1HQGA

Crystal structure of the h141c arginase variant complexed with products ornithine and urea
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
314
structure length
313
Chain Sequence
KPIEIIGAPFSKGQPRGGVEKGPAALRKAGLVEKLKETEYNVRDHGDLAFVDVPNDSPFQIVKNPRSVGKANEQLAAVVAETQKNGTISVVLGGDHSMAIGSISGHARVHPDLCVIWVDAHTDINTPLTTSSGNLGQPVAFLLKELKGKFPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYIIKTLGIKYFSMTEVDKLGIGKVMEETFSYLLGRKKRPIHLSFDVDGLDPVFTPATGTPVVGGLSYREGLYITEEIYKTGLLSGLDIMEVNPTLGKTPEEVTRTVNTAVALTLSCFGTKREGNHKPETDYLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ARGINASE 1
publication title Mechanistic and metabolic inferences from the binding of substrate analogues and products to arginase.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Hydrolase
total genus 113
structure length 313
sequence length 314
chains with identical sequence B, C
ec nomenclature ec 3.5.3.1: Arginase.
pdb deposition date 2000-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00491 Arginase Arginase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.800.10 Alpha Beta 3-Layer(aba) Sandwich Arginase; Chain A Ureohydrolase domain 1hqgA00
4GWCA 3E8ZA 4FCKA 2CEVA 1P8QA 4HZEA 5HJAA 1T4RA 1P8NA 4MYNA 4Q42A 4IU0A 1WOIA 4IE1A 2A0MA 3SL1A 1P8SA 4GWDA 1T5GA 3THJA 3E6KA 1HQFA 1P8OA 3RLAA 4MYLA 4HWWA 4Q3UA 4Q3RC 4G3HA 1XFKA 4DZ4A 4RHJA 4Q3SA 4RHLA 3MMRA 4IU1A 4MXRA 3NIQA 4IU5A 4HXQA 3MFVA 4IE2A 2PLLA 4RHKA 4Q3QA 3LP7A 3THEA 1T5FA 4GSZA 4RHMA 3E9BA 1WVAA 4Q40A 4GSVA 3LP4A 1GQ7A 3E8QA 3MJLA 3SJTA 1TBLA 1HQ5A 1CEVA 2EF4A 4Q3TA 1GQ6A 3LHLA 4I06A 3SL0A 1WOHA 3SKKA 3KV2A 1ZPGA 1ZPEA 3TF3A 3F80A 1WVBA 3TH7A 1HQGA 1P8RA 4RHIA 3MFWA 4RLAA 3GMZA 3E6VA 3NIPA 2EIVA 4IXVA 5HJ9A 3CEVA 1WOGA 4Q41A 3DJ8A 2PHAA 1T4PA 1T4SA 2EF5A 4CEVA 1R1OA 4Q3RA 1HQHA 1D3VA 1HQXA 2ZAVA 5RLAA 5CEVA 4IXUA 1PQ3A 4RHQA 4FCIA 4MYFA 1TBHA 3GN0A 2AEBA 4IE3A 1P8PA 4ITYA 4GSMA 2PHOA 3THHA 3NIOA 1P8MA 3PZLA 1T4TA 2RLAA 1RLAA 4MYKA 4IU4A 1TA1A 1TBJA 3M1RA 4Q3PA 4Q3VA
chains in the Genus database with same CATH superfamily
4GWCA 3E8ZA 4FCKA 2CEVA 1P8QA 4HZEA 5DC6A 1T4RA 3F07A 5HJAA 1P8NA 3EWFA 4MYNA 4Q42A 5D1BA 4IU0A 1C3PA 5EEKA 2VQMA 5BWZA 3MAXA 1WOIA 4IE1A 2A0MA 3SL1A 1P8SA 4GWDA 1T5GA 3THJA 3E6KA 4ZUQA 1HQFA 1T67A 5DC7A 1P8OA 3MZ3A 4RN0A 4BKXB 3RLAA 4MYLA 1C3RA 4HWWA 4Q3UA 5THUA 1T64A 4BZ6A 5THTA 4Q3RC 4G3HA 1XFKA 5D1CA 5G1AA 4DZ4A 4QA6A 4RHJA 5IWGA 4Q3SA 4RHLA 3MENA 3EZPA 4QA3A 4QA0A 5EF8A 4CBYA 4LY1A 3MMRA 2VQOA 4IU1A 3NIQA 4MXRA 3ZNSA 4QA5A 4ZUNA 4IU5A 2VQVA 4HXQA 5EEMA 3MFVA 4IE2A 4QA4A 2PLLA 4RHKA 4Q3QA 3LP7A 3THEA 1C3SA 1T5FA 2GH6A 4GSZA 4LXZA 4RHMA 3E9BA 3EW8A 4ZUOA 5G1CA 1WVAA 4Q40A 4GSVA 3LP4A 1GQ7A 3E8QA 3MJLA 5EFJD 4CQFA 3SJTA 1TBLA 5G13A 1HQ5A 3C0YA 5LI3A 3SFFA 1CEVA 2EF4A 5EF7A 5EENA 4Q3TA 1GQ6A 5G17A 5G0YA 3LHLA 3Q9BA 3MZ6A 4I06A 5EFHA 5A2SA 3SL0A 1WOHA 3F06A 3SKKA 3KV2A 3Q9FA 1ZPGA 1ZPEA 5EEIA 5FCWA 5G0XA 3TF3A 3F80A 5G3WA 1WVBA 3TH7A 5IX0A 1HQGA 5G11A 1P8RA 3EZTA 3MFWA 4RHIA 4RLAA 5G12A 3C0ZA 3C10A 3GMZA 3E6VA 5EFGA 4CBTA 3NIPA 5EEFA 5EFBD 2EIVA 4IXVA 5THVA 4BZ8A 5HJ9A 4A69A 3CEVA 2VCGA 1WOGA 1ZZ0A 4Q41A 5DC8A 1ZZ1A 3DJ8A 2PHAA 1T4PA 4BZ9A 1T4SA 3Q9EA 2EF5A 4CEVA 1R1OA 4Q3RA 4QA1A 1W22A 5G0JA 5G0IA 1HQHA 4ZURA 5G1BA 1D3VA 2V5WA 1HQXA 2ZAVA 4QA2A 5RLAA 2VQQA 5CEVA 4ZUMA 4IXUA 1T69A 3RQDA 5D1DA 5EFNA 1PQ3A 4RHQA 3F0RA 4FCIA 1TBHA 3GN0A 4MYFA 5JI5A 2AEBA 3SFHA 3Q9CA 4IE3A 4RN1A 1P8PA 5DC5A 4ITYA 5FUEA 4GSMA 3MZ7A 2PHOA 4BZ5A 2V5XA 3THHA 1ZZ3A 3NIOA 4QA7A 1P8MA 4BZ7A 3PZLA 5G0HA 4RN2A 1T4TA 4ZUPA 2VQJA 5G0GA 5G10A 2RLAA 1RLAA 1VKGA 4MYKA 4IU4A 5EFKB 5THSA 5ICNB 3ZNRA 1TA1A 1TBJA 3M1RA 2VQWG 4Q3PA 3MZ4A 4Q3VA
chains in the Genus database with same CATH topology
4GWCA 3E8ZA 4FCKA 2CEVA 1P8QA 4HZEA 5HJAA 1T4RA 1P8NA 4MYNA 4Q42A 4IU0A 1WOIA 4IE1A 2A0MA 3SL1A 1P8SA 4GWDA 1T5GA 3THJA 3E6KA 1HQFA 1P8OA 3RLAA 4MYLA 4HWWA 4Q3UA 4Q3RC 4G3HA 1XFKA 4DZ4A 4RHJA 4Q3SA 4RHLA 3MMRA 4IU1A 4MXRA 3NIQA 4IU5A 4HXQA 3MFVA 4IE2A 2PLLA 4RHKA 4Q3QA 3LP7A 3THEA 1T5FA 4GSZA 4RHMA 3E9BA 1WVAA 4Q40A 4GSVA 3LP4A 1GQ7A 3E8QA 3MJLA 3SJTA 1TBLA 1HQ5A 1CEVA 2EF4A 4Q3TA 1GQ6A 3LHLA 4I06A 3SL0A 1WOHA 3SKKA 3KV2A 1ZPGA 1ZPEA 3TF3A 3F80A 1WVBA 3TH7A 1HQGA 1P8RA 4RHIA 3MFWA 4RLAA 3GMZA 3E6VA 3NIPA 2EIVA 4IXVA 5HJ9A 3CEVA 1WOGA 4Q41A 3DJ8A 2PHAA 1T4PA 1T4SA 2EF5A 4CEVA 1R1OA 4Q3RA 1HQHA 1D3VA 1HQXA 2ZAVA 5RLAA 5CEVA 4IXUA 1PQ3A 4RHQA 4FCIA 4MYFA 1TBHA 3GN0A 2AEBA 4IE3A 1P8PA 4ITYA 4GSMA 2PHOA 3THHA 3NIOA 1P8MA 3PZLA 1T4TA 2RLAA 1RLAA 4MYKA 4IU4A 1TA1A 1TBJA 3M1RA 4Q3PA 4Q3VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GWC A;  3E8Z A;  4FCK A;  2CEV A;  1P8Q A;  4HZE A;  5HJA A;  1T4R A;  1P8N A;  4MYN A;  4Q42 A;  4IU0 A;  1WOI A;  4IE1 A;  2A0M A;  3SL1 A;  1P8S A;  4GWD A;  1T5G A;  3THJ A;  3E6K A;  1HQF A;  1P8O A;  3RLA A;  4MYL A;  4HWW A;  4Q3U A;  4Q3R C;  4G3H A;  1XFK A;  4DZ4 A;  4RHJ A;  4Q3S A;  4RHL A;  3MMR A;  4IU1 A;  4MXR A;  3NIQ A;  4IU5 A;  4HXQ A;  3MFV A;  4IE2 A;  2PLL A;  4RHK A;  4Q3Q A;  3LP7 A;  3THE A;  1T5F A;  4GSZ A;  4RHM A;  3E9B A;  1WVA A;  4Q40 A;  4GSV A;  3LP4 A;  1GQ7 A;  3E8Q A;  3MJL A;  3SJT A;  1TBL A;  1HQ5 A;  1CEV A;  2EF4 A;  4Q3T A;  1GQ6 A;  3LHL A;  4I06 A;  3SL0 A;  1WOH A;  3SKK A;  3KV2 A;  1ZPG A;  1ZPE A;  3TF3 A;  3F80 A;  1WVB A;  3TH7 A;  1HQG A;  1P8R A;  4RHI A;  3MFW A;  4RLA A;  3GMZ A;  3E6V A;  3NIP A;  2EIV A;  4IXV A;  5HJ9 A;  3CEV A;  1WOG A;  4Q41 A;  3DJ8 A;  2PHA A;  1T4P A;  1T4S A;  2EF5 A;  4CEV A;  1R1O A;  4Q3R A;  1HQH A;  1D3V A;  1HQX A;  2ZAV A;  5RLA A;  5CEV A;  4IXU A;  1PQ3 A;  4RHQ A;  4FCI A;  4MYF A;  1TBH A;  3GN0 A;  2AEB A;  4IE3 A;  1P8P A;  4ITY A;  4GSM A;  2PHO A;  3THH A;  3NIO A;  1P8M A;  3PZL A;  1T4T A;  2RLA A;  1RLA A;  4MYK A;  4IU4 A;  1TA1 A;  1TBJ A;  3M1R A;  4Q3P A;  4Q3V A; 
#chains in the Genus database with same CATH topology
 4GWC A;  3E8Z A;  4FCK A;  2CEV A;  1P8Q A;  4HZE A;  5DC6 A;  1T4R A;  3F07 A;  5HJA A;  1P8N A;  3EWF A;  4MYN A;  4Q42 A;  5D1B A;  4IU0 A;  1C3P A;  5EEK A;  2VQM A;  5BWZ A;  3MAX A;  1WOI A;  4IE1 A;  2A0M A;  3SL1 A;  1P8S A;  4GWD A;  1T5G A;  3THJ A;  3E6K A;  4ZUQ A;  1HQF A;  1T67 A;  5DC7 A;  1P8O A;  3MZ3 A;  4RN0 A;  4BKX B;  3RLA A;  4MYL A;  1C3R A;  4HWW A;  4Q3U A;  5THU A;  1T64 A;  4BZ6 A;  5THT A;  4Q3R C;  4G3H A;  1XFK A;  5D1C A;  5G1A A;  4DZ4 A;  4QA6 A;  4RHJ A;  5IWG A;  4Q3S A;  4RHL A;  3MEN A;  3EZP A;  4QA3 A;  4QA0 A;  5EF8 A;  4CBY A;  4LY1 A;  3MMR A;  2VQO A;  4IU1 A;  3NIQ A;  4MXR A;  3ZNS A;  4QA5 A;  4ZUN A;  4IU5 A;  2VQV A;  4HXQ A;  5EEM A;  3MFV A;  4IE2 A;  4QA4 A;  2PLL A;  4RHK A;  4Q3Q A;  3LP7 A;  3THE A;  1C3S A;  1T5F A;  2GH6 A;  4GSZ A;  4LXZ A;  4RHM A;  3E9B A;  3EW8 A;  4ZUO A;  5G1C A;  1WVA A;  4Q40 A;  4GSV A;  3LP4 A;  1GQ7 A;  3E8Q A;  3MJL A;  5EFJ D;  4CQF A;  3SJT A;  1TBL A;  5G13 A;  1HQ5 A;  3C0Y A;  5LI3 A;  3SFF A;  1CEV A;  2EF4 A;  5EF7 A;  5EEN A;  4Q3T A;  1GQ6 A;  5G17 A;  5G0Y A;  3LHL A;  3Q9B A;  3MZ6 A;  4I06 A;  5EFH A;  5A2S A;  3SL0 A;  1WOH A;  3F06 A;  3SKK A;  3KV2 A;  3Q9F A;  1ZPG A;  1ZPE A;  5EEI A;  5FCW A;  5G0X A;  3TF3 A;  3F80 A;  5G3W A;  1WVB A;  3TH7 A;  5IX0 A;  1HQG A;  5G11 A;  1P8R A;  3EZT A;  3MFW A;  4RHI A;  4RLA A;  5G12 A;  3C0Z A;  3C10 A;  3GMZ A;  3E6V A;  5EFG A;  4CBT A;  3NIP A;  5EEF A;  5EFB D;  2EIV A;  4IXV A;  5THV A;  4BZ8 A;  5HJ9 A;  4A69 A;  3CEV A;  2VCG A;  1WOG A;  1ZZ0 A;  4Q41 A;  5DC8 A;  1ZZ1 A;  3DJ8 A;  2PHA A;  1T4P A;  4BZ9 A;  1T4S A;  3Q9E A;  2EF5 A;  4CEV A;  1R1O A;  4Q3R A;  4QA1 A;  1W22 A;  5G0J A;  5G0I A;  1HQH A;  4ZUR A;  5G1B A;  1D3V A;  2V5W A;  1HQX A;  2ZAV A;  4QA2 A;  5RLA A;  2VQQ A;  5CEV A;  4ZUM A;  4IXU A;  1T69 A;  3RQD A;  5D1D A;  5EFN A;  1PQ3 A;  4RHQ A;  3F0R A;  4FCI A;  1TBH A;  3GN0 A;  4MYF A;  5JI5 A;  2AEB A;  3SFH A;  3Q9C A;  4IE3 A;  4RN1 A;  1P8P A;  5DC5 A;  4ITY A;  5FUE A;  4GSM A;  3MZ7 A;  2PHO A;  4BZ5 A;  2V5X A;  3THH A;  1ZZ3 A;  3NIO A;  4QA7 A;  1P8M A;  4BZ7 A;  3PZL A;  5G0H A;  4RN2 A;  1T4T A;  4ZUP A;  2VQJ A;  5G0G A;  5G10 A;  2RLA A;  1RLA A;  1VKG A;  4MYK A;  4IU4 A;  5EFK B;  5THS A;  5ICN B;  3ZNR A;  1TA1 A;  1TBJ A;  3M1R A;  2VQW G;  4Q3P A;  3MZ4 A;  4Q3V A; 
#chains in the Genus database with same CATH homology
 4GWC A;  3E8Z A;  4FCK A;  2CEV A;  1P8Q A;  4HZE A;  5HJA A;  1T4R A;  1P8N A;  4MYN A;  4Q42 A;  4IU0 A;  1WOI A;  4IE1 A;  2A0M A;  3SL1 A;  1P8S A;  4GWD A;  1T5G A;  3THJ A;  3E6K A;  1HQF A;  1P8O A;  3RLA A;  4MYL A;  4HWW A;  4Q3U A;  4Q3R C;  4G3H A;  1XFK A;  4DZ4 A;  4RHJ A;  4Q3S A;  4RHL A;  3MMR A;  4IU1 A;  4MXR A;  3NIQ A;  4IU5 A;  4HXQ A;  3MFV A;  4IE2 A;  2PLL A;  4RHK A;  4Q3Q A;  3LP7 A;  3THE A;  1T5F A;  4GSZ A;  4RHM A;  3E9B A;  1WVA A;  4Q40 A;  4GSV A;  3LP4 A;  1GQ7 A;  3E8Q A;  3MJL A;  3SJT A;  1TBL A;  1HQ5 A;  1CEV A;  2EF4 A;  4Q3T A;  1GQ6 A;  3LHL A;  4I06 A;  3SL0 A;  1WOH A;  3SKK A;  3KV2 A;  1ZPG A;  1ZPE A;  3TF3 A;  3F80 A;  1WVB A;  3TH7 A;  1HQG A;  1P8R A;  4RHI A;  3MFW A;  4RLA A;  3GMZ A;  3E6V A;  3NIP A;  2EIV A;  4IXV A;  5HJ9 A;  3CEV A;  1WOG A;  4Q41 A;  3DJ8 A;  2PHA A;  1T4P A;  1T4S A;  2EF5 A;  4CEV A;  1R1O A;  4Q3R A;  1HQH A;  1D3V A;  1HQX A;  2ZAV A;  5RLA A;  5CEV A;  4IXU A;  1PQ3 A;  4RHQ A;  4FCI A;  4MYF A;  1TBH A;  3GN0 A;  2AEB A;  4IE3 A;  1P8P A;  4ITY A;  4GSM A;  2PHO A;  3THH A;  3NIO A;  1P8M A;  3PZL A;  1T4T A;  2RLA A;  1RLA A;  4MYK A;  4IU4 A;  1TA1 A;  1TBJ A;  3M1R A;  4Q3P A;  4Q3V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...