW8A 5KT3A 3BQ2A 3RBZA 2QO3A 1YTYA 5EN1A 4RWWA 1FEEA 2JLGA 2V4JA 4J91A 4QIVA 2CQIA 5IT0A 2QLJB 5KPRA 4YNQA 1K9MT 3TYTA 2OSQA 3AAPA 3AJDA 4FJMA 4DL3A 3UWTA 2VGMA 4IOXA 1IBMK 2CJBA 2JLFA 3LGMA 2W41A 2XYGB 4H5VA 4USMA 4EP4A 3VR1A 2YBVA 3W3DA 3H59A 4DBQA 4JKEA 4BRIA 1TK0A 3SXLA 1PYTA 4DCPB 2H4WB 2ZDPA 4ZPDA 1URRA 3DU5A 2ZH2A 3RR8A 2ZH3A 1RAOA 5EX0A 3GOIA 1WG5A 4YQWA 3CFOA 3R5BA 4N41A 2MGZA 1NK5A 3FBEA 1N52B 3R1LA 3Q8UA 3MEGA 3P49B 4CVNE 2IM2A 1YRTA 2CPYA 1FJCA 2HNDB 1WBDA 2R7YA 4GKKK 3KWMA 2QGFB 4FM2A 1LWFA 1XQIA 3KLEB 3W5YA 4ZLNA 5IV4A 2LEPA 4CW7B 2DRAA 4F0HA 1NNDA 2XMMA 4DSLA 3G6EN 4YY3J 2VFTA 1N48A 1M5SA 1X9WA 1KBRA 1ZPVA 3GJQB 4RNFA 3RR7A 1N56A 4ZS6A 4N76A 3MM9B 4TY9A 2VOPA 4BE1A 3SQ0A 4LF1A 3H6EA 3ZTSA 5ADXA 4IOBA 1BA0A 4L3KA 1RTIB 3GG4A 2VQEJ 4ZJQA 2N7YA 2DGXA 1X4CA 5HMZA 1SV5A 2MKIA 3JS9A 4C8MA 2P9LA 3CE8A 3WX4A 1IBCB 4NRUA 3TJAA 4H0OA 2RVJA 4JV5K 1W7WA 1VQMS 2ADBA 5L8RC 3V6HA 2HBZB 1UW9A 3TR5A 4DV5J 5A2QY 3UE5A 5CA5A 1FKOA 3NGRA 3DXMA 4JD2B 5DQIA 4ZVFA 1CJKA 1XR7A 5KRTA 1R59O 4EO8A 1WBBA 3A13A 2W7PA 2J9EA 1IG9A 1VK8A 1X4AA 3F0NA 3S1TA 1HL6A 3DKDA 4FK2A 3ZETB 2JC1A 3OT9A 2Y8YA 2HHHF 2UU9J 3BPSP 2D9OA 1FTRA 2MZQA 5E7OB 3CQ8A 3QZ7A 4CDIA 2HQDA 2VC0A 4AHSA 2IA6A 1X9JA 2IDEA 2GMLA 2QXFA 2QL5B 2CDRB 3T1YJ 5AE2A 1C0TA 2YI1A 4OZLA 4DTNA 2OKQA 4G1QB 4NLQA 3MMJA 3PYEA 2A6MA 4DTUA 4ZDNA 4TN2A 6FDRA 4DU1A 2YKOA 1QTMA 3U3YA 2DNYA 5TKYA 4CBXA 3SUNA 3OS0A 1Y7PA 2E1CA 2WHOA 1Y0HA 2NZTA 3NWGA 5CD4A 4HR2A 2W6KA 3RAMA 2MQOA 1SH3A 1JLCA 1HPZB 3V6DA 4CH0S 3KDNA 3MPVA 4OHYA 1NK7A 1S3XA 5DLFA 5HVFA 4IWVA 3LP1B 4CFBA 3HJFA 4IG3A 1NK9A 4A48A 3LWLA 3UR3C 2KG1A 2AGPA 4ISFA 4M5LA 3OYAA 3CMAN 1PBUA 3KHYA 1EQMA 5L39A 4IEIA 5FLXO 5FRMA 3CCQS 2Z1HA 1PG5B 2R7VA 1FF2A 2KKZA 3C6HA 1R8CA 1SC6A 1H1VA 4A47A 3MWPA 3U3GA 2ROEA 4H0XB 1GTHA 3PY8A 5ETMA 2P9CA 1E6VA 3WT0A 2VQEK 3GU0A 1QJHA 2XMWA 4DU8A 5BN9A 3H1VX 3D0PA 4DG1A 3ZLJA 4B3MF 1K73O 4PG8A 2ZZMA 2G2ZA 1S5JA 4DV5K 2C2NA 1UPPA 4YB5A 3IKMA 2C2DA 2PI5A 3EWGA 3DGVA 1U4BA 3M32B 4PY5A 3SSQA 1S72S 1FK9A 2N4CA 4OIXA 3C14B 4QU6A 4LFCF 2D4WA 1QSYA 5IZHA 3TUJC 3CTRA 5IQ6A 3QEXA 1SC3B 1RZMA 4A8XA 3NL0A 3VALA 2AA4A 2BKNA 4BG9A 4DX6A 3KJVA 1W7AA 1LWFB 4MKAA 2IFXA 3T1YK 1YI2N 3MM6B 2K06A 3HSDA 3TEHB 4P52A 3IG1A 2YNHB 2BM1A 3TX8A 4RW9A 1W2IA 2J6SA 1WSFA 2MQMA 5AFUH 1ATRA 2FBXA 4EMDA 5A8RA 1QAXA 3M6UA 3MCNA 4A8YA 2VA2A 4B3OA 3HSJA 4UQGA 3NDKA 3M8PB 2IVYA 3G25A 2Y9HA 2FLNA 3BSAA 4EO6A 2QWRA 2FUG9 4AHTA 2E5GA 2NR0A 4Q45A 4M3TA 4IO1A 1SL1A 2P9NA 1GXUA 1FKOB 1HI1A 1KVKA 5KG1A 2W2NP 4WTOB 3PJ9A 3NBPA 4DV2F 1SKWA 3OVAA 3FEYB 3DFEA 3CD7A 4IBNA 4C8NA 2HLTA 1S4EA 3K0JA 2XMAA 4FYDA 2HHQA 1DFDA 3UDEA 2XC9A 1BISA 1F3FA 1F1BB 4IFVB 2HRYA 3LANA 4FOEA 4OYXA 2NYIA 3IAM9 1OH5A 3EGZA 4BBYA 4FJIA 5J2PA 4B9TA 2C3MA 4PWDA 3NY0A 3LF0A 4ID5A 1VQNN 1XR5A 2D0OA 1RBAA 1G15A 3RMAA 2CUYA 1HNZJ 1UFKA 3S3NA 5JUMA 1FT8A 3UDLA 5J1PA 3D28A 1EQYA 3FEZA 3I32A 2M3DA 1S0NA 3M8WA 2MHEA 3TU5A 1NDKA 2O8DB 3AJ1A 3O6WA 1TKXA 4UTGA 3PIPL 5K9FA 1LFWA 3U1NA 2EFGA 3I33A 4YOWA 2JH3A 2YVSA 3C7NA 1S1XB 1BQNB 4CTAB 2KVQE 3F56A 3CDUA 1WN7A 1SPBP 4P75A 1T11A 3WXLA 3B54A 2OJ3A 3KK3A 1OJ4A 3WZ0A 3AA4A 3ELHA 1EO1A 2JVOA 5EDWA 3CD6S 1IM6A 5DG7A 1NGGA 4ILHA 2RN2A 2CJKA 4IG3B 4ED5A 3KWIA 2Z1JA 3SQGB 2ITGA 3THXA 4E7KA 4HTIA 3IA0A 3TANA 1QVFM 1BG3A 4JKDA 4NB4A 3PIPQ 4CJPA 4DLGA 4KFBB 3LTOA 3GB0A 4X65F 4FYXB 3GBTA 2NZ4A 2J76E 2HEKA 5LSRA 2JJ4D 2H5EA 8ATCB 3VQ7A 1IKWB 3OR1B 3QQCD 1JJ2R 2PO4A 3C6AA 1S6OA 2XZTB 3KLHB 3HBTA 4RW7B 2IDLA 3Q89A 2VFSA 3SI6A 4C11B 1HNIA 1MU2B 4WP3A 3MCSA 1BOTO 3MR2A 3OS2A 1HWIA 1J53A 2XMUA 3VAJA 4CZKA 4J7CA 3W62A 4XH5A 4RW8A 3DLGB 1X4GA 4M1KA 3FGUA 4X64J 4I7FA 4B1UB 5AQRA 2DNQA 2R42A 4PCQA 2DPIA 4DR2J 2UVUA 1LAWA 2M88A 1N36K 4P2SA 3UR0A 4A46A 1Q16B 2VUGA 3AAWB 4A8WA 1IBKF 4TSXA 2DTJA 1TUVA 3O9RA 3SCXA 4NLBA 1AROP 1RGVA 5K8OA 5FD1A 1KONA 3K59A 4B9QA 5A8WB 1LOTB 2PN6A 1RA6A 1U8WA 1XR6A 2OZSA 1S79A 3IG1B 3F41A 3AAQA 4RW9B 1NGJA 1R8BA 5HMYA 1KVBA 1VQPS 1ASWA 1S6PB 2ZUAA 4V1Ak 2CZVC 5A8RB 1X4EA 4B3OB 4DU3A 3N01A 2Q1LA 4ZPCA 1TK5A 2HW3A 2GX9A 2YJEA 2W9BA 4CEQA 5KG5A 2PIIA 2D9PA 4C48A 4GVLA 5B0CA 2LXIA 2P9NB 2E1PA 2FVSA 3MURP 4WKRA 5C0YA 4R8UA 3NH0A 5I3QA 3ATUA 2O3DA 4DSFA 2LQ9A 2HIQA 3S41A 2CWKA 2MKSA 4F26A 1NGDA 4DQQA 5AT1B 5BYSA 3CQXA 1DBDA 3JAMO 4BC4A 2ASJA 4HCBA 1W0HA 4Y3CA 1BU6O 2M5YA 4IEEA 3CG7A 3GG1A 2MJUA 2QTDA 3VAGA 5J2PB 3ZSYA 2LFVA 5KFNA 4DR4F 2A40A 3MAAA 1GLAG 4ID5B 3NF9A 3RAQA 5KFCA 1ZM2A 1VSLA 4ICLB 1RT6B 5H9FJ 4BE0A 5IQQA 3FK4A 1U6ZA 3IFEA 2IVNA 2GVZA 5ADXH 2DXDA 4QOTA 2GIRA 3W2VB 1HNVA 3R5CA 3R2DJ 1QVGM 2AJFE 4TYBA 3HPOA 1D9DA 3GR0A 3QGIA 1DTQA 1JLFB 4EUVA 5HANA 1QM9A 4X64K 4CZIA 1CC8A 4DR2K 5AQWA 1L3VA 2CIMA 3J8AA 1U2CA 3O1BA 5BR9A 3KK3B 3IC1A 3SBMA 3DI6A 3M8SA 2CPFA 4Q44A 2QLWA 4CF2A 2MQ8A 5D0GA 1VQ5N 2V7YA 3ILIA 1N0VC 1J2VA 1VQ6N 3VAHA 4CQ1A 1R7IA 1VBXA 2B6AB 1L3UA 1NJYA 1K73T 1KS2A 1PAUB 1HFEL 1GXTA 3KIOA 2HHSA 1UJ5A 3QSIA 1WC5A 1BIUA 1RAIB 3TTCA 2AGOA 3OBWA 5THWA 2ZD1B 1RT4A 5T41A 3BQ1A 2RF2A 3DXBA 1TU0B 4BR7A 4EP5A 3LUYA 2KHOA 5KOWA 1QSLA 1XUPO 2FGOA 3G6VA 4U95A 2CQHA 3C16B 4NLTA 2O4GA 4JI5J 5FPMA 1UJ4A 1TGOA 2W24A 1VQKN 4I69A 4WFZA 3SAFA 3KK2A 4B1WB 4ZMMA 1UEKA 3M6VA 4BRHA 2C2ZB 4JI7J 4PKIA 3CCMS 2WAQD 4H5WA 2XBPA 2RUSA 3SDEB 1FRXA 3Q8PB 2VFRA 3Q24A 4NCAA 3J7YI 4ECQA 1S1TA 3JSMB 3CXCR 3L7UA 2XMKA 2HQ3A 1FNMA 1Q86O 2C1EB 1ZBHA 2HK2A 2HFVA 5H9FK 4USVA 4BRCA 3HYFA 3VVUA 3F44A 3ZSQA 4EI2A 1B99A 4NA1A 3JSYA 3T41A 2VWJA 3WXJA 2OHDA 2G8FA 1YBAA 2CA9A 3TQ1A 1FWKA 4YHHJ 2MKCA 4JI2F 4Z4HA 2P9GA 3CMAS 3HLUA 2UP1A 4CZEA 3T5KA 4I4BA 2LEAA 4CM2A 5AQYA 2VDIA 2VJVA 1N5YB 1VQLS 5G0RB 2QG9B 3KNAA 2QSWA 1R3NA 2J9CA 4FZVA 3UCUP 2RD5C 3HHDA 1RBTA 1J5EF 3NH2A 3N5FA 4E19A 1NK6A 1S0OA 2NZCA 3T5JA 5AQPA 3EGNA 1TVRB 1TP7A 4C7QA 2GWKA 4B02A 2DNMA 1NM1A 1JLAA 2CGJA 1W9HA 3P3DA 5F3TA 4CK3A 2O8FA 1P1TA 3OYIA 4FPRA 1YX2A 2JSXA 5HP1A 2GQQA 5B0AA 2JGUA 4BY9C 1TUGB 2VONA 2Z56B 1MW7A 2VG6A 2CNLB 6AT1B 4JK9A 3BH6B 2F8SA 4LVNP 4F4WA 3IRXB 3AVKA 3V9UA 4MK9A 1AUSL 4CO0A 4JKFA 2V52B 4GVBB 5ITHA 1T94A 4M7XA 1ZBLA 4GMJB 4JI5K 4KREA 4DUYF 1DTQB 3DDKA 4FNHA 2Z30B 3OYGA 1JKHA 3BN4A 1YI2S 5GAHU 1BWVA 1EKRA 4CNZA 2J0XA 3EDRB 2EBGA 4JI7K 3NWRA 2JFDA 2EX3A 1HRHA 3KFWX 1VRTA 4FXVA 3DI6B 1HNXF 1ZM9A 3L2RA 3I55S 5TKWA 5EVZA 2FF6A 1CQMA 4WXOA 3VA0A 2XS2A 2YPYA 1JL2A 4JI4J 4MFBA 2M70A 3W1YC 4KBOA 3BDPA 1S1VA 1QHTA 3CFPA 4MIAA 1ZM3A 2E6MA 4QW8A 1XK8A 2NUUG 4B3SJ 3TTFA 2LQJA 1H7WA 4O3NA 3GDQA 4E0DA 1OPIA 4LF9F 3IWNC 4JB8B 4DUZF 4FJJA 4CCHA 1NGCA 2A10A 4U9RA 2FC0A 4YHHK 2KXNB 2QWMA 3A0IX 3VQSA 4P73A 2WVCA 3RW7A 3DU6A 2P9EA 1U1KA 1AZSA 5I4MA 2V9WA 1SQFA 3AD9C 2E9ZA 1ZA1B 2H5JB 5AZIB 4PYAA 5SZTA 3T1HF 5KFFA 1I94K 3SSSA 4UZBA 3KK2B 3FDSA 4A4JA 1CLFA 2HNYA 2EBEA 3TAGA 1IUJA 4LC9B 1S22A 5M2RA 3OYDA 4RCHA 3HSTB 4P2FA 1BI4A 4NA3A 3SCKE 3GFXA 2HB5A 1C0FA 2WSCC 4C8OA 1CS4B 1FCAA 2QT7A 5C24B 3UN2A 5MLCV 3K0SA 3HT3A 3OXGA 2ZBQA 4KV8B 1RQ0A 4HUGA 1RWKB 4DB3A 2VPXB 1SC4B 3M4XA 1SL2A 2NSBA 3DOMB 1S7HA 4X4OA 4YOXA 4KO0B 3FMBA 4URQU 1Q5YA 1WWHA 2YHYA 2DR7A 1SVDA 2M2BA 3BYPA 4ZVUB 1RE1B 3A3NB 1DLOB 1WC1A 3RB4A 2YPZA 3KMQA 2QX0A 4DR3F 3CC4N 2FJAB 1WSJA 3FBCA 2Q97A 4I6AA 3VQTA 2H54B 4FBUA 1N5TA 3SYZA 1Z25A 1JLGB 2AYEA 1HYSB 2VCPA 4JI3J 4OI1A 5AQXA 1BCMA 5FPNA 4JI4K 4Z2XA 3U1MA 1FJ7A 5KFOA 4M3YA 4DV0F 5LT5A 1YF5L 3MMBA 4NRTA 3U6FA 1GNKA 4EZ6A 5L1KA 3LDLA 1VK0A 4XH4A 4FZYA 2KM8C 1WHYA 2XYPB 5FDLB 2JX2A 3CJBA 4B3SK 3VGLA 2G8KA 1EXQA 1X9SA 3SAHA 1SQEA 1G1XA 4IXCA 1PGZA 4WJBA 4CZLA 3O9UA 3TTDA 2NXNA 4CZFA 5EUHA 2GS8A 5B0EA 5EWFA 3PFEA 4ZCKA 1Q7LB 4Q8FA 2OPQA 4ZA1A 8AT1B 4YFUA 3OL7A 3C15B 4CLLA 4W5OA 4LF5J 4J9MA 1IWAA 2E29A 2OFGX 3VAKA 3DLBA 2Z57B 1GLFO 4HTJA 3VGTA 1TKZB 3WNFA 4IG0A 3POTA 3IR6B 4OKKA 4WBFA 3TAFA 3CJ9A 3DDNA 4CJTA 3W7BA 1TFYA 1C2PA 1FERA 3OW2R 3BGRA 3G9CA 3J81Y 4FLVA 2FC9A 1PILA 4JBCA 1Y64A 2GCFA 1BDGA 3H90A 2C2KB 3HSGA 2X3DA 1C0GA 3V5RA 3ZNUA 3OR2A 5AJ3J 4ZJLA 3MEDA 4M63C 4IOCL 1S1VB 1UEUA 4IO9Q 1WEXA 3MF5A 5A6WA 4BDYA 4Y2KA 4YDXA 2E1MC 2CGKA 3BO3A 3QJJA 4X66K 4H4OB 3L6QA 5IXUA 3NNCA 3BBBA 1J5OB 1N8RT 3K89A 1WOSA 5AR0A 4ZLJA 4RUCA 1SB6A 2EWHA 4JYAJ 2BEFA 2RU9A 2V4QA 4URSA 2ZHAA 1IR0A 2B51A 2PZSA 5KFUA 2JLEA 1JNRB 4CLZA 2XGPA 1I3OB 1AZSB 4IOCQ 3ET6A 2FLPA 2WOMA 1N0UA 2Z2MA 3FBBA 2E1YA 3OBYA 4RW4A 1TQLA 4L75A 4ZIWA 3U27A 4HLBA 1JXEA 1EQ0A 1DEJA 1YT3A 2BE9B 4ZPBA 2YWKA 1RTZA 2HNYB 3KLGA 3MAHA 3QEVA 4FW2A 2FVQA 5AQUA 2PFFB 1UJ6A 4FWPA 1JXVA 3IBCB 3FFIA 4LR8A 3FZFA 3VA3A 5MAOA 3VMFB 5DS7A 3OHBA 3FRZA 1WD6A 1HHQA 9ATCB 2V7ZA 5J1EA 5DJBA 2CDQA 3FFKB 2GIFA 2E5HA 3VQPA 4LF5K 4KRFA 1HKGA 1HD1A 3MECA 4Q5VA 3KYLA 2E9RX 3L7PA 3MDQA 3Q8SB 3NFAA 4ILMA 1UAWA 5FROA 1SKUB 3JTOA 4WE1B 4FO0A 4DTOA 4B3TJ 5I42A 3W0LA 4AF1A 4LQ9A 4F4KA 1AUDA 3EE8A 2I38A 4IFYA 3EJMA 3R6GB 2DNLA 4LIWA 2J4RA 5LL6d 3PW4A 2YKNA 2OPRA 1PJ7A 5M2UA 4WK1A 2FZCB 1PYSB 3AO4A 1SCJB 3D0IE 3N28A 1WDDA 4QBUA 5RUBA 3LL3A 3PJWA 1IQZA 3GIMA 5I3UA 2WB1D 4TKTA 3PO4A 4OZ1A 3WBZA 2CJYB 4Y2CA 2K1RB 2A3ZA 4OX9F 2E2OA 4XDDA 1NK0A 2MZ1A 4FLZA 3VQCA 3N0VA 3MR7A 4NLGA 4RBVA 3GIIA 3O1WA 2R7XA 2P9KB 1GOAA 2HNZA 5F8HA 4CO4A 1VQKS 3Q8RB 2XTJP 3VEXA 3C65A 2YNFB 1RDDA 2F8MA 1YKWA 1TELA 2X51A 1IBMF 4EU0A 4YR0A 3TARA 1WSIA 3POTB 4DSKA 1KFDA 3QESA 3AOCA 5LMNJ 4LFBJ 5BR8J 4DQSA 2Q3SA 3VWSA 3AV9A 3V81A 2D3ZA 3HT0A 5IFMA 5LJWA 1KP6A 5B09A 1MSWD 2W40A 2AJ1A 2FSNA 4G1IA 1FESA 2ZE2B 4Z4IA 3GYGA 4I2QA 4ILGB 1HI0P 3TWHA 3OL6A 1YIJN 2ACYA 3D3CJ 2YQ3A 3IR5B 5ELZA 5AE3A 1RCHA 3R9PA 1PJ6A 2CPJA 1S1WA 2JNJA 3ZZOA 4LFAJ 4TU7A 3J80O 1E6YB 1YSJA 2UUCJ 1BIZA 1KXPA 1TKTA 4F8RA 1KLMB 3GJRB 1MNEA 2O8BB 4C0OC 2N3LA 4NA2A 2RUGA 4B9NA 1LW0B 1R31A 2DFHA 4IDKB 4M5IA 1GFWB 1I3AA 1UEVA 3RYLA 2W7AA 2QMWA 3V4MA 4B3TK 2E20A 2WVEA 3FC9A 1B9DA 1KQKA 2OTJN 1N5SA 3OVBA 2RDDA 1DQAA 1RADB 3LP2B 1H98A 4OJGA 4JV5F 3TSPA 4R25A 1Z2LA 2F9DA 1GLJO 3E8OA 3ET6B 3KDOA 2EK1A 2W4PA 2F8EX 1BA1A 3VEWA 4FJ9A 2JZ5A 4AE5A 2E44A 4JI0F 2B43A 2HSEB 3MCOA 1HLUA 2Q1NA 4AM6A 3UIQA 1TUYA 4O0NA 1VHIA 2E2NA 1RDBA 3IDHA 1FW6A 3IGNA 1GLLO 4GNIA 2L9DA 1L3TA 4EYHB 3VAFA 2UUAF 1FWLA 4O0JA 3QO9B 4YUDA 2IJRA 5GAEI 4FJHA 3GCXP 3N79A 4NL5A 4CZMA 1VJQA 5EOYA 4WQ5C 4Q7AA 4O5BA 5LMNK 4BRQA 4LFBK 5BR8K 3LW5C 3TRGA 4B9LA 2ZFHA 4WWSA 3DRRB 2EFNA 2JWLA 4RR5A 2XYHB 2GUIA 1IKYA 2VJUA 2EHGA 3N6LA 3VEOA 3SPYA 1U04A 2Q43A 2ASDA 5AQIA 2VBYA 2XY8A 1D0EA 5AXKA 5HI7A 1JWWA 1VRUB 4TY8A 2VBXA 2EI5A 2RMLA 3FQLA 4C1NK 1RLDA 4KR0B 4DL2A 5B0FA 5I3UB 3V9SA 4KKOB 3P83D 2HS0A 3HULA 4HTUA 1NNEA 1IG8A 3EM1A 3CCWA 3CDEA 1LW2A 3HD1A 4Z4EA 2FBTA 5AQNA 4NYZA 3R7SB 1NSKL 2YNIA 3MM8A 5IWAJ 2RRNA 3FRYA 3VESA 3Q86A 3LALA 2RHQB 3ZSWA 3U7JA 3GPAA 2VQEF 1AFJA 1NU4A 1RTHA 4P72A 4CHPA 3FSXA 5DM6L 2DEIA 3MM5A 4MKVA 3ZC4A 3NMRA 2O8CA 4PABA 3WQUA 3WDOA 1NPRA 3J7AN 5J1NA 3SQ2A 4QZVB 3MCMA 2BR0A 1YK9A 3HRGA 3GE9A 4QIGA 4CBUA 4PPDA 3IO1A 4EK2A 3S3OA 3CCTA 3VZHA 1WKKA 3WX8A 3DRXA 3SFUA 4RNMA 3CHWA 2D7SA 3N5BA 3M6GA 2FZKB 1XMOK 1T6CA 4H5NA 2ZGYA 3B82A 1U1NA 4I9LA 3CIMA 3QJPA 1LK5A 2B7CB 2V2KA 4YMEA 2XQCA 4ES2A 3I5CA 4PKDB 1RU2A 1RTJA 4B3RJ 4N7TA 1N33J 1C4AA 2EW9A 2ZBIA 3I5BA 1VQ8S 2DNRA 4XDCA 1NPPA 4Q2MA 4ELUA 3GYXB 2M7SA 3H4DA 1J9AA 2BABA 4J2DA 1SKSA 3DLKB 4L8RB 2LDIA 1WDTA 1IQTA 5C2GA 1WSVA 3PFOA 4EZ9A 4H4MB 4BRDA 3NF6A 1QAIA 2BUNA 3B78A 4DPWA 4DTPA 4Y0WA 3KJNB 4MYTA 5T7LA 1ESVA 1GK8A 4ZOSA 4K2XA 1DURA 5ETLA 4DJBA 4Z7YA 5FLXU 3NH1A 1NHKL 3MUMP 1VHXA 2VA3A 2L9NA 2HWHA 3C0BA 1CG2A 1HBOA 2C42A 1N88A 4OYMA 4M5KA 3R1XA 2DNPA 1NSAA 4CI6A 3NNHA 2YQ1A 1I5OB 2ZOGA 2MDAA 4CHYA 1RAJA 4U8YA 1T7PA 4URGA 1MG7A 4GKJJ 4O55A 2W9CA 5JICA 3D66A 3M9MB 5CAAA 3BREA 2ZBCA 2ZITA 1YJ9S 4CT8A 2IC3A 4K43A 5HQLA 1IJFB 3CVKA 2FBVA 2LMIA 3M7VA 4JKHA 2DO0A 4CJRA 2LLZA 4V19X 1B3TA 3HHNB 1TV6A 2NPIA 3PV8A 1HBMB 1Q82T 4DS5A 3ZSZA 3BR8A 1VQ7N 4KH5A 1RAGB 5AQLA 3V6KA 4KPCA 4EFAC 1JJHA 4DZDA 2PT0A 1HQEB 4RTFD 4CJQA 4CJWA 4CO3A 4CM0A 2GEMA 2BW7A 1E4GT 1IR2A 5HBMA 3P6YC 5F8LA 2RHKA 2ZEJA 1QS4A 2NXCA 2LU1A 4J2AA 5HRNA 2YHWA 3BGUA 4UOCA 5GAEP 3CW2C 3ZXWA 4X62J 2DYAA 1C1CB 5KT2A 1F5CA 4B3RK 2H5IB 2HQFA 3RB6A 1FVQA 1YJVA 1N32K 3AVFA 2VFUA 4U7BA 3D6TB 2AYMA 3MDFA 3TAEA 1OMSA 5HROB 3JAMY 1UVIA 2V5HG 4A8MP 3AVIA 3LP0B 3MM8B 1HW8A 5GMEA 5A0YA 1SIZA 2HKEA 2DFFA 4KHRA 2YCHA 2PFDA 3MM5B 1SH0A 2AEMA 2OO4A 2ZOMA 4JI1J 2R8JA 4M3WA 3NGZA 3NEKA 3TO8A 2BE7D 3W60A 2CQGA 2HZAA 2GUPA 4QS7A 1HI8A 3D0GE 3GP9A 2UUBJ 5GAHI 4KHWA 3KK1A 4P7TA 4N8NA 3H5XA 1WHVA 4UOHA 3VOVA 3K7RA 2ZOFA 4H4KA 2O5DA 1MROA 2AW0A 4IZ9A 1UAXA 3T6BA 2DHGA 3CPWR 1N36F 3EGWB 4CLYA 3UVJB 2AYGA 3FKBA 5FJ4A 3CCRN 2HQCA 5ETSA 4BRFA 4EGLA 4EBDA 4K4TA 4NO7A 3HDSA 2CQ4A 5D78A 4TU8A 2A2DA 4A8KA 4ZIVA 3CJTA 1BC6A 5GMDA 4CJFA 4E8UA 2LQBA 4OYWA 3CO0P 4MIBA 3G4SS 4ECZA 1RDUA 3G71S 5LMUJ 3QRRA 3DJCA 4CZHA 3R5AA 2GWJA 2F96A 3L95X 4OHVA 3PRBA 4LF8F 4P7VA 3CD0A 1ZBFA 4ZHRB 3O9QA 3BSCA 2CH6A 2OA8A 2ZH9A 1UVKA 1C4CA 4NLWA 2LVWA 5K14A 2Y1IA 3KG1A 2VG7B 3BKFA 1WKJA 4PUOA 2WBRA 3A1YG 1VMBA 3W2WB 2E5LF 3ZT1A 5DQHA 4X62K 2VQFJ 5LJ3Y 3J7ZT 3Q0AA 1VLYA 4NCBA 2DR6A 2YTCA 4C0BA 4H0VB 3VERA 3PX0A 1RAEB 5CQGA 4LSNB 2OMOA 1W25A 1AW0A 3O9SA 2DNGA 5DK5A 3PEJA 3CCSN 4M5HA 1RNHA 3NG8A 5F0UA 3DRPA 1T8EA 1LNQA 1NGHA 2LQ5A 1BQMA 3N6NA 1XNRJ 4B1XB 3AOBA 4DTMA 3EMTA 2BW2A 4J9RA 2M8DB 3OXLA 4JI1K 4KTZA 4C3KA 3DNCA 3AVHA 2BE2A 1TV6B 1U25A 2CZ9A 1M5HA 4B8AB 3CCUS 4F25A 1KVIA 3QT6A 2RSQA 3WIVA 3VEVA 3I56N 4DR6F 3CULA 4RUHA 5DRKA 1GH8A 3F73A 1FEHA 4RNOA 5HBMB 1RACB 4R0EA 5IM0A 1H74A 1P9QC 2P9UA 2F3JA 4M3RA 4B1YB 2C2EA 3NGYA 3EICA 2L9WA 3I31A 5CZVA 2DNNA 1RK8A 3MM7B 3NMAA 3C19A 4LF4K 4BLGA 1R89A 4CJVA 4JP8A 4J90A 3DN9A 4IQMA 1XIQA 2Y8WA 5KGXA 2OTJS 4OX7A 2W4DA 2QK9A 1WOPA 2Z0GA 3GFYA 2FDNA 2DR8A 1NEEA 1FKPA 3ZFVA 2I0XA 4F4XA 3CIPA 3ZSXA 3V2UC 2P5VA 3V4IA 5A0YB 5LMUK 1XBWA 2P9SB 1KQSM 5D4NA 1RTDA 4NXMK 4XK8C 3RRHA 1DZ5A 2YH1A 4PQUA 2ZVIA 3OYJA 4HUFA 5AXNA 4ZCMA 3HHLC 4B9MA 4BDPA 4A61A 3ICLA 4EEYA 1JCGA 3X3UA 4O0IA 3KK1B 2XY7A 1ZETA 2WBNA 2HOEA 2PEBA 4H5RA 5HLFB 2VQFK 3D3BJ 4HVZA 3BKUA 3AH6A 3H7HB 2F9TA 4Y0FA 4UOFA 1CPZA 4OGEA 4LSLB 1F9HA 4O3OA 2VB6A 4DTXA 1O8BA 2OUGA 2ZZTA 3W64A 1ASVA 2BOPA 1HNWJ 2OPPB 3C6UA 4C97A 2YWGA 4KH4A 4DN0A 3PRVA 4H03B 3L8BA 4YOTA 1XNRK 3HCXA 4PL8A 2DY4A 3KUHA 3GLJA 1ZH5A 3LDOA 3LAMA 4PEOA 4FWLA 3QRPA 2DXEA 5KFBA 2DT9A 4MYUA 1RJJA 4ISEA 2RQ4A 4OI4A 4ILRA 2NXEA 2WK4A 2PBDA 3I8DA 1SL0A 1T3VA 1XHXA 4DCHA 3SV3A 1FE0A 4KHYA 3RTVA 3M8ZA 2QJ3A 4CO5A 2AF6A 4PXBA 2WVDA 3H5SA 3G6YA 3DRSA 3CNQP 3P38A 1IJEB 5ETTA 3C94A 3OS1A 1VQMN 5A8KB 3QFWA 4PUOB 1REVA 2KLAA 2DITA 1H2UX 1ZPWX 4MJKA 1H72C 3UN3A 1RBRA 3CJ5A 3M8QB 4RWTA 3L3VA 4MKBA 4U67L 4CLSA 3QSYB 4BGAA 3TAMB 4C6AA 5DM7L 1DAXA 2BVZA 4NX9A 1JCEA 4LRBA 2VBWA 1R27B 3EVMA 3B8HA 2O8EA 1V6HA 4FF4A 3CC7S 1YVUA 2GC8A 3WUHA 2B9WA 3THPA 3E3XA 1TL1B 1AYEA 2C2OB 3O80A 1UVLA 3M2RA 1K9MO 3K9JA 1X8DA 1U0HB 1ROFA 4ZTFA 1YVFA 3F2KA 1GQEA 4USWA 4I68A 1RT5B 1K47A 1NXIA 2MPUA 4DDFA 4ZN3A 4DFPA 4B9UA 4CYUB 2E8AA 4U67Q 2QA4S 4OPKA 5KFHA 3VTHA 5DM7Q 1FXRA 1LWEA 4LBPA 3LGNA 1XC9A 2VGNA 3ENQA 3I4HX 1JK9B 2R9LA 2UXBJ 4OI0A 4CEZA 3QGPA 1Q81T 3CJ4A 2P9IB 2V9KA 3OTBA 4WU2A 5DG9A 4CJEA 1DTTA 1HNWK 3QRQA 1IH7A 1TMMA 2GNKA 4YB1P 3HI9A 1WSEA 3RSEB 1ZBIA 5E2QA 1JLQA 1YZ6A 4ALZA 1RAAB 2B56A 2ZUGA 5EX3A 5IV3A 2BDPA 1WC6A 4KGKA 2SXLA 4CEFA 5LSLA 3L0QA 5J2NB 3V4IB 3CCQN 3L3UA 4X4QA 3K5NA 1RTDB 3D2FB 2HBYB 2QRRA 2VODA 2DR9A 1HWUA 3EYZA 2YKQA 5D6GA 4A8FA 4TXSA 5HRSA 2E2PA 4YHHF 2G4BA 2GZOA 3M1VB 5E3CA 4OYPA 2K2PA 2XSJB 1FRHA 1RCXB 4FJ8A 2QN6B 2HVDA 4Y6IA 1HHSA 2GO8A 4J9UE 3CJKA 4M63A 4DF8A 2NRZA 1S72N 1I94F 2AP1A 3W9HA 2V4RA 3QGGA 1TK8A 2IVMA 4YP3A 2RT3A 3H08A 4Y28C 2NUBA 2FQQB 2XLKA 2MKJA 1K8KA 1NDPA 3D2WA 2HHHJ 3EKSA 1JLEA 1RT7B 2ZH1A 1CJUA 4ZVPB 4ENOA 2HS3A 2WVFA 2DHSA 1EJ7L 1L3KA 4NLOA 4EHUA 2ZKUA 5U47A 3MMCB 5CZ2A 4OZNA 5AQTA 3J7A1 4NXNF 2K7JA 2RRBA 4DPTA 1Q53A 4JK8A 4X2BA 4FL9A 4NLXA 1AB8A 3CQYA 1SUQA 2VKZG 4L72B 5F2RA 3O3GA 3CM6A 4CJKA 4I2PA 3M5RA 1NGBA 2Z58B 2J5AA 1VQOS 3DRSB 1TL7A 3US5A 1HBUB 1OVYA 2HVEA 2UXBK 3ZZ0A 1U49A 1WTFA 3RVCA 2MKKA 1REVB 3FCHA 2MB0B 3THVA 5L9XA 2IAJA 3TUZC 2JWKA 4FWQA 2CQCA 1P90A 2VFVA 4ECUA 3DOLB 4ZVGA 2U1AA 4DWIA 4KGMA 3KLFB 3CB4A 4E7JA 2W2PP 4MLHA 1NUEA 5K5MA 3MXHP 4WTYA 2DB1A 2W2QP 2WVBA 2ZH5A 3P39A 4B3SF 4QU7A