1HQGA

Crystal structure of the h141c arginase variant complexed with products ornithine and urea
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
314
structure length
313
Chain Sequence
b'KPIEIIGAPFSKGQPRGGVEKGPAALRKAGLVEKLKETEYNVRDHGDLAFVDVPNDSPFQIVKNPRSVGKANEQLAAVVAETQKNGTISVVLGGDHSMAIGSISGHARVHPDLCVIWVDAHTDINTPLTTSSGNLGQPVAFLLKELKGKFPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYIIKTLGIKYFSMTEVDKLGIGKVMEETFSYLLGRKKRPIHLSFDVDGLDPVFTPATGTPVVGGLSYREGLYITEEIYKTGLLSGLDIMEVNPTLGKTPEEVTRTVNTAVALTLSCFGTKREGNHKPETDYLA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ARGINASE 1
publication title Mechanistic and metabolic inferences from the binding of substrate analogues and products to arginase.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Hydrolase
total genus 113
structure length 313
sequence length 314
chains with identical sequence B, C
ec nomenclature ec 3.5.3.1: Arginase.
pdb deposition date 2000-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00491 Arginase Arginase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.800.10 Alpha Beta 3-Layer(aba) Sandwich Arginase; Chain A Ureohydrolase domain 1hqgA00
5RLAA 5HJ9A 4IU5A 1T4SA 4IXVA 1TBLA 1WOIA 4Q3RA 4MYFA 4GSMA 4IU1A 3M1RA 4ITYA 3NIQA 1HQHA 3RLAA 3CEVA 4Q42A 4CEVA 3NIOA 5CEVA 1CEVA 3MMRA 4MYLA 4RHLA 3LP4A 3TH7A 4Q40A 4HZEA 1GQ6A 3SL0A 1HQXA 1GQ7A 1T4RA 1PQ3A 4Q3PA 4Q3SA 4IE3A 2PHAA 1R1OA 1TBHA 3E6VA 4RHIA 3E8QA 3THJA 1T5FA 1P8QA 1ZPEA 1T5GA 3SKKA 2PHOA 4IE2A 2CEVA 2EF4A 4Q3QA 3LHLA 4HXQA 3THHA 1T4TA 4RHMA 1TA1A 5HJAA 4DZ4A 4G3HA 1P8PA 1WOGA 4RHJA 2PLLA 4GWCA 4Q3RC 4RHKA 1XFKA 1TBJA 3F80A 3MFVA 1P8NA 4GWDA 1T4PA 2A0MA 2AEBA 1P8MA 4MXRA 4Q3TA 1HQGA 3DJ8A 4Q3UA 2EIVA 3NIPA 3E9BA 3LP7A 1HQFA 4IU0A 4HWWA 4RLAA 4Q3VA 3PZLA 4RHQA 3E6KA 2ZAVA 3TF3A 3THEA 4I06A 2EF5A 3MFWA 3MJLA 4GSZA 4IU4A 3SJTA 4IXUA 4IE1A 1D3VA 1WVAA 2RLAA 4MYKA 1P8RA 3GMZA 1WVBA 3KV2A 4FCKA 4GSVA 3SL1A 1WOHA 3GN0A 1P8SA 1RLAA 1ZPGA 4FCIA 4MYNA 1HQ5A 3E8ZA 1P8OA 4Q41A
chains in the Genus database with same CATH superfamily
5DC7A 5RLAA 3SFHA 5THTA 4BZ5A 4QA7A 2VQMA 5G12A 5EFKB 5HJ9A 4IU5A 5G0YA 4RN1A 1T4SA 1ZZ1A 3F06A 4IXVA 5D1CA 1TBLA 1WOIA 4Q3RA 4MYFA 5G0JA 4GSMA 4IU1A 3ZNRA 3EWFA 4QA0A 4BZ9A 1ZZ3A 3F07A 3M1RA 4ITYA 2GH6A 5G0HA 5G0GA 5IWGA 3NIQA 5THSA 1C3RA 3SFFA 4ZURA 1HQHA 3RLAA 3CEVA 4Q42A 4CEVA 3MZ4A 3NIOA 3Q9EA 5DC8A 3C10A 5CEVA 1ZZ0A 1CEVA 3MMRA 4MYLA 5EEMA 5EFJD 4RHLA 5G13A 2VQWG 3LP4A 1T69A 3TH7A 3Q9BA 3MZ3A 4HZEA 4Q40A 4ZUOA 5EEFA 1GQ6A 4BZ6A 1C3PA 3Q9CA 3SL0A 1HQXA 1GQ7A 1T4RA 5THVA 2VQQA 1PQ3A 4Q3PA 5G17A 2V5XA 4Q3SA 4IE3A 2PHAA 4RN2A 5EFBD 1R1OA 1TBHA 3E6VA 4RHIA 2VQJA 3E8QA 3THJA 1C3SA 1T67A 1W22A 1T5FA 1P8QA 5D1DA 5G1AA 1ZPEA 1T5GA 3SKKA 5G0IA 3F0RA 5THUA 2PHOA 4IE2A 2CEVA 2EF4A 4Q3QA 2VCGA 5A2SA 3LHLA 3MAXA 4HXQA 5JI5A 1VKGA 4ZUPA 4LXZA 2VQVA 3THHA 3EZPA 1T4TA 4CBTA 3EW8A 4RHMA 5EEIA 1TA1A 5HJAA 5EF8A 4DZ4A 5G1BA 4G3HA 1P8PA 1WOGA 3MZ6A 4RHJA 2PLLA 4GWCA 4Q3RC 4RHKA 5EENA 5FUEA 1T64A 2V5WA 5G3WA 1XFKA 1TBJA 3MENA 5DC6A 3F80A 3MFVA 1P8NA 4GWDA 1T4PA 2A0MA 4CBYA 4BZ7A 2AEBA 4QA6A 5DC5A 5ICNB 1P8MA 4MXRA 5LI3A 4Q3TA 1HQGA 3DJ8A 4QA3A 3EZTA 3C0YA 5EEKA 4Q41A 4Q3UA 2EIVA 3NIPA 3E9BA 3LP7A 4BKXB 5G11A 1HQFA 4ZUMA 4IU0A 4HWWA 4RLAA 5IX0A 4ZUQA 4Q3VA 3RQDA 3PZLA 4RHQA 3E6KA 3C0ZA 4QA1A 4BZ8A 5FCWA 2ZAVA 4CQFA 3TF3A 3Q9FA 5G10A 3THEA 4I06A 5EFGA 4RN0A 2EF5A 2VQOA 5BWZA 3MFWA 3MJLA 4GSZA 4IU4A 5D1BA 5EFHA 3SJTA 4IXUA 4IE1A 5G0XA 1D3VA 5G1CA 1WVAA 2RLAA 4MYKA 1P8RA 3GMZA 1WVBA 3KV2A 4FCKA 4GSVA 3SL1A 5EFNA 4QA5A 5EF7A 1WOHA 3GN0A 4QA4A 1P8SA 4ZUNA 1RLAA 4LY1A 1ZPGA 4FCIA 4MYNA 3MZ7A 4QA2A 1HQ5A 3E8ZA 3ZNSA 1P8OA 4A69A
chains in the Genus database with same CATH topology
5RLAA 5HJ9A 4IU5A 1T4SA 4IXVA 1TBLA 1WOIA 4Q3RA 4MYFA 4GSMA 4IU1A 3M1RA 4ITYA 3NIQA 1HQHA 3RLAA 3CEVA 4Q42A 4CEVA 3NIOA 5CEVA 1CEVA 3MMRA 4MYLA 4RHLA 3LP4A 3TH7A 4Q40A 4HZEA 1GQ6A 3SL0A 1HQXA 1GQ7A 1T4RA 1PQ3A 4Q3PA 4Q3SA 4IE3A 2PHAA 1R1OA 1TBHA 3E6VA 4RHIA 3E8QA 3THJA 1T5FA 1P8QA 1ZPEA 1T5GA 3SKKA 2PHOA 4IE2A 2CEVA 2EF4A 4Q3QA 3LHLA 4HXQA 3THHA 1T4TA 4RHMA 1TA1A 5HJAA 4DZ4A 4G3HA 1P8PA 1WOGA 4RHJA 2PLLA 4GWCA 4Q3RC 4RHKA 1XFKA 1TBJA 3F80A 3MFVA 1P8NA 4GWDA 1T4PA 2A0MA 2AEBA 1P8MA 4MXRA 4Q3TA 1HQGA 3DJ8A 4Q3UA 2EIVA 3NIPA 3E9BA 3LP7A 1HQFA 4IU0A 4HWWA 4RLAA 4Q3VA 3PZLA 4RHQA 3E6KA 2ZAVA 3TF3A 3THEA 4I06A 2EF5A 3MFWA 3MJLA 4GSZA 4IU4A 3SJTA 4IXUA 4IE1A 1D3VA 1WVAA 2RLAA 4MYKA 1P8RA 3GMZA 1WVBA 3KV2A 4FCKA 4GSVA 3SL1A 1WOHA 3GN0A 1P8SA 1RLAA 1ZPGA 4FCIA 4MYNA 1HQ5A 3E8ZA 1P8OA 4Q41A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5RLA A;  5HJ9 A;  4IU5 A;  1T4S A;  4IXV A;  1TBL A;  1WOI A;  4Q3R A;  4MYF A;  4GSM A;  4IU1 A;  3M1R A;  4ITY A;  3NIQ A;  1HQH A;  3RLA A;  3CEV A;  4Q42 A;  4CEV A;  3NIO A;  5CEV A;  1CEV A;  3MMR A;  4MYL A;  4RHL A;  3LP4 A;  3TH7 A;  4Q40 A;  4HZE A;  1GQ6 A;  3SL0 A;  1HQX A;  1GQ7 A;  1T4R A;  1PQ3 A;  4Q3P A;  4Q3S A;  4IE3 A;  2PHA A;  1R1O A;  1TBH A;  3E6V A;  4RHI A;  3E8Q A;  3THJ A;  1T5F A;  1P8Q A;  1ZPE A;  1T5G A;  3SKK A;  2PHO A;  4IE2 A;  2CEV A;  2EF4 A;  4Q3Q A;  3LHL A;  4HXQ A;  3THH A;  1T4T A;  4RHM A;  1TA1 A;  5HJA A;  4DZ4 A;  4G3H A;  1P8P A;  1WOG A;  4RHJ A;  2PLL A;  4GWC A;  4Q3R C;  4RHK A;  1XFK A;  1TBJ A;  3F80 A;  3MFV A;  1P8N A;  4GWD A;  1T4P A;  2A0M A;  2AEB A;  1P8M A;  4MXR A;  4Q3T A;  1HQG A;  3DJ8 A;  4Q3U A;  2EIV A;  3NIP A;  3E9B A;  3LP7 A;  1HQF A;  4IU0 A;  4HWW A;  4RLA A;  4Q3V A;  3PZL A;  4RHQ A;  3E6K A;  2ZAV A;  3TF3 A;  3THE A;  4I06 A;  2EF5 A;  3MFW A;  3MJL A;  4GSZ A;  4IU4 A;  3SJT A;  4IXU A;  4IE1 A;  1D3V A;  1WVA A;  2RLA A;  4MYK A;  1P8R A;  3GMZ A;  1WVB A;  3KV2 A;  4FCK A;  4GSV A;  3SL1 A;  1WOH A;  3GN0 A;  1P8S A;  1RLA A;  1ZPG A;  4FCI A;  4MYN A;  1HQ5 A;  3E8Z A;  1P8O A;  4Q41 A; 
#chains in the Genus database with same CATH topology
 5DC7 A;  5RLA A;  3SFH A;  5THT A;  4BZ5 A;  4QA7 A;  2VQM A;  5G12 A;  5EFK B;  5HJ9 A;  4IU5 A;  5G0Y A;  4RN1 A;  1T4S A;  1ZZ1 A;  3F06 A;  4IXV A;  5D1C A;  1TBL A;  1WOI A;  4Q3R A;  4MYF A;  5G0J A;  4GSM A;  4IU1 A;  3ZNR A;  3EWF A;  4QA0 A;  4BZ9 A;  1ZZ3 A;  3F07 A;  3M1R A;  4ITY A;  2GH6 A;  5G0H A;  5G0G A;  5IWG A;  3NIQ A;  5THS A;  1C3R A;  3SFF A;  4ZUR A;  1HQH A;  3RLA A;  3CEV A;  4Q42 A;  4CEV A;  3MZ4 A;  3NIO A;  3Q9E A;  5DC8 A;  3C10 A;  5CEV A;  1ZZ0 A;  1CEV A;  3MMR A;  4MYL A;  5EEM A;  5EFJ D;  4RHL A;  5G13 A;  2VQW G;  3LP4 A;  1T69 A;  3TH7 A;  3Q9B A;  3MZ3 A;  4HZE A;  4Q40 A;  4ZUO A;  5EEF A;  1GQ6 A;  4BZ6 A;  1C3P A;  3Q9C A;  3SL0 A;  1HQX A;  1GQ7 A;  1T4R A;  5THV A;  2VQQ A;  1PQ3 A;  4Q3P A;  5G17 A;  2V5X A;  4Q3S A;  4IE3 A;  2PHA A;  4RN2 A;  5EFB D;  1R1O A;  1TBH A;  3E6V A;  4RHI A;  2VQJ A;  3E8Q A;  3THJ A;  1C3S A;  1T67 A;  1W22 A;  1T5F A;  1P8Q A;  5D1D A;  5G1A A;  1ZPE A;  1T5G A;  3SKK A;  5G0I A;  3F0R A;  5THU A;  2PHO A;  4IE2 A;  2CEV A;  2EF4 A;  4Q3Q A;  2VCG A;  5A2S A;  3LHL A;  3MAX A;  4HXQ A;  5JI5 A;  1VKG A;  4ZUP A;  4LXZ A;  2VQV A;  3THH A;  3EZP A;  1T4T A;  4CBT A;  3EW8 A;  4RHM A;  5EEI A;  1TA1 A;  5HJA A;  5EF8 A;  4DZ4 A;  5G1B A;  4G3H A;  1P8P A;  1WOG A;  3MZ6 A;  4RHJ A;  2PLL A;  4GWC A;  4Q3R C;  4RHK A;  5EEN A;  5FUE A;  1T64 A;  2V5W A;  5G3W A;  1XFK A;  1TBJ A;  3MEN A;  5DC6 A;  3F80 A;  3MFV A;  1P8N A;  4GWD A;  1T4P A;  2A0M A;  4CBY A;  4BZ7 A;  2AEB A;  4QA6 A;  5DC5 A;  5ICN B;  1P8M A;  4MXR A;  5LI3 A;  4Q3T A;  1HQG A;  3DJ8 A;  4QA3 A;  3EZT A;  3C0Y A;  5EEK A;  4Q41 A;  4Q3U A;  2EIV A;  3NIP A;  3E9B A;  3LP7 A;  4BKX B;  5G11 A;  1HQF A;  4ZUM A;  4IU0 A;  4HWW A;  4RLA A;  5IX0 A;  4ZUQ A;  4Q3V A;  3RQD A;  3PZL A;  4RHQ A;  3E6K A;  3C0Z A;  4QA1 A;  4BZ8 A;  5FCW A;  2ZAV A;  4CQF A;  3TF3 A;  3Q9F A;  5G10 A;  3THE A;  4I06 A;  5EFG A;  4RN0 A;  2EF5 A;  2VQO A;  5BWZ A;  3MFW A;  3MJL A;  4GSZ A;  4IU4 A;  5D1B A;  5EFH A;  3SJT A;  4IXU A;  4IE1 A;  5G0X A;  1D3V A;  5G1C A;  1WVA A;  2RLA A;  4MYK A;  1P8R A;  3GMZ A;  1WVB A;  3KV2 A;  4FCK A;  4GSV A;  3SL1 A;  5EFN A;  4QA5 A;  5EF7 A;  1WOH A;  3GN0 A;  4QA4 A;  1P8S A;  4ZUN A;  1RLA A;  4LY1 A;  1ZPG A;  4FCI A;  4MYN A;  3MZ7 A;  4QA2 A;  1HQ5 A;  3E8Z A;  3ZNS A;  1P8O A;  4A69 A; 
#chains in the Genus database with same CATH homology
 5RLA A;  5HJ9 A;  4IU5 A;  1T4S A;  4IXV A;  1TBL A;  1WOI A;  4Q3R A;  4MYF A;  4GSM A;  4IU1 A;  3M1R A;  4ITY A;  3NIQ A;  1HQH A;  3RLA A;  3CEV A;  4Q42 A;  4CEV A;  3NIO A;  5CEV A;  1CEV A;  3MMR A;  4MYL A;  4RHL A;  3LP4 A;  3TH7 A;  4Q40 A;  4HZE A;  1GQ6 A;  3SL0 A;  1HQX A;  1GQ7 A;  1T4R A;  1PQ3 A;  4Q3P A;  4Q3S A;  4IE3 A;  2PHA A;  1R1O A;  1TBH A;  3E6V A;  4RHI A;  3E8Q A;  3THJ A;  1T5F A;  1P8Q A;  1ZPE A;  1T5G A;  3SKK A;  2PHO A;  4IE2 A;  2CEV A;  2EF4 A;  4Q3Q A;  3LHL A;  4HXQ A;  3THH A;  1T4T A;  4RHM A;  1TA1 A;  5HJA A;  4DZ4 A;  4G3H A;  1P8P A;  1WOG A;  4RHJ A;  2PLL A;  4GWC A;  4Q3R C;  4RHK A;  1XFK A;  1TBJ A;  3F80 A;  3MFV A;  1P8N A;  4GWD A;  1T4P A;  2A0M A;  2AEB A;  1P8M A;  4MXR A;  4Q3T A;  1HQG A;  3DJ8 A;  4Q3U A;  2EIV A;  3NIP A;  3E9B A;  3LP7 A;  1HQF A;  4IU0 A;  4HWW A;  4RLA A;  4Q3V A;  3PZL A;  4RHQ A;  3E6K A;  2ZAV A;  3TF3 A;  3THE A;  4I06 A;  2EF5 A;  3MFW A;  3MJL A;  4GSZ A;  4IU4 A;  3SJT A;  4IXU A;  4IE1 A;  1D3V A;  1WVA A;  2RLA A;  4MYK A;  1P8R A;  3GMZ A;  1WVB A;  3KV2 A;  4FCK A;  4GSV A;  3SL1 A;  1WOH A;  3GN0 A;  1P8S A;  1RLA A;  1ZPG A;  4FCI A;  4MYN A;  1HQ5 A;  3E8Z A;  1P8O A;  4Q41 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...