1HQFA

Crystal structure of the binuclear manganese metalloenzyme arginase complexed with n-hydroxy-l-arginine
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
314
structure length
314
Chain Sequence
KPIEIIGAPFSKGQPRGGVEKGPAALRKAGLVEKLKETEYNVRDHGDLAFVDVPNDSPFQIVKNPRSVGKANEQLAAVVAETQKNGTISVVLGGDHSMAIGSISGHARVHPDLCVIWVDAHTDINTPLTTSSGNLHGQPVAFLLKELKGKFPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYIIKTLGIKYFSMTEVDKLGIGKVMEETFSYLLGRKKRPIHLSFDVDGLDPVFTPATGTPVVGGLSYREGLYITEEIYKTGLLSGLDIMEVNPTLGKTPEEVTRTVNTAVALTLSCFGTKREGNHKPETDYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ARGINASE 1
publication title Mechanistic and metabolic inferences from the binding of substrate analogues and products to arginase.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Hydrolase
total genus 106
structure length 314
sequence length 314
chains with identical sequence B, C
ec nomenclature ec 3.5.3.1: Arginase.
pdb deposition date 2000-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00491 Arginase Arginase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.800.10 Alpha Beta 3-Layer(aba) Sandwich Arginase; Chain A Ureohydrolase domain 1hqfA00
4HWWA 1ZPGA 4RHQA 3NIQA 3GN0A 1WOHA 1WOGA 4IE3A 4Q42A 4RHIA 5HJAA 4GWDA 3SKKA 4CEVA 1R1OA 4Q3QA 4RLAA 4IU4A 2RLAA 3E9BA 2EIVA 2PHAA 3RLAA 3E6KA 4ITYA 4RHKA 4Q41A 1GQ7A 3F80A 3PZLA 1WVAA 3MMRA 5CEVA 1TBHA 1HQXA 4IE1A 1T5GA 2PHOA 3MJLA 3LHLA 1P8NA 4IXUA 1TBLA 1P8SA 4I06A 4Q3PA 2AEBA 1P8PA 1D3VA 4Q3RA 3THEA 3THJA 2PLLA 1ZPEA 3GMZA 4Q3VA 1P8OA 4IXVA 1TA1A 3E8QA 3LP7A 5HJ9A 1P8QA 4RHMA 1PQ3A 3TH7A 1CEVA 2EF5A 1P8MA 4HXQA 3SL0A 3MFWA 4MYLA 4FCKA 4Q40A 4GSVA 3CEVA 4DZ4A 2ZAVA 3NIPA 1HQGA 4RHJA 3M1RA 4IE2A 4Q3SA 1WOIA 1HQFA 3E6VA 4GSZA 1RLAA 3KV2A 4HZEA 4MYFA 1XFKA 2A0MA 1HQ5A 3LP4A 2EF4A 4RHLA 2CEVA 3DJ8A 3NIOA 4IU0A 4Q3TA 3E8ZA 1GQ6A 3SL1A 4G3HA 4Q3RC 1T4PA 1TBJA 4GSMA 4IU1A 4MYNA 3MFVA 4MXRA 5RLAA 1T4TA 4MYKA 1T5FA 1P8RA 3SJTA 1T4RA 1WVBA 4IU5A 3TF3A 1HQHA 1T4SA 4Q3UA 3THHA 4GWCA 4FCIA
chains in the Genus database with same CATH superfamily
4HWWA 5IWGA 1ZPGA 5A2SA 4RHQA 4FCIA 1C3RA 3NIQA 3SFHA 5G10A 5D1BA 4RN1A 3F06A 3MZ7A 4RN2A 3GN0A 5EEIA 3MZ4A 1WOHA 5JI5A 5EF8A 5DC5A 5EEFA 1WOGA 4ZUOA 4IE3A 4Q42A 4RHIA 5HJAA 4GWDA 5G0JA 3SKKA 4QA2A 4BZ8A 5EFHA 3F07A 4BZ5A 1R1OA 4Q3QA 4CEVA 4RLAA 5DC6A 4IU4A 5G0GA 4CBTA 2VQWG 2RLAA 3E9BA 4QA6A 5EFNA 2EIVA 5G0YA 2PHAA 2VQOA 3E6KA 3Q9EA 4ITYA 4RN0A 4RHKA 5IX0A 3RLAA 1C3PA 5G1BA 4Q41A 3F80A 3PZLA 1WVAA 3MMRA 5CEVA 5ICNB 4BZ7A 1TBHA 1HQXA 5EEKA 4IE1A 1T5GA 2PHOA 3MJLA 3LHLA 1P8NA 5EEMA 5BWZA 5EFGA 4IXUA 2VCGA 2VQQA 3ZNRA 2VQJA 1TBLA 1P8SA 4I06A 2GH6A 4Q3PA 5D1DA 3MAXA 2AEBA 1P8PA 4CBYA 5G3WA 1D3VA 4Q3RA 3THEA 5FCWA 3MENA 3THJA 5G1AA 4BKXB 2PLLA 1ZPEA 3F0RA 3GMZA 5G0IA 4Q3VA 1P8OA 4IXVA 1TA1A 3E8QA 1T67A 3Q9CA 1ZZ0A 5THUA 3LP7A 5G0XA 5HJ9A 1P8QA 5EF7A 4RHMA 5THVA 1PQ3A 5FUEA 3TH7A 1CEVA 2EF5A 1P8MA 4HXQA 4LY1A 5EENA 3MFWA 4MYLA 5G13A 3SL0A 4ZUQA 1VKGA 5LI3A 4FCKA 4Q40A 4GSVA 3CEVA 4DZ4A 2ZAVA 3RQDA 3NIPA 1HQGA 1T64A 3C0YA 4RHJA 4A69A 3M1RA 4IE2A 5G17A 4Q3SA 1WOIA 4QA4A 5EFKB 3EZTA 5EFJD 5DC8A 1HQFA 3MZ6A 3E6VA 4GSZA 4ZUMA 1RLAA 4QA1A 5G1CA 3KV2A 3EZPA 4HZEA 4MYFA 5EFBD 1W22A 3C10A 1XFKA 2A0MA 4QA5A 1ZZ1A 1HQ5A 2V5WA 3LP4A 2VQMA 3MZ3A 1ZZ3A 4QA7A 2EF4A 4RHLA 4BZ9A 2CEVA 3DJ8A 1T69A 3NIOA 4IU0A 4Q3TA 3E8ZA 5THSA 5THTA 4CQFA 1GQ6A 3SL1A 4G3HA 4Q3RC 3Q9BA 2V5XA 1T4PA 1TBJA 4GSMA 1C3SA 4IU1A 4MYNA 3MFVA 2VQVA 4MXRA 4ZUNA 5DC7A 5G11A 5RLAA 4ZUPA 4ZURA 1T4TA 4LXZA 4MYKA 1T5FA 5G12A 1P8RA 3SJTA 1T4RA 3EWFA 1WVBA 4BZ6A 4IU5A 3ZNSA 3C0ZA 5D1CA 3TF3A 4QA0A 1HQHA 1T4SA 4Q3UA 4QA3A 3THHA 4GWCA 5G0HA 3SFFA 3EW8A 1GQ7A 3Q9FA
chains in the Genus database with same CATH topology
4HWWA 1ZPGA 4RHQA 3NIQA 3GN0A 1WOHA 1WOGA 4IE3A 4Q42A 4RHIA 5HJAA 4GWDA 3SKKA 4CEVA 1R1OA 4Q3QA 4RLAA 4IU4A 2RLAA 3E9BA 2EIVA 2PHAA 3RLAA 3E6KA 4ITYA 4RHKA 4Q41A 1GQ7A 3F80A 3PZLA 1WVAA 3MMRA 5CEVA 1TBHA 1HQXA 4IE1A 1T5GA 2PHOA 3MJLA 3LHLA 1P8NA 4IXUA 1TBLA 1P8SA 4I06A 4Q3PA 2AEBA 1P8PA 1D3VA 4Q3RA 3THEA 3THJA 2PLLA 1ZPEA 3GMZA 4Q3VA 1P8OA 4IXVA 1TA1A 3E8QA 3LP7A 5HJ9A 1P8QA 4RHMA 1PQ3A 3TH7A 1CEVA 2EF5A 1P8MA 4HXQA 3SL0A 3MFWA 4MYLA 4FCKA 4Q40A 4GSVA 3CEVA 4DZ4A 2ZAVA 3NIPA 1HQGA 4RHJA 3M1RA 4IE2A 4Q3SA 1WOIA 1HQFA 3E6VA 4GSZA 1RLAA 3KV2A 4HZEA 4MYFA 1XFKA 2A0MA 1HQ5A 3LP4A 2EF4A 4RHLA 2CEVA 3DJ8A 3NIOA 4IU0A 4Q3TA 3E8ZA 1GQ6A 3SL1A 4G3HA 4Q3RC 1T4PA 1TBJA 4GSMA 4IU1A 4MYNA 3MFVA 4MXRA 5RLAA 1T4TA 4MYKA 1T5FA 1P8RA 3SJTA 1T4RA 1WVBA 4IU5A 3TF3A 1HQHA 1T4SA 4Q3UA 3THHA 4GWCA 4FCIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HWW A;  1ZPG A;  4RHQ A;  3NIQ A;  3GN0 A;  1WOH A;  1WOG A;  4IE3 A;  4Q42 A;  4RHI A;  5HJA A;  4GWD A;  3SKK A;  4CEV A;  1R1O A;  4Q3Q A;  4RLA A;  4IU4 A;  2RLA A;  3E9B A;  2EIV A;  2PHA A;  3RLA A;  3E6K A;  4ITY A;  4RHK A;  4Q41 A;  1GQ7 A;  3F80 A;  3PZL A;  1WVA A;  3MMR A;  5CEV A;  1TBH A;  1HQX A;  4IE1 A;  1T5G A;  2PHO A;  3MJL A;  3LHL A;  1P8N A;  4IXU A;  1TBL A;  1P8S A;  4I06 A;  4Q3P A;  2AEB A;  1P8P A;  1D3V A;  4Q3R A;  3THE A;  3THJ A;  2PLL A;  1ZPE A;  3GMZ A;  4Q3V A;  1P8O A;  4IXV A;  1TA1 A;  3E8Q A;  3LP7 A;  5HJ9 A;  1P8Q A;  4RHM A;  1PQ3 A;  3TH7 A;  1CEV A;  2EF5 A;  1P8M A;  4HXQ A;  3SL0 A;  3MFW A;  4MYL A;  4FCK A;  4Q40 A;  4GSV A;  3CEV A;  4DZ4 A;  2ZAV A;  3NIP A;  1HQG A;  4RHJ A;  3M1R A;  4IE2 A;  4Q3S A;  1WOI A;  1HQF A;  3E6V A;  4GSZ A;  1RLA A;  3KV2 A;  4HZE A;  4MYF A;  1XFK A;  2A0M A;  1HQ5 A;  3LP4 A;  2EF4 A;  4RHL A;  2CEV A;  3DJ8 A;  3NIO A;  4IU0 A;  4Q3T A;  3E8Z A;  1GQ6 A;  3SL1 A;  4G3H A;  4Q3R C;  1T4P A;  1TBJ A;  4GSM A;  4IU1 A;  4MYN A;  3MFV A;  4MXR A;  5RLA A;  1T4T A;  4MYK A;  1T5F A;  1P8R A;  3SJT A;  1T4R A;  1WVB A;  4IU5 A;  3TF3 A;  1HQH A;  1T4S A;  4Q3U A;  3THH A;  4GWC A;  4FCI A; 
#chains in the Genus database with same CATH topology
 4HWW A;  5IWG A;  1ZPG A;  5A2S A;  4RHQ A;  4FCI A;  1C3R A;  3NIQ A;  3SFH A;  5G10 A;  5D1B A;  4RN1 A;  3F06 A;  3MZ7 A;  4RN2 A;  3GN0 A;  5EEI A;  3MZ4 A;  1WOH A;  5JI5 A;  5EF8 A;  5DC5 A;  5EEF A;  1WOG A;  4ZUO A;  4IE3 A;  4Q42 A;  4RHI A;  5HJA A;  4GWD A;  5G0J A;  3SKK A;  4QA2 A;  4BZ8 A;  5EFH A;  3F07 A;  4BZ5 A;  1R1O A;  4Q3Q A;  4CEV A;  4RLA A;  5DC6 A;  4IU4 A;  5G0G A;  4CBT A;  2VQW G;  2RLA A;  3E9B A;  4QA6 A;  5EFN A;  2EIV A;  5G0Y A;  2PHA A;  2VQO A;  3E6K A;  3Q9E A;  4ITY A;  4RN0 A;  4RHK A;  5IX0 A;  3RLA A;  1C3P A;  5G1B A;  4Q41 A;  3F80 A;  3PZL A;  1WVA A;  3MMR A;  5CEV A;  5ICN B;  4BZ7 A;  1TBH A;  1HQX A;  5EEK A;  4IE1 A;  1T5G A;  2PHO A;  3MJL A;  3LHL A;  1P8N A;  5EEM A;  5BWZ A;  5EFG A;  4IXU A;  2VCG A;  2VQQ A;  3ZNR A;  2VQJ A;  1TBL A;  1P8S A;  4I06 A;  2GH6 A;  4Q3P A;  5D1D A;  3MAX A;  2AEB A;  1P8P A;  4CBY A;  5G3W A;  1D3V A;  4Q3R A;  3THE A;  5FCW A;  3MEN A;  3THJ A;  5G1A A;  4BKX B;  2PLL A;  1ZPE A;  3F0R A;  3GMZ A;  5G0I A;  4Q3V A;  1P8O A;  4IXV A;  1TA1 A;  3E8Q A;  1T67 A;  3Q9C A;  1ZZ0 A;  5THU A;  3LP7 A;  5G0X A;  5HJ9 A;  1P8Q A;  5EF7 A;  4RHM A;  5THV A;  1PQ3 A;  5FUE A;  3TH7 A;  1CEV A;  2EF5 A;  1P8M A;  4HXQ A;  4LY1 A;  5EEN A;  3MFW A;  4MYL A;  5G13 A;  3SL0 A;  4ZUQ A;  1VKG A;  5LI3 A;  4FCK A;  4Q40 A;  4GSV A;  3CEV A;  4DZ4 A;  2ZAV A;  3RQD A;  3NIP A;  1HQG A;  1T64 A;  3C0Y A;  4RHJ A;  4A69 A;  3M1R A;  4IE2 A;  5G17 A;  4Q3S A;  1WOI A;  4QA4 A;  5EFK B;  3EZT A;  5EFJ D;  5DC8 A;  1HQF A;  3MZ6 A;  3E6V A;  4GSZ A;  4ZUM A;  1RLA A;  4QA1 A;  5G1C A;  3KV2 A;  3EZP A;  4HZE A;  4MYF A;  5EFB D;  1W22 A;  3C10 A;  1XFK A;  2A0M A;  4QA5 A;  1ZZ1 A;  1HQ5 A;  2V5W A;  3LP4 A;  2VQM A;  3MZ3 A;  1ZZ3 A;  4QA7 A;  2EF4 A;  4RHL A;  4BZ9 A;  2CEV A;  3DJ8 A;  1T69 A;  3NIO A;  4IU0 A;  4Q3T A;  3E8Z A;  5THS A;  5THT A;  4CQF A;  1GQ6 A;  3SL1 A;  4G3H A;  4Q3R C;  3Q9B A;  2V5X A;  1T4P A;  1TBJ A;  4GSM A;  1C3S A;  4IU1 A;  4MYN A;  3MFV A;  2VQV A;  4MXR A;  4ZUN A;  5DC7 A;  5G11 A;  5RLA A;  4ZUP A;  4ZUR A;  1T4T A;  4LXZ A;  4MYK A;  1T5F A;  5G12 A;  1P8R A;  3SJT A;  1T4R A;  3EWF A;  1WVB A;  4BZ6 A;  4IU5 A;  3ZNS A;  3C0Z A;  5D1C A;  3TF3 A;  4QA0 A;  1HQH A;  1T4S A;  4Q3U A;  4QA3 A;  3THH A;  4GWC A;  5G0H A;  3SFF A;  3EW8 A;  1GQ7 A;  3Q9F A; 
#chains in the Genus database with same CATH homology
 4HWW A;  1ZPG A;  4RHQ A;  3NIQ A;  3GN0 A;  1WOH A;  1WOG A;  4IE3 A;  4Q42 A;  4RHI A;  5HJA A;  4GWD A;  3SKK A;  4CEV A;  1R1O A;  4Q3Q A;  4RLA A;  4IU4 A;  2RLA A;  3E9B A;  2EIV A;  2PHA A;  3RLA A;  3E6K A;  4ITY A;  4RHK A;  4Q41 A;  1GQ7 A;  3F80 A;  3PZL A;  1WVA A;  3MMR A;  5CEV A;  1TBH A;  1HQX A;  4IE1 A;  1T5G A;  2PHO A;  3MJL A;  3LHL A;  1P8N A;  4IXU A;  1TBL A;  1P8S A;  4I06 A;  4Q3P A;  2AEB A;  1P8P A;  1D3V A;  4Q3R A;  3THE A;  3THJ A;  2PLL A;  1ZPE A;  3GMZ A;  4Q3V A;  1P8O A;  4IXV A;  1TA1 A;  3E8Q A;  3LP7 A;  5HJ9 A;  1P8Q A;  4RHM A;  1PQ3 A;  3TH7 A;  1CEV A;  2EF5 A;  1P8M A;  4HXQ A;  3SL0 A;  3MFW A;  4MYL A;  4FCK A;  4Q40 A;  4GSV A;  3CEV A;  4DZ4 A;  2ZAV A;  3NIP A;  1HQG A;  4RHJ A;  3M1R A;  4IE2 A;  4Q3S A;  1WOI A;  1HQF A;  3E6V A;  4GSZ A;  1RLA A;  3KV2 A;  4HZE A;  4MYF A;  1XFK A;  2A0M A;  1HQ5 A;  3LP4 A;  2EF4 A;  4RHL A;  2CEV A;  3DJ8 A;  3NIO A;  4IU0 A;  4Q3T A;  3E8Z A;  1GQ6 A;  3SL1 A;  4G3H A;  4Q3R C;  1T4P A;  1TBJ A;  4GSM A;  4IU1 A;  4MYN A;  3MFV A;  4MXR A;  5RLA A;  1T4T A;  4MYK A;  1T5F A;  1P8R A;  3SJT A;  1T4R A;  1WVB A;  4IU5 A;  3TF3 A;  1HQH A;  1T4S A;  4Q3U A;  3THH A;  4GWC A;  4FCI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...