1HQEA

Human immunodeficiency virus type 1
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
554
structure length
554
Chain Sequence
b'PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords POL POLYPROTEIN
publication title The Lys103Asn mutation of HIV-1 RT: a novel mechanism of drug resistance.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 135
structure length 554
sequence length 554
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2000-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1hqeA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1hqeA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1hqeA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1hqeA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1hqeA05
4BE2A 3V1RA 4KI4A 2R8GA 5KRTA 1MU2A 4K4SA 1T3NA 4X2BA 3OVNA 4K4XA 3DLGB 1RT4A 2RKIB 3VQBA 5KFCA 4DTMA 2YNFB 3UQSA 4K4TA 1VSLA 2B5JA 3L2VA 2G8KA 4J2EA 2VG6A 4F8RA 4DTOA 4HCCA 3TI0A 3HP9A 3JYTB 3I0SB 4N41A 3KLGA 4O3NA 1S1VA 1HQUB 4UQGA 3SV3A 4FJ5A 3MR3A 3QIPA 4WE1A 2PYJA 4NLUA 4C8MA 4KHMA 2R8IA 2FJWA 2X78A 3ZSZA 3MXMA 4O44B 3NAHA 4ECQA 3KD5E 3AVGA 1RTDA 3HO1A 4KKOA 5CYQA 2ZE2A 3H59A 1HRHA 1JLAB 2VA3A 1TL1B 4BDYA 2RDJA 2V4QA 5HP1A 3KLIA 1IG9A 3NF9A 3AVMA 4RW9B 1HNVB 4KHYA 2IA6A 2HNYB 4NLQA 4FLTA 2YKMB 2IC3A 4QWEA 3OJUA 2HMIB 4IRCA 4FCYA 5L1JA 4DU3A 4FJLA 4F4WA 4CJTA 3QLHB 4PY5A 4M41A 4QW8A 2B6AB 1CXQA 1RNHA 4KRFA 3MECA 5C5JA 3DYAB 3AVCA 4U6PA 2R7YA 1TKZA 1DLOA 1I3AA 3TARA 3U6FA 3I5CA 1YVFA 4ZPAA 4W5QA 1IKYA 3PVXA 4FBTA 3G0ZA 1CLQA 2VWKA 3DRRA 1RDCA 3WNEA 3V1QA 3OYNA 2YNHB 3H08A 3KTQA 2D7SA 3G6VA 2G8FA 4CJWA 1U09A 5KG6A 3ZSYA 3P83D 2O4IA 2OPRB 1RTJA 3C6TB 4FS2A 2BANA 3MXIA 4GW6A 3KK1B 4CJPA 1Z26A 2BQRA 3T5HA 4F2SA 4W5TA 1IO2A 1N5YB 3PR4A 2YV0X 3KD1E 3GIMA 1L3SA 2R2UA 1SH2A 4M45A 5DQHA 1RT3B 3AA4A 2KZMA 1L3VA 3RMBA 4B9LA 3H98A 2OA8A 5FDLA 1NHVA 4E1MA 4CF2A 4E3SA 5KFIA 4NLGA 1WAJA 1BQMB 3FQLA 1YVUA 3LPTA 5F8NA 4I7FB 4TXSA 3NH2A 1HMVB 1C6VA 2IJNA 1FKOB 4URGA 1S5JA 2UVUA 2QV6A 1JLCA 2KW4A 5KT5A 4LD0A 4NLTA 2XGQA 4CJQA 3AA5X 3ZCMA 2IM2A 3KMQA 4B9UA 3IS9B 1G15A 3DLKA 5KG7A 1FK9A 4QWBA 2A1RA 4ELUA 5KT7A 5CZ2A 3Q8SB 2OH2A 1LW2B 3CJ4A 3ZSQA 4KTWA 2R2RA 4OJRA 3AVFA 1HJRA 2CKWA 3TAMB 2HHSA 4ECVA 2VA2A 3BGRA 4FJXA 1T05A 2QK9A 3KLEA 1S6PB 2WRMA 1R0AB 1C1BA 1WNSA 1KLMA 1CZBA 1S0MA 2G8VA 2VG7B 3H5YA 1X9WA 2IJFA 1EXQA 4URQU 4U7CA 1RT2A 3PV8A 4CECA 3DLRA 1ASUA 4IG0A 5KFYA 5K14B 1VRTA 4MFBB 4OPJA 3PW4A 4H4MB 3DRSA 3K5OA 2XI2A 3VQ7A 4J9RA 4YR0A 4EYHB 5I42B 2G8HA 4PA1A 2HHTA 5KG2A 4YR2A 1ZBIA 4IH7A 2OZSA 4WZMA 4ED7A 4J9OA 3TAEA 1JLEB 4CHPA 1WSEA 4ECRA 4ID1A 1RBVA 4Z4EA 3C94A 5KG3A 4DTUA 3DLEB 4PWDA 1RYRA 3DRPA 2BRLA 1RT6A 1HQEB 1K6YA 2YHBA 3VQCA 1TK0A 3AO2A 2WONB 3OHAA 1TAUA 4O4RA 4NCBA 1S1UA 4OGEA 1TVRB 4NCGB 5KFDA 4Q0BA 3VA3A 4RW4B 3RBEA 4RNMA 3KKSA 5CYMB 1WSFA 5F9LA 3MFIA 1S48A 3DM2A 4FM1A 2ATLA 4IDKB 2E9RX 3GQCA 1RYSA 4ZVHA 4B9VA 4RW8A 2WOMB 3ZT3A 2HHWA 2HW3A 3HVTA 2HNDB 3MEDA 3FFIB 3NH0A 4OLBA 2E9TA 2HNZA 2IMWP 3CWJA 4KREA 4DQSA 3C6UB 1RTIA 4ECZA 4PQUA 3V9UA 4DG1B 2W8KA 1ZBUA 5F8HA 4WXOA 4EP4A 4TYBA 2KFNA 3L2WA 1S4FA 4KBIA 5KFBA 2Z1JA 3K57A 4KFBA 4HCBA 2IAJA 1ASWA 3V4IB 3EY1A 1EETA 1GX6A 1DTQB 4J9KA 3T5JA 1VRUA 2D0CA 1S9EA 5KTQA 4N76A 1JLGB 2IM3A 5FRMA 4CEZA 1REVB 2GUIA 1XR5A 4JRQA 2GIQA 2E4LA 1Q9XA 3KNAA 3LDSA 4M3XA 3PW0A 3TVKA 3V9WA 3LP2A 3UDLA 4O0JA 2JEIA 4IFVB 4DLEA 3HSTB 3NAEA 1S1TA 3RB0A 3P1GA 2DPIA 1VK0A 2GV9A 3O3FA 4KO0A 1BCOA 5J2NB 4O4GB 4EBCA 2VG5B 2ATQA 1TV6A 1A5WA 3H2LA 2R8JA 2ITGA 1LWFA 3T5KA 4Q8FA 3OJSA 4KHSA 4Y3CA 1RT1B 4G1QB 2OPQA 1WSGA 4RNFA 1W25A 3TANA 4GMJB 1L5UA 1C0MA 1LWEB 4IOBA 1K1QA 4FJHA 3EZUA 4DTXA 1SL2A 2FLPA 1J5OB 3QERA 3WNGA 4FW1A 5KFAA 4YP3A 1TP7A 4RUCA 3NBPA 4XPEA 3HKWA 5KFZA 3DLGA 2RKIA 3GIJA 1XI1A 2HWHA 1NK5A 3PHEA 4MK9A 3H5UA 1BGXT 1IKVB 4CJEA 2F96A 1HNIB 1HARA 1U4BA 3IG1B 2EC0A 3DOLB 3L3UA 4I2QB 3KIOA 3JYTA 3I0SA 4K4UA 1S0OA 4KV8B 3RBDA 4AH9A 1WSHA 2WTFA 2FLLA 4DS4A 4YQWA 4AHCA 5J2MA 3T3FA 4O44A 5JS1A 3V6KA 4FJJA 3CDWA 4L8RB 2J6UA 1GOAA 4O5BA 3JSMB 1S0NA 1TAQA 3AA2A 3CFOA 3ASMA 1JLAA 4W5NA 3DLBA 1TL1A 3LP0A 4JLHA 2FBVA 1WN7A 3OYDA 4FBUA 4CEAA 3HPGA 4RW9A 3PJWA 1HNVA 1ZETA 3BQ0A 2HNYA 4GC7A 3EZ5A 2DFFA 2YNIA 4CJUA 2XY6A 1QAIA 2HMIA 3DI6A 3LWLA 5J1EB 3HPOA 3VQ6A 3SCXA 4DTSA 2FBXA 2B6AA 4AILC 4Y34A 4TY8B 5HRSA 3DYAA 4C8NA 3TAFA 2DFEA 3MEGB 2Z1HA 5HRPA 5KFPA 4I2PB 1KFSA 3QGGA 2IM1A 2VWJA 1TGOA 5E41A 4DLGA 3RTVA 4FS1A 4ECSA 3SNNA 4MQ3A 4B9NA 4OVLA 3CDEA 4DS5A 2OPRA 3QIOA 1QHTA 1RTHB 4C8OA 1NK6A 3M9NB 3C6TA 4K4ZA 3OYCA 5KGWA 3M8PA 3KK1A 1D9FA 5KFXA 1N5YA 1QAJA 4Z4FA 3ITHB 3OL9A 2XO7A 3H4DA 3SYZA 1GOCA 3ZSVA 2XI3A 1RT3A 4F2RA 3QEPA 1JXEA 4QOZB 4DL7A 3NHGA 1BQMA 3K5MA 5KFUA 4RNOA 3PX6A 1QQCA 5J2PB 4CGDA 1Y97A 4I7FA 2WB4A 2YNGA 5J2QB 3AVJA 2XY7A 3N6LA 5DGAA 3LP3A 2HHVA 1KHVA 1HMVA 2BRKA 1FKOA 4H4OA 2FVQA 4TN2A 1JX4A 3NAIA 4EZ6A 1Z25A 3BSOA 3PW2A 2C2DA 3I0RB 2WHOA 3AO4A 1ZYQA 4Z4IA 3H5XA 4HUEA 5C25B 3VQ5A 4MK8A 3IS9A 2DTUA 4CHZA 3OLBA 1T03B 4XPCA 4FVMA 5DK5A 1RILA 1LAWA 1JLQB 4JUZA 3OYFA 4J9NA 3CDUA 3VN5A 4CGFA 1HYSB 5I3UB 1TK8A 3TAMA 4NZ0A 3OYEA 4M3UA 1A5VA 3O4NA 3B6OA 4W5RA 5EUHA 1GX5A 1S6PA 4KAIA 4PUOA 4Q8EA 1R0AA 4YNQA 4TSXA 2VG7A 4FJMA 3HPHA 2P5OA 4FZZA 3HK2A 3CVKA 5HROB 3OS0A 5SZTA 2LSNA 5K14A 4MFBA 1X9MA 2FBTA 4ZTJA 3SQ1A 4FJ8A 3I5BA 4EO6A 3FSIA 3QETA 4FZXC 1ZBLA 2E9ZA 3MF5A 5I42A 3KMSA 3PUFA 2JGUA 5DMRA 3S3NA 4B3OB 3TWHA 5KT3A 3QNOA 4F4KA 2Q3SA 4HTUA 1BIZA 3SQ0A 1JLEA 4R0EA 5KFFA 5C42B 4ICLB 4DSFA 2OPPB 4FJNA 3NKYA 4CK3A 3GV8B 3MR5A 2AGQA 3DLEA 4ZMMA 4TQSA 4FYDA 4NYNA 1HQEA 4IH5A 3QZ7A 1N6QB 2XGPA 4CEQA 2WONA 2OZMA 2W7OA 3SJJA 3AVHA 3OS2A 2FVSA 2IGIA 2ILYA 3LANA 1TVRA 4ECYA 5KFVA 3QZ8A 4CHOA 4RW4A 3LPUA 4E1NA 4EEYA 4Z0UA 1N48A 5HLFB 4CEBA 2IBKA 4N47A 4IDKA 4CF9A 3OL8A 2WOMA 3KJVA 2HNDA 4R5PB 3GYNA 1QE1B 3FFIA 5F8IA 3THVA 3RWUA 2W42A 4CEDA 3KLVA 1VSFA 4DG1A 2HHQA 1RA6A 4KHUA 3QIDA 4NLPA 3U3GA 3V4IA 3HP6A 1DTQA 1UA1A 2D3UA 4J9LA 3D0PA 1JIHA 4J9QA 4BE1A 4F50A 1JLGA 1OS5A 1REVA 2V4RA 4BWMA 1VSMA 3HVWA 2G8UA 2QXFA 2GIRA 1UAXA 1IKXB 1B9DA 3KK2B 1RDRA 3RAXA 3AO5A 3OS1A 3VA0A 3TAQA 4CK2A 3IN5A 4IFVA 3TQ1A 3ALYA 4CJLA 1UWBB 3FRZA 4CJFA 2D0BA 2NUBA 4NLDA 4CHQA 3TAGA 4M3RA 4ID5B 4JS4A 2ZD1A 3VQSA 2BDPA 5J2NA 4DSKA 2PYLA 4O55A 4IKFA 3DMJB 3CFRA 5DQGA 4CFAA 1SUQB 3PZPA 4LSLA 4M3YA 5DLFA 3N6NA 2W7PA 3SI6A 3BREA 1RT1A 3M8QB 3KLFB 2UUWA 4BDPA 3O4QA 1IKWA 4B08A 3KOAA 5KFLA 3VQ4A 3Q8RB 3T19A 1RBUA 1NJYA 1LWEA 3GV7B 4B8CA 1KHWA 2AU0A 4FLVA 5KGXA 3QESA 1J5OA 1DTTB 2FC0A 3QGHA 1BL3A 5EWFA 2VG6B 3QO9A 1S9GB 4Q44A 1U47A 4K4YA 5FRNA 3KLGB 2XY5A 1X1PA 1SV5B 4MIAA 4J2DA 4ZVGA 4JS5A 2AJQA 1IKVA 3V9SA 4FM2A 1N56A 1HNIA 4O3PA 4DL2A 4NLXA 3IG1A 1I39A 3DOLA 1JL2A 2C28A 4I2QA 1RTDB 4M42A 2ASDA 2ZE2B 3ZSOA 1RT7B 4KV8A 4G3IA 1YT3A 3LP1A 4DQQA 2I5JA 3T1AA 2D41A 3V6DB 1HPZA 1KFDA 4BACA 4WFZA 2QE5A 4FM0A 1C0TA 3ZT4A 1NK0A 4WYWA 3HVRA 4OKKA 4Y1DA 4RW6B 1EP4B 4ZP8A 5JUMA 3V81B 4KAZA 5L1LA 4ZPDA 5DG8A 4DL3A 4Q43A 4IFYB 4QWCA 1BCMA 4DU4A 1DLOB 4F4YA 1JLBB 2ILZA 5FROA 5J1EA 3RRGA 4NLSA 3H5SA 3P5JA 2XCPA 3DRRB 5KRSA 4I9QA 3DLHA 3O3GA 3V6JA 3SQ4A 3G6YA 2C2RA 2HHXA 1S6QB 4CJKA 4O3OA 1HYVA 3NDKA 3MEGA 2XC9A 4I2PA 3NL0A 3K2PA 1XR7A 4ZHRB 4DSJA 3IGVA 2IDOA 4KHRA 4E7HA 4M94A 3NFAA 2XHBA 3QNNA 1D9DA 1D8YA 4IBNA 3OL6A 1XWLA 5F9NA 1VSEA 2BE2B 4K4VA 3PO4A 2XCAA 5KFTA 1RCHA 2XY8A 1QS4A 3TABA 5KFGA 5JS2A 2IS3A 2O4GA 5EDWA 4CE9A 3ITHA 2Z1IA 4EO8A 5HRRA 4B9SA 1KLNA 2JEJA 2ZQBA 3OYMA 4HVJA 4WFXA 1JXLA 4KHNA 4ED0A 2FLNA 2W9AA 4F3TA 3EPGA 2G8IA 3CJ3A 3OYKA 5KFOA 3KKRA 3SQ2A 4FLYA 5J2PA 5C24B 1BI4B 3AVKA 4BE0A 2R2TA 1QSSA 1S1WB 5KG1A 4E7LA 5KT2A 4ZPBA 2ASJA 4CESA 4MKAA 2YHAA 4LSNB 1VSHA 3H40A 2OPSB 3SI8A 3U3YA 4DFKA 3I0RA 2R8HA 4K8ZA 3PW5A 4O3QA 4NLRA 2BQUA 3QEXA 2AQ4A 1S9FA 5C25A 1RDDA 2DY4A 4DFPA 1T03A 1JLQA 1JLFB 2FJVA 1EX4A 1KLMB 1SH0A 3UIQA 1HYSA 5I3UA 2EHGA 2X74A 3WNFA 3WNHA 1BISA 4ED2A 4CK1A 2YNFA 5DG7A 1A5XA 2RF2B 3SUNA 4RUAA 5KG0A 1J53A 1W0HA 3DRSB 3MFHA 3BQ2A 4CJ5A 1D1UA 4KB0A 5HROA 1KRPA 1HQUA 3IRXB 2XRIA 2ETJA 1NJXA 3RB3A 4CEFA 1RA7A 3V1OA 4DMNA 5KFQA 1NK7A 3PY8A 4JRPA 4NYZA 4JV2A 2HVHA 4B3OA 3A2FA 4FLWA 1LW0B 3F73A 3AO3A 4AHSA 5F8MA 1KVAA 2WK4A 4HUGA 2W9BB 1NOZA 1NHUA 1NJZA 2AWZA 5DG9A 3K58A 2YKMA 3KLHB 5C42A 4ICLA 2OPPA 5D3GB 3OYBA 4WXWA 3QLHA 1YTUA 4M3WA 3ISNC 1N6QA 4OGCA 4NLVA 4BWJA 1BQNB 1RBRA 2UVRA 1WSJA 4OL8A 3OLAA 1I6JA 4CFCA 2HNZB 3S9HA 1LV5A 5HLFA 2F8EX 1CSJA 1RTIB 2YNHA 4LQ3A 2UUTA 5KFWA 1IH7A 4DEZA 5KG5A 4N5SA 3OYHA 4H54A 4IR1A 3HM9A 2Y1IA 4QPXA 1QE1A 2AX1A 1SKSA 1VSJA 3UR0A 3GIKA 3NGDA 3E01B 4YR3A 3AVLA 4CF0A 4R8UB 1T7PA 1NKBA 3LAKA 3LZJA 1XR6A 3ZT1A 1NKEA 4LH4A 4Z4HA 4CJSA 1UA0A 4KHQA 4CCHA 3H4BA 3PW7A 4BDZA 3SUQA 3MTKA 4QWAA 3CO9A 3V6HA 3CG7A 3D45A 1TKXB 3LAMA 3LP2B 3G6XA 4DSLA 4HKQA 3FQKA 3OY9A 3BR9A 4ECWA 1CXUA 2HHUA 1TL3B 3HXMA 4E7KA 3VQ8A 3RMCA 3NH1A 2D0AA 1IKXA 3KK2A 4MKBA 1JL1A 4DTPA 3RRHA 5KFKA 4KE5A 4DSIA 4ED6A 4RNNA 3OSPA 1J9AA 2R8KA 4CIEA 1TV6B 4FLXA 4ZTFA 5EU7A 1UWBA 4RW7B 4CERA 1U48A 2C2EA 3AVBA 1RAJA 4E19A 4DTNA 4AHVA 1NK8A 4DQPA 4KTQA 1LW2A 2Z1GA 4ID5A 1LWCB 1FKPB 3QYYA 2KTQA 3SZ2A 1X9SA 1SKRA 4LY7A 4IH6A 3K59A 1SUQA 3QEVA 4TLRA 4B9TA 4Y2AA 4MH8A 3M8QA 3KLFA 1WNEA 3SPZA 5KFSA 5DLGA 2AX0A 3NBPB 3FDSA 2DFHA 4NLOA 4DFMA 4KTZA 4HUFA 4EZ9A 1S1XB 4H4MA 3QEIA 5HBMB 1DTTA 3NCIA 4DQIA 4DL4A 3DOKB 2P51A 2EX3A 1S49A 3CM5A 1S9GA 4F4XA 1NK4A 2QKKA 4IQXA 4FJIA 5L1KA 3OYIA 1GOBA 4Z4CA 1C0UB 2E6MA 1SV5A 2BQ3A 4LQ9A 5J2MB 3RB4A 3TAPA 3L2UA 4E0DA 2Y1JA 1XHXA 4B8AB 2ZKUA 4OKEA 2HAIA 4FLUA 3MEEB 1RDBA 4I9LA 1RT7A 3LP0B 4RG8A 1NNDA 5EWEA 3CFPA 4YFUA 1TKTB 3HYFA 1FXXA 2PZSA 3V6DA 4ECXA 4CJ3A 2J6SA 1L3TA 3GIIA 4QCLA 4FK2A 1B92A 4XO0A 2YNIB 4ECTA 4NCGA 4AHRA 1VSIA 3DI6B 1RT5B 5CYMA 4OKJA 3CJ0A 4RW6A 3CJ5A 2RDIA 4XIUA 1EP4A 5KFRA 3GV5B 1SH3A 3V81A 2UVVA 5KFEA 4AHTA 4E7JA 1ZTTA 3KK3B 4IFYA 4H8KA 1F21A 1JLBA 3OL7A 4QAGA 3BSCA 2KQ2A 3C6UA 2FVRA 4DL6A 2KZZA 1ITGA 4YMEA 4ED1A 2W9CB 3SFGA 1S6QA 1KTQA 4B9MA 4FJKA 4KB1A 1C1CB 1RBSA 4DF8A 4ZHRA 3NF7A 2ALZA 3M8PB 4CJVA 2R2SA 2KFZA 4W5OA 4OLAA 4ELTA 2BE2A 2RN2A 2YKNB 4E7IA 3B6PA 1TQLA 3I5AA 4DF4A 3HJFA 4CF8A 3Q8QB 2RPIA 4ED3A 1KVBA 1L3UA 1S10A 5CY4A 4IG3B 4GC6A 3DDKA 2YNGB 3BSNA 3ZT2A 4J2BA 3G10A 4H4OB 4LH5A 4ECUA 2IM0A 2B4JA 1JKHB 3LALA 5C24A 1BI4A 3SUOA 4O4GA 4DL5A 4NRTA 4KSEB 2V0NA 3AO1A 4JV1A 2VG5A 1NOYA 1S1WA 1B9FA 4IRDA 3RR7A 3QGIA 4CJ4A 4CGIA 2BR0A 4QWDA 1QSLA 2FVPA 4LSNA 3OSNA 3OYAA 2OPSA 1T94A 4G1QA 4ZP9A 1MU2B 4CIFA 3VQDA 1RT4B 3M9OB 4ZVFA 3MR6A 2F8TA 5KT6A 2FBYA 1Q9YA 3VQEA 2B5JB 5DGBA 4PUOB 1JLFA 4JV0A 1U45A 4HYKA 4DU1A 2D3ZA 2X6NA 3NF6A 1S1VB 1QUVA 3VQ9A 3QIPB 4WE1B 3ZSXA 1NJWA 2RF2A 3KHHA 4EBEA 2DPJA 1NKCA 2AGOA 4EBDA 1C1AA 4FJGA 3ISND 4DTRA 4KKOB 5CYQB 4IKAA 3IRXA 1YTAA 1T8EA 3Q8PB 4Y1CA 1SL1A 5HP1B 3KHLA 3KLIB 3RB6A 4IR9A 3JSMA 2D5RA 1N4LA 4O3RA 1RDAA 2IC3B 5SWMA 3M8RA 3MAQA 3I8DA 3S3OA 3KHRA 1LW0A 4WYLA 3OYGA 5L9XA 1LAVA 3D5MA 4FK0A 2W9BA 3MR2A 1HYZA 3NGYA 3MECB 4CFBA 3KLHA 4FJ7A 1TKZB 5D3GA 1KSPA 4TY9A 2J6TA 1IKYB 5JXSA 3AA3A 4J2AA 4M95A 3HVAA 2FJXA 1BHLA 3CYMA 4TY8A 1BQNA 2HVIA 3IGNA 3D28A 3KJVB 1RTJB 2G8WA 4ZP6A 3K5LA 4NLWA 2BANB 2JC1A 1SKWA 1CZ9A 4NRUA 1D5AA 1K1SA 3HT3A 1Q8IA 4WZQA 5HRNA 2XWYA 1WSIA 4ELVA 1KVCA 5KFNA 4E89A 1RTHA 4Q5VA 3EYZA 3CM6A 5FDLB 5KFMA 3VQQA 4TYAA 4CFDA 1QTMA 3E01A 1Z4UA 3OYLA 3KHGA 4R8UA 4C8LA 2X6SA 4RU9A 3SUPA 4OPKA 3ZSRA 2JEGA 2E6LA 1WLJA 4URSA 4NLYA 1JLCB 1WAFA 4FW2A 4O3SA 1ZBFA 4ZPCA 2ASLA 1TKXA 3C95A 1IM4A 5KFHA 4DTJA 5J2QA 2JEFA 4IRKA 5T7BA 2B43A 1TL3A 3DLKB 3AVIA 1D0EA 1S97A 1U49A 1FK9B 3HHKA 1SL0A 1TKDA 1RBTA 4CIGA 1ZTWA 3L2RA 2ZD1B 3HL8A 4HHTA 5KI6A 2GBZA 5F8GA 4RW7A 3BGRB 4LSLB 4RNHA 1T05B 3ZSWA 4N56A 3GILA 3KLEB 2W8LA 3BJYA 4MK7A 3CJ2A 1C1BB 1IKWB 1ZBHA 1LWCA 1FKPA 3AVAA 4KHWA 3LWMA 4FK4A 1RT2B 1W9HA 3M8SA 3UPFA 3BQ1A 4K50A 1BIUA 4IG0B 3PX0A 1VRTB 3MXJA 4GVMA 3PJXA 4KPYA 3QO9B 4CHNA 4WFYA 2JC0A 1S1XA 3BDPA 4FZYA 3OHBA 1EKEA 5HBMA 1TK5A 3DOKA 5KFJA 4DWIA 5L1IA 5CZ1A 5F8LA 2JLEA 4CGJA 4QW9A 3NF8A 3NGZA 2F8SA 4KI6A 3VQAA 4PWDB 4EYIB 4CEOA 2P1JA 3OYJA 4AHUA 1C0UA 3DRPB 4K4WA 3SV4A 3CQ8A 1RT6B 5DQIA 3LP1B 4CEEA 4Z4GA 4J9PA 2I5JB 4FLZA 3NGIA 3SPYA 3RR8A 3V9ZA 1HPZB 3QEWA 3O3HA 1S1UB 3VQPA 1C0TB 3MEEA 4Q0BB 5EWGA 4KB7A 3DM2B 1TKTA 4ZVEA 4DQRA 4M3TA 4F4ZA 1XHZA 3BSAA 4RW8B 2HB5A 3HVTB 3RMAA 3CIZA 4J9MA 4CGGA 3MEDB 4F3OA 1O1WA 3V9XA 3K5NA 4MIBA 2AGPA 1RT5A 5F8JA 3AVNA 5KG4A 4RZRA 4CF1A 4PQUB 1VSDA 4J9SA 3NMAA 3ICLA 4CHYA 3KK3A 4R5PA 2P5GA 4FXDA 3PX4A 3AV9A 4KFBB 3SFUA 3M9MB 2IAJB 1NK9A 3IAYA 4EP5A 1EETB 1QSYA 3LZIA 4FJ9A 1VRUB 4ZP7A 4DSEA 1S9EB 2W9CA 4Q45A 1U04A 1C2PA 1ASVA 3EPIA 1VSKA 1C1CA 2PY5A 4DFJA 4M3ZA 3L8BA 4Y2CA 3N6MA 5T14A 2O5DA 3ZT0A 3S3MA 3E51A 2QKBA 4C8KA 1S1TB 2I1RA 3PR5B 4O0IA 4NYFA 4NCAA 2YKNA 3TR8A 3L2QA 4KO0B 2BGGA 3RMDA 1KCFA 3F9KA 3QINA 1UOCA 4TQRA 3RAQA 4IG3A 1MMLA 1J54A 4K8XA 1LWFB 3L3VA 5KT4A 2WCXA 3T5LA 2GC8A 2C22A 2UVWA 2IOCA 3ULDA 1JXBA 2OPQB 1JKHA 3DMJA 3PO5A 4CJRA 4ED8A 4CGHA 1XC9A 3NE6A 2OYQA 2CJQA 2HWIA 2A1SA 2FVCA 3G86A 2V9WA
chains in the Genus database with same CATH superfamily
3CB4A 3O6WA 3GG1A 3OVNA 4K4SA 1VJQA 1CJVA 3G82A 1RT4A 1QTNB 3T1HF 4DTMA 3UQSA 2I8EA 2FHJA 3J7AN 2FSNA 1YZ6A 5E26A 4CO1A 4ID8A 4BC2A 4F3QA 2HHHJ 3TI0A 4ANEA 1RAEB 4CZLA 4RWXA 3C6HA 2ZITA 1DZ5A 2E2OA 3GB0A 4U9RA 1S1VA 1HQUB 3QIPA 2P8IA 4C8MA 4KHMA 1NM2A 4GKJK 3ZNUA 4A48A 3K89A 2ACMA 1RTDA 4UTGA 5H9FJ 3HO1A 4KKOA 5CYQA 1FJEB 1IJJA 1P1TA 3N01A 2VA3A 1TL1B 1SZ2A 3HDSA 4QU7A 1DJ0A 2RDJA 2R7TA 3G71N 4PZVA 3L9ZA 3H1QA 2RJZA 1NSKL 2YKMB 1Y7PA 3OJUA 1F9FA 2DY1A 2JFKA 4FJLA 2HQDA 4CJTA 2VL1A 3ILJA 3QLHB 4DUTA 2AP1A 3I56S 1JXVA 1RNHA 2YHXA 1VQOS 2QTDA 3DYAB 3FK4A 2AYBA 1IKYA 3G0ZA 1RSCA 3OYNA 2UV8A 2YX4A 2RU9A 1GLDG 3H08A 1S7HA 3W61A 4CJWA 4MAKA 1U09A 4PYDA 2IRXA 3M30A 4BRAA 1RAIB 2FHJD 2BANA 4RWTA 4Y0WA 3KK1B 1K73O 2D74B 1EZZB 4B3TK 4JI2J 4GKKF 4OI6A 3GIMA 3THWA 4LIWA 4OYZA 4M45A 2BVZA 3AA4A 1WSRA 2LXUA 4B9LA 3H98A 5D0EA 3R9PA 1WKLA 4G65A 1WAJA 3FQLA 2D4WA 4USIA 2DRBA 4I7FB 4TXSA 3NH2A 3NCQA 2W2PP 4YHHJ 2IJNA 3R3LA 4LREA 2QV6A 4DUZF 2GO8A 5A6PA 2RRBA 5HANA 1VBZA 2UYTA 3CTRA 4LD0A 2GQQA 1R89A 2XGQA 3NRBA 4Z37A 3BO2A 4ED5A 3JAMY 4QWBA 3F56A 4ELUA 4M5DB 4X4OA 2R4FA 3CJ4A 1H6KX 1RKJA 4MDAA 2RQ4A 4ES2A 1KS2A 4OJRA 4HLBA 4LF7K 5AR0A 1HD0A 2AEJA 2CKWA 5GMKa 1Q53A 4ZLLA 2WRMA 2ADBA 2YI1A 3D0IE 3SBMA 1YZ7A 1L3KA 3OR1B 4JK8A 1S3XA 1X9WA 2IJFA 4URQU 3M6XA 2QLFB 1RT2A 2GCFA 4CECA 2EBGA 1ASUA 4IG0A 5KFYA 3VVUA 2RSQA 5ETLA 3Q24A 4OYIA 3DRSA 1E3MA 1IR1A 3W5XA 4FWOA 4YR0A 4EYHB 4H0OA 2OD6A 4DV4K 1GXTA 4Y2MA 1BLUA 3L95X 3C7NA 4J9OA 1EQ0A 3QBWA 3DGPB 1URNA 2LU1A 5ETOA 2EFPA 3HFKA 1ZAVA 2MQ8A 2QWRA 4PKIA 5FPMA 1H74A 4FYVB 2HBKA 2MQNA 4ZA1A 1TMMA 1HW8A 3AO2A 5E2QA 1S1UA 3DLJA 3Q0AA 4EU0A 2E1RA 4EFAC 1TVRB 2UUAJ 1E4GT 4RNMA 1WSFA 5DM7Q 5F9LA 1D3WA 3ET6B 3DM2A 3EVOA 2ATLA 1PCAA 2E9RX 3SXLA 4M5GA 1BY9A 3GQCA 4P72A 3A0IX 3N9UC 2HNDB 3SBGA 3FFIB 3NH0A 4OLBA 2YPYA 1CZAN 4OZ0A 1WTFA 3CWJA 3CCEN 3P4IA 4USTA 1HR0J 1PILA 1I94K 3DGVA 1ZBUA 3P5BP 4WXOA 3CJTA 4TYBA 2KFNA 4WFAL 4BQLA 3I55N 2IVYA 4KBIA 4IZ9A 4KH4A 2RHQB 2J8SA 1VQ6S 2IAJA 3F0NA 3EY1A 1X4DA 2RIJA 5AFUA 3AARA 1EETA 1DTQB 1VRUA 1RWNB 2E2NA 4V1Ak 2ALYB 2C3UA 2IM3A 3BV8A 4LT6A 1XMOF 2ZH7A 3J7AP 1NLKL 2V2ZA 1NB7A 4JRQA 1HBNB 2GIQA 3CE8A 2E4LA 4U95A 4IQMA 1WB9A 2KVIA 5F3TA 2JEIA 2CPJA 4DLEA 1CVJA 1PJ7A 1S1TA 4C3KA 3RB0A 4N8OA 1VK0A 3FEYB 2HK3A 2KXNB 4KO0A 3O3FA 4L6V3 1BCOA 4EBCA 3GG4A 2G13A 3U8XA 1VQYA 4P7VA 2ITGA 3OUYB 2MZJA 3T5KA 4Q8FA 3OJSA 5EXWA 4IJAA 3N4QA 4G1QB 4WCEL 4DN0A 4RNFA 1W25A 3BEGB 3RBXA 2F4VK 4NX9A 4DV5F 1RB0A 5HO4A 3EZUA 3WXMB 4CLTA 5ADZA 3WNGA 2V2VA 1UJ5A 4DPYA 1FJGF 2Y8WA 2MLYA 4JKGB 3R3TA 3MM8B 1XI1A 4CLZA 4ILJA 1TL7B 4MK9A 3OVSA 1HNIB 1HARA 1U4BA 3DOLB 3MCAB 3KIOA 1X31C 1E4FT 4K4UA 4KV8B 5ETMA 2FLLA 1NGEA 4OYBA 1KR4A 4N77A 4QBUA 4DUYK 3AA2A 3ASMA 4W5NA 1TL1A 2HIQA 4CM2A 2FBVA 2N4DA 3L4QA 4FBUA 1NGJA 2A42A 1JCGA 2R42A 4CJUA 1DAXA 3QT7A 3D1OA 4ZN3A 1S0VA 3HPOA 2JHEA 1XBWA 4NXNF 3SCXA 4KR0B 4TY8B 4PAAA 1ZAXA 4DPWA 3DYAA 4C8NA 3ZC4A 1N36K 4I2PB 2VWJA 5FPNA 2GIFA 4CZFA 4ZVSB 3BH7B 2LEBA 2ZBCA 4OVLA 3TVYA 4DS5A 4JI7K 2ZH4A 1RTHB 4YS2A 1ZA2B 3EL2A 3M9NB 3KK1A 2G2OA 3G6ES 5HVHA 1VCTA 1G3OA 2P9KB 3BKUA 2KL8A 3H4DA 2VOOA 3ZSVA 5HATA 2QTWA 3QEPA 2JWLA 2MTLA 4OX9K 1N32J 1YJNN 1XN9A 3QNWB 5C2CA 2ROPA 1Y97A 4I7FA 2EC2A 2WB4A 4HI2A 3R97A 3LP3A 1S12A 3DRYA 1GLCG 2C2DA 2WHOA 3CPWM 2V2KA 2DEJA 1RKIA 2BJDA 2DGOA 4MK8A 3P49B 4U96A 2ZGYA 2DHHA 5AQFA 4CHZA 5DK5A 4M5DA 2WTUA 4JUZA 3OYFA 3QJLA 3EDQB 3VN5A 4CGFA 3CJ7A 1HYSB 5I3UB 1GNKA 3EUNA 5JVGL 1A7GE 1V5VA 3AGKA 1B7YB 1A5VA 3O4NA 4ZVTB 1VQMN 3OBIA 1P8ZA 1TFYA 3OR1A 3PYFA 2ZJPQ 4CLFA 1U0SA 4KYZA 2CJKA 2FBTA 3R5GA 2HQ3A 3I5BA 3LDLA 2UU9J 3FSIA 3QETA 4FZXC 2NR0A 2E9ZA 2JGUA 3S3NA 4B3OB 3TWHA 4DDFA 3OTEA 3BGLA 2QWNA 3HHLC 2GX9A 4ETXA 1RAOA 3CT9A 4R0EA 3DGPA 3ISZA 4DUZJ 3MPYA 2HSTA 3TYTA 4ICLB 4DSFA 4FJNA 2AA4A 2QL5B 2OP5A 1IBCB 2HKEA 4M5MA 4TQSA 4FYDA 3KHYA 5BRHA 4IH5A 2UXDK 2B3TB 2QEXN 3ZYYX 1N6QB 4CEQA 2QWLA 4B3SJ 2FVSA 3A8EA 2ILYA 1TVRA 1QY7A 4C1NK 5KFVA 4OZ2A 3ZTQA 4E1NA 4EEYA 2DHXA 2NXJA 3ET6A 2ZZMA 4N47A 2IBKA 1YXQA 4CZEA 1DY3A 3BN7A 1VQ4N 2HNDA 2VZ9A 3FFIA 4FXVA 2DR9A 3THVA 5GAHI 5K20B 2CG4A 2K06A 5I9EB 4RTFD 3CJ9A 4KHUA 4PG6A 3G8QA 1X4CA 3OFEA 3ID8A 4IDHA 1Q5VA 3PSFA 5HQLA 3U3GA 2O8EA 2NYIA 1DTQA 5K8NA 1UA1A 1RCXB 3D0PA 4C98A 1UFLA 4BE1A 4P2XA 2A3ZA 4BRMA 2CZ9A 3CD0A 1OS5A 2AF6A 1HBNA 5IWAF 2QXFA 3LF0A 2H51B 3SMPA 4RUHA 5HAOA 5EX3A 3SQGB 1SIZA 3AO5A 2W4DA 3TAQA 1AFIA 2RRNA 3ATVA 1RABB 2DXEA 1O6XA 3QBXA 1C4CA 1CBKA 2D0BA 4MDBA 2NUBA 4NLDA 4CHQA 1XEZA 3TAGA 1FFSB 2CYYA 4M3RA 1N5SA 2JRSA 1YX2A 5DQGA 1TYQA 1SUQB 4M3YA 2BUNA 5DLFA 4ZIVA 1K47A 3O4QA 1IKWA 2EPIA 3KOAA 4LF9J 1FNXH 3VQ4A 3MCSA 3ILLA 3OTDA 1YF5L 3GV7B 3WQPA 3IKMA 1YJ7A 1D8ZA 1T9VA 2DNLA 1CEZA 3VEYA 2GZOA 3BKTA 2Q2RA 1BL3A 3CPEA 4QIFA 1WG5A 2UXBF 1F5CA 1MROB 3DKDA 4BR5A 4K4YA 1MWKA 2XYHB 3T41A 2OHDA 2CZVC 1TL7A 1GLFO 3JB9k 2A18A 3V9SA 1HNIA 1XMOJ 2ZNYA 4P74A 3DOLA 1T3OA 1JL2A 4CI0B 4DHVA 3FFKB 3AY0A 3ZZZA 2ZE2B 2ASDA 3ZSOA 4L72B 4KV8A 3I9V9 1TL4A 4Q7AA 1UP1A 3LP1A 4DQQA 3VAGA 2D41A 3V6DB 1WJ9A 1HPZA 1KFDA 2PFDA 4BACA 2RU3A 2F5GA 3ZT4A 4A8XA 3CC4N 4DZDA 3BEXA 1A6LA 1H98A 2ZM6K 1D9AA 3FZBA 4WF9L 3CCJS 2U2FA 1LK7A 4A8YA 3RW6A 5LL6d 5GAGP 4B02A 4LSZB 5DG8A 4DL3A 4Q43A 3A8KA 2DNOA 1F2GA 1BCMA 4AM7A 4FVUA 2OD4A 1DLOB 1X9JA 3B4MA 1RI7A 1QVGM 1NGFA 5D4LA 2XCPA 4A46A 4DV5J 4X4VA 5KRSA 3G6YA 4B3RJ 3U1NA 1NG9A 2CAJA 1Q82T 3IRWP 2N7YA 3N28A 1FJGJ 4I2PA 2MSTA 4JI3F 1ELOA 4ZHRB 4DSJA 3UDVA 4NXMK 4KHRA 3PYDA 3NFAA 3QNNA 2CQ2A 4X4PA 4IBNA 2IIHA 3OL6A 1XWLA 5F9NA 1VSEA 1NBWA 2LP4A 2XCAA 5KFTA 2VPWB 1RHMB 3ZZYA 5DZ6A 2VQEF 4LJMA 2EWSA 4F25A 5KFGA 2YX6A 4ILHA 2P9KA 2CDQA 2MZTA 3TZWA 4CE9A 2Z1IA 4EO8A 5HRRA 2Q1LA 3AJ2A 2W40A 4WFXA 4KHNA 5H9FK 1GAOA 2HVEA 2W9AA 4JI8F 3CJ3A 5KFOA 2M5YA 3KKRA 4OO1J 5C24B 2C2MB 3TUJC 2OIHA 2F8HA 1S1WB 2DVIA 5KT2A 2JWNA 1SJ3P 2IVFB 4CESA 2QI2A 4MKAA 4GNIA 2OPSB 4A47A 4M8LA 3AOAA 4CO0A 3PW5A 4O3QA 3KZBA 1XNRJ 3AY9A 1S9FA 3N4PA 2ROEA 1NJIO 4JI1F 1JWWA 2ZOFA 4RWWA 4YOVA 4JI4K 3CC2S 4FF4A 5EVZA 3BY5A 1IBLK 4M5KA 3UIQA 1HYSA 5I3UA 4AF1A 3R6LB 2MKIA 1BISA 1IBMF 4CK1A 1FD2A 2YNFA 2ZKTA 2PFFB 3T1YJ 2RF2B 2DXFA 4RUAA 5KG0A 4BC5A 2Y0BB 3MFHA 2QA2A 2CH6A 5BN9A 1VQNS 5HI7A 4V19S 1D1UA 3MCOA 4RBTA 3GMGA 1J5EF 1YBUA 2W01A 4YUDA 1B0VA 1VFJA 3CCSN 2Q79A 3V1OA 5KFQA 4LF4F 3PY8A 1OY9A 3L4BC 1UEUA 1RWVB 2KN4A 4B3OA 3A2FA 3QFWA 2ZJRQ 2L9NA 4WK3A 4YHHK 4AHSA 4OV6A 2DNYA 5DDRC 1NJZA 3DXKB 3KLHB 3OTOJ 4ICLA 1VK3A 1Q7YO 2CG8A 1KQFB 3DXBA 3OYBA 1JK9B 4UT4A 4M3WA 2XMWA 1N6QA 4OGCA 2GTDA 1OY8A 3D68A 4FNIA 1VS3A 3HSCA 2LQJA 1VQKS 2XLJA 5C2GA 1WSJA 3PDNA 2HLTA 1TUGB 2HNZB 3R5AA 2K7KA 2EWHA 1CSJA 1HNWJ 1RBAA 4L76A 4H54A 4DU7A 4QPXA 1SKSA 3QICA 2R7VA 3HZ6A 4OMFG 3AVLA 4CF0A 1T7PA 4MKVA 3J8AA 5KQDA 2XG8A 3WQTA 3J80Y 1Q81O 1AROP 1VC0A 2X3GA 4CJSA 2XYPB 4KHQA 4CCHA 1OPZA 1VISA 3W0LA 4BDZA 2DNKA 3QJPA 4AXIA 3D45A 3HHDA 5DS7A 3G6XA 2F65A 3BR9A 4A8QA 1F9EB 3TJ9A 4UY85 3SQGA 2MLZA 1HNZF 4EAHD 5KFKA 4ED6A 2C42A 4RNNA 3OSPA 1J9AA 3J7ZT 2EW9A 1TV6B 2GWKA 2MKSA 4RW7B 4CERA 3AVBA 1PAUB 4DTNA 4AHVA 2Z1GA 3DFEA 1LWCB 4EHTA 1RK8A 2J76E 3SZ2A 1X9SA 1SKRA 2RILA 4BBYA 1SUQA 3PHTA 4ZITA 1Y0HA 4B9TA 3O3LA 3NGSA 3Q23A 2F40A 3SPZA 5DLGA 2AX0A 1KTVA 2E7XA 2X1GA 4BR4A 2D3OR 3LDNA 1WACA 4WQ5C 4Z94A 1HR0K 1REGX 3MPDA 3MK6A 2GWJA 4EZ9A 3AOBA 3NCIA 4I0WA 4I4BA 1NZ8A 2EX3A 4DMZA 1MROA 3WEEB 4LF6K 3CJRA 3OYIA 2JL9A 1GOBA 3DC2A 1C0UB 5LL6Z 2E6MA 4C8YA 3V2UC 4FYYB 2EK6A 2E2PA 3L2UA 4E0DA 3MX2A 3D4JA 4OKEA 3GU0A 2HAIA 4NE9C 3FSYA 5LT5A 1T9UA 1SQEA 2Z58B 3CFPA 2VKZG 2VBZA 4PG5A 5JMVA 2X3DA 3FC9A 1J27A 3WIUA 3V6DA 2V8GA 4UOCA 5AFUH 3GIIA 3LGNA 4FK2A 4AQYK 1RADB 3DI6B 1SXLA 2HFUA 1ZAWA 1RT5B 5CYMA 4OI1A 5L8RC 2ZC4A 1KAYA 4NL5A 3MGJA 4DXLA 1HWLA 1MN7A 4AHTA 4O23A 1H38A 3IBFB 4ES1A 4H8KA 3THYB 2KO1A 4LF5F 4LBHA 4CT9A 5CHCB 2C2KB 3JTNA 2HURA 2GGPB 4YMEA 5DETA 1PGZA 1K0VA 4KB1A 3C65A 1C1CB 1RBSA 3W9JA 4ZCLA 4DF8A 4ZHRA 2UXBJ 2A0FB 3M8PB 1R7IA 1SJQA 2R2SA 4OZ3A 2QWOA 2HVZA 2KFZA 3BO4A 4ISFA 3FVYA 4OLAA 2DNPA 2E29A 3FEXB 3OTBA 2ZBRA 1K44A 3HJFA 3U7JA 1WC3A 1L3UA 1KVBA 5HK4A 4WP9A 3DDKA 4ANCA 3VENA 1KOOA 6FD1A 3THXB 4LH5A 1DKGD 3FZ2A 2QN6B 2EFNA 5AQMA 2ZDPA 1LEOA 3M2UB 2B4JA 3KG0A 2C2NA 5C24A 2YWGA 4AXJA 4JV1A 4FWQA 1S1WA 4IRDA 2V34A 2WSFC 4CGIA 2VODA 2OPSA 1T94A 2Z57B 4CNZA 2BZ2A 1MU2B 1YJ9S 4CIFA 3EX7B 2FUG9 1LNQA 1KQGB 1QHAA 1UEVA 1LXJA 3UKUB 5IC6B 3US5A 2W6LA 1P9YA 3Q2TC 3R7BB 1HD1A 3W64A 3MMCB 1KXPA 4JI3J 2D3ZA 3CJSA 1RUSA 3T1HK 3EVMA 3VQ9A 4WE1B 2RF2A 1U2FA 3KHHA 5AE3A 3OFGA 3RVCA 2AV5A 2NUHA 3ISND 5DM7L 4DTRA 2VQEJ 5KPZA 2HS4A 2HG4A 3MN6A 1RU2A 2R9LA 3Q8PB 1HJOA 4KHPF 2HGMA 1M0SA 3KLIB 3O9UA 2ZH2A 4OHWA 1IWGA 5BREA 3RB6A 3ADAC 1WC4A 1T6CA 2D5RA 1N4LA 1RDAA 4JI8J 1HPMA 5E84A 5L9XA 1W2BM 1TMJA 4FK0A 1YRTA 4DV0J 1TL5A 3E9LA 4I68A 1WOPA 1MNEA 3DXKA 4CFBA 3KLHA 2HOEA 1VBXA 2KB2A 4QIWD 2CPEA 3D7EO 4JI1J 4O0NA 2KYZA 2ZHOA 2FJXA 3BB5A 1YRXA 3D0HE 1SC6A 3LGMA 3IGNA 3PRVA 5ETRA 4ZP6A 5A2QY 1Q8LA 1K1SA 3MAAB 3GONA 2NXUA 1IBMJ 4H03B 5HRNA 1KVCA 1FWLA 5KFNA 4GV9A 4K5RA 5FDLB 4TKTA 4AUKA 3B8AX 4TYAA 1Z4UA 1B4SA 3OYLA 4GKKK 2X1BA 4N7TA 1J5EJ 4WTOB 4NYPA 4OPKA 3WT0A 4DV1J 2FHKA 1FVSA 4NLYA 2H3GX 4FW2A 2YX7A 4ITSA 1ZBFA 3SK3A 4BG8A 4LF4J 4USWA 2CQ3A 5FPDA 2R7SA 2OI2A 4FVCA 3UN5A 1ZBSA 4DTJA 3AQOA 2FSKA 4ZDNA 1AZSA 2GNKA 1UPMB 2B43A 3FZHA 3DLKB 2KJWA 1D0EA 4DUZK 1FK9B 1SL0A 2ROGA 1ZTWA 2YKQA 2ZD1B 1JJCB 3O9QA 5KI6A 2GBZA 4QR2A 1Y9OA 2HBYB 5AQYA 4RW7A 4RNHA 2BKNA 1ZS6A 1NGHA 4PXEA 2AEFA 1S6UA 3H20A 1WI8A 1EIYB 2QWQA 1C1BB 2KM8B 1ZBHA 2NSBA 1LWCA 2Z2ZA 4KHWA 4DV6F 1W9HA 4GO7X 3IWXA 1FW6A 4Z7CA 1PBAA 3UPFA 4PL7A 1VRTB 2V5HG 3H90A 3VZIA 5C2FA 4LRCA 3OVBA 2CNNB 4FYWB 2PIIA 4PPZA 3VTHA 3LA0A 1QDUB 2BJ7A 5AJ3J 3HLUA 1U0HB 3OHBA 1EKEA 3KG1A 1MWYA 3WEEA 4TU8A 2MQOA 1IM6A 4CGJA 4BR7A 2CH5A 4CEOA 1PBUA 2P1JA 4WQ4A 1C0UA 1YI2S 4C97A 3NGIA 4ENOA 3NMUA 3BF3A 1C0TB 2VJVA 2V50A 2QL7B 3R5CA 2W2OP 2B51A 4WBFA 4DQRA 4F4ZA 5F41A 1S6OA 3BSAA 2GJFA 2A10A 4HVZA 4CO3A 3CIZA 3RMAA 4F3OA 3JS6A 3V9XA 1VDHA 3HKZD 4MIBA 4JI6F 1RT5A 5F8JA 1CQMA 1YRUA 3BDEA 4J5OA 4CHYA 3THYA 3PX4A 2HRYA 2OUGA 2QGFB 1S59A 2GGPA 4FJ9A 4ZP7A 4DSEA 3EPIA 1VSKA 2CJAA 1C1CA 1N5TA 4L74A 3SSQA 3O1WA 2P9CA 2P9SB 2DPNA 2JVRA 5T14A 2O5DA 3ZT0A 1M5VC 4CYUB 3S3MA 2B9YA 2DGUA 3P38A 3IBWA 1S99A 2HS3A 4C8KA 1XMOK 3JS9A 3PR5B 4O0IA 4NCAA 4NYFA 3NP5A 1CC7A 2MQPA 2E66A 3F9KA 1YIJN 1UOCA 1D09B 4K8XA 4P10A 5KPRA 3L3VA 1N88A 4UUXA 2WCXA 2ZJPL 3THXA 2GC8A 4EWTA 3CCLN 2UVWA 2IOCA 1D4XA 3DNCA 2OPQB 2CQ0A 1HHSA 3DMJA 3PO5A 2BX6A 4CJRA 3CCWA 3RG6A 5CR4A 3CUNA 3R1HA 2IHR1 5IOLA 2R8GA 3TVZA 1MU2A 3JQMA 4K4XA 4DV5K 3DLGB 5C0YA 3MPWA 3OR2B 1HI0P 4WU2A 4K4TA 2E5LF 1VSLA 3PRDA 3A5MC 1CC8A 3L2VA 2G8KA 1Q78A 4J2EA 4CO5A 3MMCA 1N33J 4DTOA 3HP9A 3I0SB 3CNQP 1FKAF 1UVJA 4N41A 4UQGA 3MR3A 4WE1A 3TWZA 2PYJA 1PYOB 4NLUA 4YEAA 3ZSZA 2FJWA 3UR3C 1FE4A 3NAHA 4ECQA 3AOCA 2W6KA 3AVGA 1G2EA 3CMQA 2GHPA 3H59A 1YITS 4LFAF 3OTCA 4QPTA 1JLAB 2B7CB 1WEXA 1NM1A 5BR8J 2DNGA 4IOCQ 3KLIA 2AP6A 3NF9A 3AVMA 4QS8A 1HNVB 3GE1A 4CZHA 4KHYA 4NLQA 2WVBA 1JB0C 3GR1A 4IRCA 4F4WA 1M1KT 1NB2A 3W60A 3OA9A 2IVMA 3UVJB 3QAEA 2B6AB 4X84A 3AVCA 3TARA 1I3AA 4MYUA 1NSPA 5IV3A 3G96A 2C1EB 1OSDA 1E6VA 4FBTA 2MY8A 1CLQA 4YDUC 1RDCA 3V1QA 4UUWA 4NXNK 5I3QA 2YNHB 2VCPA 3D1QA 3UN3A 1I94F 2G8FA 1UEKA 3Q7CA 5KG6A 3P83D 4YOYA 3PSIA 2O4IA 2OPRB 2Q6BA 3BGFA 2B8QA 4H5TA 3C6TB 4V19X 1KN6A 5LSOA 2ZZNA 1V3ZA 4LFCF 4CJPA 2BQRA 3T5HA 4W5TA 3MAAA 1N5YB 2YV0X 2LECA 5IXUA 4I69A 4H5RA 3M2VB 2VBYA 2F8MA 5FDLA 2OA8A 4E1MA 3GDQA 4CF2A 4E3SA 1QUPA 3FUYA 1YVUA 3K7RA 2J7UA 5F8NA 3D3BJ 4MMOA 2J4RA 3GWCA 4K0KF 1PIEA 3VAKA 4B1VA 1HMVB 3ETMA 1HKCA 1FKOB 4URGA 3FKBA 2K7JA 4LVNP 3IBCB 3ENHA 3VCDA 3HD2A 2NRHA 1G15A 3DLKA 1FXRA 1FK9A 1QM9A 2AD9A 1IVZA 1LW2B 3KJQB 1WG4A 2MSSA 4DV7K 1XMQK 3VGKA 5GADU 1HJRA 1F1BB 5A8WB 2VA2A 2QK9A 4YOTA 3CXCR 3H8YA 2KT2A 1FEEA 2VC0A 1RAGB 2QG9B 1R0AB 5GADI 1C1BA 3QT8A 1WNSA 2VG7B 4OLOA 2HBMA 2YCHA 2HQIA 4JN4A 3N5BA 1KEKA 5F0WA 3PV8A 3AAQA 3DLRA 3NGKA 1VRTA 4OPJA 4H4MB 4HHHA 2XI2A 3NMRA 1UETA 3VQ7A 4J9RA 1VLYA 2ZF5O 4PA1A 3O4WA 3TZZA 1WUAA 5KG2A 1QVFR 1U0HA 1ZBIA 3VAJA 2VD3A 4M5NA 5AQVA 4ED7A 1UVKA 1FJ7A 4JYAJ 4CHPA 1RAHB 4ECRA 4DR3F 4HWIA 2RAQA 5H9EJ 1RBVA 3M7VA 3C94A 1VAZA 3EMTA 1ICEB 4NEYA 1PYSB 4AE5A 2LXIA 3CCVN 2BRLA 4ZPVR 2IVNA 1BWEA 3VQCA 4IFEA 4EIAA 4NCBA 2LCWA 3VA3A 5T41A 2HPUA 3S8SA 3C2PA 3I6PA 1Q82O 3EGNA 2QFJA 4FM1A 4IDKB 1VQ9N 4ZVHA 4B9VA 4R0JA 4P2FA 5AQLA 4X4NA 4BS2A 2MKHA 2BM1A 2IMWP 3OVAA 5JJBA 5A8KB 1TU0B 1RTIA 4DG1B 2PSZA 5F8HA 1RHQB 2MHNA 3L2WA 3MPUB 5BPNA 4KPCA 3ELHA 4HCBA 3PNIA 1ULRA 1ASWA 4A62A 1G99A 4KH5A 1Q18A 4DJBA 3LDOA 2CWKA 1SIWB 1NDKA 8ATCB 2O1PA 4FZVA 3I8BA 3MHYA 1LK5A 1GMVA 3U02A 3KNAA 3FJ2A 3LDSA 4M3XA 2P9SA 3QRQA 3TVKA 4O0JA 4CYUA 1SAZA 3B54A 4IFVB 5LJVA 2VPXB 3QQCD 4B17A 4D3GA 2JSXA 2F9TA 3P1GA 5IWAK 2DPIA 2CJXB 3TA0A 5B8HA 1KQKA 4JK9A 3WC2A 5J2NB 4O4GB 2XB2D 1A5WA 4M1KA 3H2LA 2D69A 4ZCKA 5F1XA 5HQMA 4MYTA 1U6FA 3CC7N 4DV2K 3AHPA 3BBBA 2OPQA 1WSGA 3TANA 2MLXA 2WW8A 1C0MA 2KU7A 4CQ1A 4JI6J 1OYDA 4NASA 2QMWA 3EZOA 4DTXA 1SL2A 1J5OB 3PRBA 4ZJOA 3QERA 2G1DA 3CCUN 4RUCA 3NBPA 4P71A 1ZPVA 4JI5F 2ZJRL 5KFZA 3DLGA 5HL7Q 2EKYA 2FD2A 3OR2A 5BN8A 1RACB 2J7KA 3LOUA 4B3TJ 3PHEA 3H5UA 1CPZA 2W41A 2GA7A 5AQRA 3AXMA 4PABA 2UXBK 2GEMA 2LMIA 3NNAA 3I0SA 2NZCA 2BJ3A 1XNQF 4X62F 3RBDA 3DXSX 4LRDA 1ZC6A 3IAM9 3W66A 5JS1A 4FJJA 1RWOB 4L8RB 2J6UA 1FDBA 1NGBA 1BUPA 1GOAA 1TAQA 3CFOA 3O8MA 1TUYA 1JLAA 2WVDA 3DLBA 3GLJA 4JLHA 2Y8YA 1OKJA 2XWXA 2FJAB 3MPVA 4CEAA 2UXDF 1HNVA 5ELZA 3UW1A 2YNIA 3E1YA 3LWLA 4C7QA 3EJMA 3C16B 2N7CA 1ZM9A 4LF7J 5FLXU 2QZ8A 3D6TB 2B6AA 3ZETB 5B0DA 3HHLB 5B0BA 2DFEA 1QLNA 2I9SA 5KFPA 5LJ3Y 2IM1A 4ZIWA 2WC9A 3A8YA 4DLGA 1IQTA 3P45B 4OPAA 2O8BB 4E8UA 3HFVA 2E5LJ 4PQAA 4OYOA 2N3OA 3LGHA 2OPRA 4C8OA 1NK6A 1Q1KA 3C6TA 2ZHAA 2W4PA 4E98A 4JI3K 2DGQA 5KGWA 3SAHA 2NRRA 1D9FA 5KFXA 4GV6A 4RU2A 1N5YA 1MDUB 4IWVA 3ITHB 3AD9C 3W62A 5D4PA 2EFVA 2PI4A 3CMAN 5M1PA 2DGWA 1S4EA 1PJ5A 2D0PA 2GVDB 3J7ZO 1VIXA 2FY8A 4LC9B 2VQEK 2CPYA 2YVSA 4DR4F 3ULHA 1QQCA 1V5IB 3EGWB 2KHOA 3A3OB 3BS9A 4CGDA 1K9MT 5J2QB 1Z2LA 2XY7A 3N6LA 3ZLJA 4LUBA 3O44A 1KHVA 1HMVA 1FKOA 1VQLS 4FPAA 2IBOA 4TN2A 5MAOA 4EZ6A 4OHYA 1Z25A 3I0RB 2WUSA 3T69A 1VK8A 5B0FA 1MMDA 5E3CA 4HUEA 4J90A 1F60B 3IXQA 4YB7A 3VQ5A 2LQ9A 3OLBA 1T03B 4XPCA 2RUGA 4OYPA 2WAQD 1RILA 4XH4A 2V9KA 2HIYA 1CULB 3DXMB 3SDEB 5A8WA 1I94J 2AZ1A 5AQOA 1R0AA 2VG7A 5D6GA 1V9OA 2B4PA 5HROB 1P1LA 3CCQN 1IBMK 5LOQA 3SCKE 2EFQA 4ZTJA 1RZMA 4FJ8A 3G4SN 4EO6A 2FB0A 3DRXA 3EE8A 2XYGB 3KMSA 3PUFA 1S22A 4LIRA 5DMRA 4ZLNA 2EVZA 2GV1A 4JKCA 1YJWS 1S57A 1J5EK 4GVLA 1N5VA 1QQNA 2ZOMA 3X3UA 1EX8A 3MN7A 3SQ0A 4C8ZA 3TX0A 5D0GA 4EK2A 4LF4K 4CLWA 4CK3A 5B0AA 3M6WA 4ISGA 2MEWA 3OXFA 2ZM6F 4FP9A 3J80O 3KNGA 2AJFE 3N5FA 3DAWA 3HFZB 2NYHA 3I96A 2QWMA 4ECYA 4CHOA 3LPUA 2VFUA 3VF6A 3R5DA 6FDRA 4IDKA 1FE0A 1OQ3A 3LO3A 3KJVA 5B08A 1QE1B 4AL6A 4A59A 1Q95G 2FZCB 2W42A 2N3LA 3KLVA 5A8KA 3OBWA 1Y4ZB 4DG1A 2E1YA 1HWKA 2V4JB 2HHQA 5ITHA 4OZJA 1OVQA 1FRJA 1BC6A 1BQXA 2XQCA 2OFHX 4UZCA 3OHRA 2CQ1A 2D3UA 4J9LA 2I7PA 4CVNE 1JIHA 1Z6RA 2HHPA 4BLGA 4NMLA 2QYGA 2BJ8A 3K5PA 4LRAA 4DUYJ 2GIRA 3N4WA 1VQ8S 1A9NB 1B9DA 1BWVA 7AT1B 3HX9A 1BU6O 2H3EB 2HS0A 1URRA 4ZVQB 4C0OC 2NREA 1NNEA 3C46A 4IFVA 3TQ1A 3ALYA 4CJLA 1UWBB 4OJ3A 3N0VA 4CJFA 5AXNA 2B9EA 3E2EA 4UF4A 2VQFF 1T11A 2VICA 4JS4A 3VQSA 1HNZK 5J2NA 4DSKA 2PYLA 1VQ5N 3FNNA 3PZPA 2HQCA 1FNMA 3N6NA 2W7PA 5AQNA 3M8QB 2UUWA 3KUGA 3MOJB 2M2BA 1IBLF 3FBFA 1N36J 1RBUA 4JD2B 8RUCA 3G82B 2AU0A 1GMWA 5KGXA 3WUHA 2FSJA 1CG2A 4HDGA 5AQGA 1C0GA 1J5OA 4OHXA 3GFXA 1WEZA 4HEA9 3EDRB 1XIQA 3FZFA 4W4MA 5F2RA 3R5BA 3QO9A 2VUGA 4Q44A 5IQQA 1U47A 2W1BA 7FD1A 2XY5A 4X66F 3RRKA 2NPFA 4CWBA 3ENOA 1SV5B 4MIAA 2BJ9A 2QA4G 4RL1A 4USKA 4NLXA 5ETTA 4WU3A 1NBEB 2C28A 1RTDB 4OX9J 1S72N 2J5AA 1RT7B 2KJVA 4G3IA 2CFXA 2WW4A 1PJ6A 3R6GB 3R9LA 2O01C 2PGCA 1NK0A 2BW2A 3ZZUA 4OKKA 3LUYA 2CQCA 4RW6B 2RB7A 3L7OA 4IOAQ 2P9EA 4PEOA 2MPUA 1YUWA 4ZP8A 3G87A 3V81B 1WC1A 2LA6A 3RW7A 3NXZA 1BMQB 4IFYB 4QWCA 3JTPA 3H42A 4PPDA 4DU4A 5FROA 2QO3A 3C16A 1OSCA 1T9YA 4HR2A 1J2VA 2ZVSA 2D1CA 2C2RA 3NEKA 1S6QB 3HHLA 1GMWD 4O3OA 1HYVA 3NDKA 2MQLA 2XC9A 4L3NA 3NL0A 2A3JA 1JCEA 3VEVA 1XR7A 4LF5K 3AQPA 3IGVA 1IBKK 2MZ1A 4E7HA 2Y9HA 2O8BA 5IT0A 3THWB 4Y00A 4NLCA 4CZGA 3CF5L 1RGVA 1RCHA 2JOQA 3MM6B 5HMYA 1QS4A 2WB1D 3HM8A 3TABA 1AT1B 3ITHA 4XDDA 3ETOA 2E5HA 1XNQJ 1U25A 4X62J 1YHQN 2PEHA 1CJUB 3M1VB 3BZCA 5CZVA 2ZQBA 3OYMA 2YXLA 3ZEUB 5DM6Q 3W7BA 5CYJA 4ED0A 2GVDA 4LMZA 4F3TA 1ZM4A 4IO1A 2G8IA 4WFBQ 3OYKA 3SQ2A 1BI4B 3AVKA 4BE0A 2R2TA 5HJYA 1EJ7L 4J9VA 5F3ZA 2LVWA 5JLFA 2EI5A 2UXDJ 3D66A 1DQAA 2ASJA 1VSHA 3H40A 3P5TL 1RHKB 3TU5A 4C23A 3U3YA 3I0RA 2R8HA 4K8ZA 2AQ4A 1DQ8A 1RWKB 2XS7A 5C2DA 4DFPA 1NXIA 1T03A 1XTZA 1P9QC 4CD1A 2FJVA 1T0TV 1GLLO 3C66A 1V4TA 3GL1A 3HHLD 2EHGA 2X74A 3DXMA 3WNFA 3WNHA 4ED2A 3GP9A 3SDEA 1S7IA 5ETVA 3A8JA 3PIPQ 1WD6A 3VALA 1SQGA 1J53A 1DGKN 1W0HA 3DRSB 2IIRA 2KT5A 4KB0A 5HROA 1KRPA 4LF6F 5A2QU 3IRXB 1F9HA 4KIAA 2UXCF 1NSQA 1NJXA 2ADCA 2A6MA 3D7SB 3HRGA 4JK7A 4L75A 5J1NA 2F63A 1NK7A 5A2QO 3AD7C 1UL3A 2QLBB 4NYZA 4DR4J 2HVHA 4JV2A 5DDPC 2NRZA 2O8DB 3I56N 1LW0B 3F73A 3AO3A 4KHPK 1VQON 2CPXA 3A4TA 4GY2B 2FTRA 4YB1P 3M6GA 2AWZA 1NU4A 3K58A 5LXYA 5D3GB 2QRRA 2QLJB 3PXGa 3S6EA 4WJBA 3M3ZA 3WHIA 3ZZTA 4BWJA 2UVRA 2XULA 2FY1A 3OLAA 1I6JA 1BA1A 1FCAA 2DNHA 5GADP 4JKAA 3KDOA 2GO9A 2UUTA 2IA0A 2A6AA 2CGLA 2C3MA 4DEZA 5KG5A 2RRAA 4NZ7A 1QE1A 3NOGA 1N8RT 2ZOGA 1XK8A 3NGDA 4QS7A 3E01B 4YR3A 3WXLA 3ZZ0A 2G0IA 2V4JA 1NKEA 2D9PA 1PC5A 1Q4RA 3H46O 4Y0FA 3MMBB 3H4BA 4BVPA 2IYGA 4BC4A 1YLXA 3CSKA 1TKXB 3UNYA 2BH1A 1OVYA 4DSLA 3FQKA 4CW7B 1CXUA 2QFIA 3FBBA 2HHUA 1XERA 5TKYA 2MZQA 3VF2A 5EOYA 2PDAA 2HSEB 1JL1A 3RRHA 4DTPA 4KE5A 3LQVA 3IMQJ 5K5MA 3T9ZA 2ZM6J 4OIXA 2XBPA 4FLXA 3UD5A 1UWBA 7FDRA 3UB5A 2C2EA 1RAJA 1NK8A 4DQPA 3CD5A 1B0PA 1UVNA 3QYYA 2KTQA 3MXHP 5GAGI 4WIIA 2HK2A 4LY7A 2BA9A 3ZO7A 3MN9A 5A8RA 1GMUA 2L48A 4ILMA 5T7LB 1U1NA 1OH5A 4A8WA 3M8QA 3FMWA 1VR6A 3SIPB 3EKSA 4JD2A 4DV6K 3OXGA 2DFHA 3CCTA 4NXMJ 4I56A 1Y3KA 4DX5A 3AGRA 2GQ2A 4DQIA 3DOKB 2ZBQA 2WBRA 2P51A 1S49A 3R6MA 1VQ7S 4F4XA 2QKKA 2H1YA 4IQXA 4FJIA 5L1KA 1SV5A 3RB4A 3A3PB 3TAPA 1C4AA 2LKZA 1M1KO 4B8AB 2R7OA 2XSJB 2ZKUA 4F67A 4LR9A 4FLUA 3MEEB 4QYZK 1RT7A 3UN2A 4LBIA 5CA5A 4P7TA 4EUVA 3HYFA 1FXXA 4I67A 3LPEA 3TA1A 4ECXA 3O80A 3RSEB 4CJ3A 1L3TA 4Y28C 4ILGB 2O67A 3EZWA 4USVA 4XO0A 1JCFA 4NCGA 2VQFJ 4BCAA 4RW6A 1FX4A 2HQFA 1Q86T 4UZBA 1SH3A 3V81A 1GEHA 5KFEA 3HHNB 4JI4J 4E7JA 3KK3B 1VQ6N 4IFYA 3C0BA 4A5AA 2D0OA 2D3O1 5BYSA 1F21A 4QAGA 1V6HA 3OL7A 1IBLJ 4JI6K 3BSCA 3GFYA 3C6UA 4BRDA 2V51B 3OFFA 4DL6A 1WEYA 2KZZA 2H5EA 3MCNA 4USMA 2W9CB 4DR2F 3FZMA 2YWEA 1S6QA 1KTQA 4FJKA 2AHOB 1FRLA 3D6FB 4H0TB 1VMBA 2FC9A 2ALZA 5AQKA 1G1XA 5LMUF 5D4NA 5CABA 2QC3A 3BUZB 1ZBTA 1TFWA 3HSDA 3DLLQ 3GJQB 3CXCM 4KH6A 2MZSA 3MM6A 4U8VA 2QA4S 1TQLA 3I5AA 5A0YB 4DF4A 3ZX2A 2DYAA 5LM7E 2P5VA 4KRWA 4IOXA 5A6WA 2CUYA 1CJUA 3M1VA 3UWTA 4JBCA 3ZEUA 4J2BA 5AZJB 3WZ0A 5DDOC 4FOEA 2L41A 4ECUA 2IM0A 1BI4A 4DL5A 4NRTA 4B9QA 3AO1A 4A8OA 2VG5A 2I0XA 3HJVA 2Z2LA 3QMLA 3RR7A 4CJ4A 3TJAA 2BR0A 1QVFM 3Q7BA 5CQGA 3FZLA 4YOXA 2ZHBA 2DNQA 3OSNA 5HVFA 3OYAA 3AXKA 3QT6A 3CCZA 2E20A 3MD3A 4K59A 1B7FA 3VQDA 3M9OB 5KQ8A 4B3MK 4ZVFA 1R6YA 2QYCA 3SCIE 5KT6A 5BJRA 2FBYA 2CRLA 1CQNA 4S0MA 4JV0A 3PFOA 5AQPA 3GFZA 4DU1A 2CNOB 4H0YB 2A2DA 3ZSXA 2E5LK 1H72C 2VFVA 4ZKAA 1BO5O 4BRNA 2NZ4A 3QWPA 4EBDA 2CPHA 2WBNA 4H4KC 3IRXA 1T8EA 1H2TZ 2BBEA 3PYEA 4Y1CA 5HP1B 4CLPA 5C15A 3DDNA 1RAFB 2CNKB 4IR9A 1BD6A 3JSMA 3VESA 1VOMA 2U1AA 2IC3B 1YGYA 4LFAK 3M8RA 4M7YA 4WFNQ 3MUMP 4WQ5A 2O8DA 3KHRA 1LW0A 2R7RA 5AQQA 3PYGA 2HRTA 5HSPA 2M70A 5EY4A 1KDNA 3R7NB 3CJQA 3MM5A 1HYZA 5DO2A 2H65B 5D3GA 3V5RA 5LJ5Y 2Y1LB 4BG9A 3BGUA 1AYEA 1RP5A 4CD3A 1LFWA 2J0QD 2NNWA 4M95A 2R7XA 1FA0A 3HVAA 1HHTP 1BHLA 3CIMA 2KKZA 3GSIA 2NRWA 3CYMA 5E3AA 2BJEA 4FNHA 3G6EN 3GPAA 1JNRB 1GH8A 2N82B 4A5BA 5MLCQ 1D5AA 4D3HA 4BRCA 1Q8IA 2RS8A 4B1WB 2XWYA 2V8VA 3UDEA 1ILYA 1NMDA 2XLIA 3J7YU 4Q5VA 3RAMA 3CM6A 3PM9A 4K25A 3CMES 1QTMA 5JICA 3E01A 2O8EB 4LFCK 1W2BR 4LF6J 3VZHA 2X6SA 4ALZA 3F41A 3SUPA 2E6LA 3NY0A 3MMBA 3MWBA 2ZH9A 4DR1F 4WFAQ 4CZIA 4NZ6A 4ZPCA 2ZBIA 1TKXA 3UCUP 3C95A 1IM4A 2EG2A 4K0KK 2P9GA 4WKYA 3CULA 3MDQA 3FR0A 3FBEA 4FKYA 5BRDA 3DOMB 4FYXB 4I6MB 5C7PA 1Y10A 5HL7L 1O5JA 1UZDA 4Y6IA 3KG4A 5B7WA 1X5SA 4AQYJ 1VYAA 4UOGA 2KKHA 1TYQB 4ZPWR 3HOSA 3PJ9A 3BGRB 1FWKA 3ZSWA 1T05B 1E6YB 4E2FB 2I6WA 2V8DA 2W8LA 3BJYA 3CCRS 4MK7A 3CJ2A 1IKWB 3JXOA 1U8WA 4FK4A 2IVPA 4BRGA 3PX0A 4QZVB 2VFTA 5T7LA 2JLGA 2M4MA 2Q1NA 3MXJA 3PJXA 4M5HA 3W8PA 4KPYA 1VRQC 1SPBP 4CHNA 4WFYA 4BRFA 3MWTA 3QBCA 2XMJA 3X1LB 2JC0A 4BR9A 2DNMA 4FZYA 3DOKA 3MM9A 1OY6A 2ASYA 1HNXK 3M2RB 3S41A 2V7ZA 2CQBA 4QW9A 2FF6A 3ID6A 2F8SA 4KI6A 4PWDB 4EYIB 4RUBA 3DRPB 3CQ8A 1RT6B 5DQIA 3LP1B 4J9PA 3CJAA 4NWBA 3SPYA 3RR8A 5IS2A 4CLYA 1HPZB 4XH1A 1S79A 4DR3K 3EE3A 2XSJA 3VQPA 3K0SA 4HH0A 1SJ4P 2PT0A 3MEEA 4Q0BB 2HVDA 3RZAA 4KB7A 3J81Y 1UJ4A 3QPIA 2J9DA 1XHZA 1Y11A 1IUJA 3RSEA 3CCVS 4RW8B 2EK1A 3ZZRA 3MEKA 3HVTB 4PWUA 5B0CA 4CGGA 5E33A 1O1WA 4DR5F 1GLJO 2J8AA 2AGPA 5KG4A 4DV3F 3NVMA 1VIOA 3VAHA 2GW8A 4HTIA 4CF1A 1LFPA 4PQUB 5D15A 4FDFA 3NMAA 1R43A 3ICLA 4E1JA 2KFYA 2MYFA 3KK3A 1RWWB 4R5PA 3PIOL 1VQ9S 3CCMN 3AV9A 9ATCB 3M9MB 2B8PA 3BGOP 3WX8A 4EP5A 3T1HJ 1QSYA 2YKOA 3LZIA 2NS1B 1S9EB 2W9CA 2PY5A 4DFJA 1K9MO 4CZKA 3UE5A 2PAVA 2MJUA 3THTA 4HI1A 2AW0A 2VASA 3EM1A 1RBOB 1N34F 1SQKA 2QKBA 2I1RA 1KOHA 4JI0K 4LF1A 1NH8A 5A0YA 3L2QA 2XMTA 1U24A 3RMDA 3HZEA 2FJDB 5D78A 1J54A 2FQQB 3EWGA 2HZCA 5AZJA 4X4TA 3T5LA 1H1VA 3T6BA 3ULDA 2AJ0A 2C3PA 4JAXA 1Y64A 3CJ1A 4DV7F 1XMQF 3ILIA 3MX5A 4WYBA 4CGHA 3W63A 2JFDA 2DB1A 2A1SA 2FVCA 3CJKB 3AT1B 3V1RA 4KI4A 2CJBA 4HH1A 1T3NA 3VQBA 5KFCA 5LMNF 1Q0NA 1U02A 5E3RA 2YNFB 1F5AA 1BA0A 2Z4PA 4GMKA 1XC3A 1VQPS 5J1PA 2VG6A 1HW9A 3EVWA 4JI5K 4HCCA 3VEOA 2V6AA 3JYTB 3KLGA 4FJ5A 4DN9A 5LMUJ 3SV3A 1OIAA 4GKKJ 2R8IA 3MXMA 2X78A 1BHNA 1QQMA 2BABA 4OX6A 4PXDA 2UUBF 3IM9A 4DOZA 1U1QA 2GMJA 2ZH3A 3CCJN 1YTYA 1HRHA 2DHAA 1XNQK 2AEMA 4X62K 2YTCA 3FZKA 2E1AA 5HP1A 1IG9A 4CH1A 5ADXH 1ZM3A 4N8NA 3BM7A 5CCLA 2IA6A 4FLTA 5AE2A 2IC3A 4QWEA 4Q2LA 2PC6A 4FCYA 2QJ3A 1N0UA 4PY5A 4CJ7A 1X3MA 2HLUA 4KRFA 1BUXA 2HFSA 5C5JA 4U6PA 1DARA 2R7YA 1DHMA 2E1ZA 4KY3A 5M1QA 5HN0A 2P9NA 3BF4A 2YQ3A 3DRRA 3WNEA 4ZVRB 2YQ1A 3KTQA 2BKOA 4K2JA 2DCUB 4RX6A 1ATSA 3THPA 3ILOA 2OAUA 1RLDA 4PCQA 3CJ8A 4O5FA 3MXIA 4GW6A 2J9CA 1C0FA 1Z26A 2Q66A 1RDWX 1VC5A 1FRHA 1B64A 2QA1A 3PR4A 4AD6A 4H5VA 3GR0A 1WHVA 5DQHA 4P73A 2H5JB 1KWMA 1NHVA 1B99A 4NLGA 1BQMB 1U8SA 4HHUA 1HWJA 3LPTA 1S5ZA 4FWRA 1FFWB 1C6VA 5KOXA 3GYXB 3CMAS 1S5JA 2UVUA 1R8PA 3P6YC 3HTVA 1UJ6A 4JKEA 2Z2MA 2O8FB 4ZS6A 4F7VA 2DR5A 2KW4A 2IFXA 4DR4K 2YJEA 3AA5X 3ZCMA 2IM2A 3CC2N 4M63C 4B9UA 3DOMA 1R8BA 4I6MA 2A1RA 4DV2F 1PO6A 1WKJA 2YWHA 2OH2A 3Q8UA 1FHTA 2AJ4A 3ZSQA 4DBQA 2R2RA 3AVFA 3R8EA 2HHSA 4ECVA 2AMCB 3BGRA 4FJXA 1T05A 1E6YA 1VQNN 1S6PB 2JLFA 4NPOA 5MLCV 1ZZNA 1K8KB 1KLMA 1CZBA 1S0MA 3CI5A 3H5YA 2G8VA 4K5SA 4K2XA 3H25A 4JI2F 3W1YC 2XMUA 2OEJA 1Y00A 2ZC3A 2OTLS 3VEZA 3MWPA 1PG5B 3K5OA 2FXUA 3IM8A 4ZCMA 3BO3A 2G8HA 1NLVA 1VHXA 2HHTA 5IT4A 4YR2A 3FLCO 3DU5A 2C2ZB 4KGMA 5KAKA 3JSYA 3PLAA 4NI2B 1ZOTA 3TAEA 3J81j 1JLEB 1WSEA 3M2RA 4DR1J 4Z4EA 4BR0A 4DTUA 4PWDA 3BBCA 1QAXA 4CDIA 1RISA 5L9NA 3DRPA 1RT6A 3QWUA 1K6YA 4A57A 3OHAA 1EQMA 5IM0A 1B3TA 1Z2ZA 4OGEA 4Q0BA 3KKSA 5CYMB 3C14B 3LPYA 1NWKA 1WC5A 3SCJE 1S48A 1RYSA 2HHWA 4RW8A 3ZT3A 3HVTA 2E9TA 1KKHA 4P2SA 2DHSA 4EGLA 1KAZA 4YOWA 4C1NI 4ECZA 4PQUA 5DM6L 1BE4A 2W8KA 2UZAA 3TUIC 4LBPA 3A13A 4RBUA 1S4FA 1X60A 4Z7YA 4WFBL 1R0BG 3HMJG 2MXYA 3V4IB 1LOTB 4J9KA 2OLWA 3NCPA 1S9EA 1RBLA 4MKYA 2DH8A 2GUIA 1IR2A 4CBXA 2QW9A 2MMYA 1Q9XA 2JVOA 5LSRA 3V9WA 3LP2A 4CIOA 4OI0A 3HSTB 3A5NC 1SCJB 2Q6CA 1U7LA 4I6WA 2GV9A 1WHWA 3BN4A 2UUAF 2P9LB 5FLXY 3MN5A 3PIPL 4QR0A 2HWTA 1NO8A 2W7AA 1YBTA 2IJRA 2ATQA 5LJWA 4ZLJA 2EBEA 2R8JA 2OMOA 3GG0A 2HBQB 4LR7A 3PACA 2PBDA 2VQFK 1AFJA 3F9MA 3VEXA 1L5UA 1CLFA 2F3JA 1LWEB 3L3CA 4FJHA 4NXNJ 2FLPA 1VQ5S 4PKHA 4YP3A 1NH7A 3CJKA 2PFUA 3EXYA 3HKWA 1HHQA 3W65A 1UKUA 1HBMB 3UDCA 2HWHA 4OHVA 1NK5A 2VFRA 4HACB 5LSLA 1BGXT 2FZKB 4CJEA 2F96A 1HKAA 4I2QB 2LDIA 1O13A 3JYTA 2LU2A 4LF2A 1S0OA 4BVOA 3CIPA 3FCWA 4X66K 2XZTB 4B1UB 1N34J 4AHCA 5J2MA 3T3FA 1TZ0A 3V6KA 3IP0A 4DR7F 4O5BA 2EKNA 5SUHA 4CBUA 4A2BA 5I4MA 3LP0A 2KXFA 1HI1A 4UOFA 1WN7A 4NO7A 4FF3A 1X5PA 3HPGA 4MLEA 3PJWA 1ZETA 2QXLA 4GVBA 2LA4A 2DFFA 4DR6K 3AB2B 4KQZA 5M2UA 1SI9A 1X4AA 3VPZA 4DV7J 1XMQJ 3VQ6A 1EARA 1N8RO 4WIQA 5D4OA 1XUPO 4AILC 3HULA 1K8AT 5HRSA 2OKQA 1KFSA 1WORA 3PEJA 3QGGA 2R3VA 3RTVA 1J6ZA 2FYXA 5LMNJ 4B9NA 3IWLA 4LF8F 4CO4A 3CDEA 3MAHA 3QIOA 2R7QA 5BPLA 4C0HA 2ZZTA 1GT8A 3OYCA 4EHUA 1QZ5A 2CPFA 1FEHA 4Z4FA 3M4XA 3A8IA 1NSAA 3OL9A 4C6AA 1UW9A 3SYZA 2A40A 3T6JA 2W2NP 2XI3A 3I82A 1UFWA 3OW2R 2KM8C 2DNNA 4QOZB 4DL7A 2UUBJ 1BQMA 3CD7A 5E3QA 5KFUA 1Q16B 5J2PB 4UY8T 1N5QA 3D6MB 2YNGA 1NPRA 3AVJA 3BKFA 2KRBA 4YY3F 1FTCA 5DGAA 1AZSB 2HHVA 3WIVA 1KQSM 4Y65A 4H4OA 1NRKA 1YHQS 2F9DA 5JVHQ 2O8FA 3BSOA 3PW2A 1ZYQA 5C25B 2MKJA 1SB6A 4CZJA 1LAWA 4ERDA 2ZH8A 4J9NA 3KK7A 2CVIA 5AQIA 3CDUA 1IJEB 1WSVA 1Q79A 1F5BA 2XNRA 1TK8A 3TRGA 4NZ0A 4DKWA 4M3UA 4OJHA 2E1PA 3B6OA 5EUHA 1GX5A 1S6PA 4I6YA 4PUOA 1FRXA 1K8KA 1OPIA 4FJMA 4ZJLA 4A8FA 3WC0A 5DRKA 3HPHA 2P5OA 4FZZA 3HK2A 2F9WA 2X1FA 3KXDA 5SZTA 4XDCA 2DIVA 1YVNA 2V68A 1X9MA 3U9DA 3K2YA 4PG7A 1MG7A 2NXEA 3J7YP 1HQ2A 1RHUB 1N32F 3K9JA 2ZWOA 1NMNA 2UXCK 4O8KA 2QSWA 1O51A 4HTUA 4NI2A 3KKFA 1BIZA 1JLEA 5HMWA 3O5TB 3I9ZA 5M1FA 5KFFA 1Q86O 5C42B 1NUEA 5IWAJ 2OPPB 3NKYA 2VIHA 2V94A 2BOAA 2DT9A 2HGLA 1U1KA 2BEFA 4EI2A 1DFDA 1M5KC 2RE2A 3QZ7A 2RNEA 2XGPA 2P2CB 3SJJA 4CH0S 3AVHA 4DHYA 3OS2A 5B09A 4DV2J 3LANA 2DRAA 3UD3P 3C14A 4Z0UA 4CEBA 3DLLL 2QM1A 3Q8VA 2O8CB 4PKDB 4A4JA 2BE7D 5F8IA 4ZVOB 5ETPA 4HT5A 3RWUA 3SMSA 1IBKF 4DCJB 3MD1A 3UFCX 2A2CA 2K8GA 4DL0C 2IYIA 2UU9F 2KH9A 4X64K 2GELA 5AT1B 3V4IA 3MR7A 3Q89A 4OI2A 4X4QA 1X8DA 3BZQA 4JKDA 2Q3PA 2V4RA 1VSMA 3HVWA 3D54A 1UAXA 1U6BA 1IKXB 1WHXA 3KK2B 4G1IA 4NOHA 3OS1A 1YK9A 3RGIA 2IMOA 4CK2A 4GO5X 4B3SF 4CT8A 4I64A 2ATCB 3IMXA 2P9LA 4ID5B 1YJVA 2BDPA 1XQIA 4IKFA 3DMJB 3CFRA 1LOUA 3U1MA 3QFHA 1WOQA 3IFEA 4LSLA 3M05A 4DX6A 3SI6A 1EO1A 3KLFB 1HL6A 1M1GA 2PN6A 4BDPA 1OYEA 5KFLA 3Q8RB 3K8VA 1NJYA 1KNZA 2ZWPA 1LWEA 3R7SB 2JDJA 1KHWA 3NS7B 4FLVA 3QESA 3VGTA 4YB6A 2NRXA 4HTLA 3R5JB 1DTTB 3O9RA 1YSJA 3HI0A 2XMKA 4WFNL 2AT1B 2XHWA 1NEEA 3P3DA 1YI2N 2BKPA 1X5OA 1HBMA 2KDOA 4HACA 1TUUA 2AJQA 2DITA 1T9XA 3UNGC 2HAFA 4DL2A 4O3PA 1T3VA 2DGSA 5CZXA 4I2QA 1X3NA 2KT3A 4H0VB 1WWHA 1BDGA 1YT3A 4U7BA 4X4UA 1W2IA 2I5JA 3QSYB 3I33A 3T1AA 4I6AA 4A61A 2QE5A 4FM0A 2QLXA 1WTBA 1PSDA 3HVRA 2F7VA 3TW0A 3SSSA 5L1LA 4ZPDA 3G71S 4OYXA 4LF9F 4WPAA 1LWXA 4F4YA 1JLBB 2FZGB 1PYTA 1E6VB 3H5SA 3P5JA 4H0XB 5DJBA 3LH2S 4I9QA 5CXTA 3DLHA 3Q83A 3BZKA 3Q22A 3V6JA 1Z1ZA 1DBDA 4CJKA 2XMAA 2CGJA 4KH1B 3CETA 3K2PA 5AQJA 2IDOA 1ATRA 4M94A 1D9DA 1D8YA 4DR2K 3BBFA 2BE2B 2E44A 4IXCA 2M8HA 2Z30B 3W9IA 4CP5A 2QX0A 1RWMB 3W5ZA 2IS3A 5LMUK 2DGXA 3BH6B 3I4HX 5HOOA 1PC4A 2KI2A 1KLNA 2JEJA 4HVJA 4JNEA 1JXLA 3VF0B 2VHGA 4DR7J 3EPGA 3CJBA 5J2PA 1M5PC 2RMLA 4XAKA 4YB5A 3GOIA 5KG1A 4E7LA 1YJTA 4ZPBA 1NGAA 2XO6A 3NGUA 4LSNB 4DFKA 4FSVA 3IDHA 4MJKA 3QEXA 3R1LA 1KVJA 3U9ZA 2ASPA 5C25A 1RDDA 4IYQA 1GXUA 1IXKA 4L3KA 4B3RF 3D6RA 3CQXA 5D8HB 2UUCK 3DU6A 4CNYA 5DG7A 1A5XA 1FD8A 2WVFA 3ENAA 1U2CA 2WBMA 4LF8J 2E2QA 4XH5A 1YITN 3BQ2A 2HRUA 3CD6N 3FE1A 3H2VE 3OD2A 1UVMA 1HQUA 3B4DA 4FKXA 2ERRA 4ED4A