1HQPA

Crystal structure of a truncated form of porcine odorant-binding protein
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
149
structure length
149
Chain Sequence
b'PFELSGKWITSYIGSSDLEKIGENAPFQVFMRSIEFDDKESKVYLNFFSKENGICEEFSLIGTKQEGNTYDVNYAGNNKFVVSYASETALIISNINVDEEGDKTIMTGLLGKGTDIEDQDLEKFKEVTRENGIPEENIVNIIERDDCPA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ODORANT-BINDING PROTEIN
publication title Crystal structure of a truncated form of porcine odorant-binding protein.
pubmed doi rcsb
molecule tags Signaling protein
total genus 32
structure length 149
sequence length 149
ec nomenclature
pdb deposition date 2000-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00061 Lipocalin Lipocalin / cytosolic fatty-acid binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 1hqpA00
1HBQA 2AL0X 1OPAA 1ML7A 4WFUA 3PEDA 1MX8A 1KQXA 2QO6A 4OS3A 5HCCC 5HCDC 1ICMA 1LKEA 1XCAA 2ACOA 2W2BA 1JJXA 3APWA 1BJ7A 3WJDA 1SXWA 5L8IA 3PECA 3BSZE 2W2FA 1NP4A 1QFTA 4GETA 5HAEA 4ZGUA 1CRBA 1LF7A 4TNNA 4ALOA 1YWAA 4YKOA 1E00A 1LICA 3FA8A 2Q2PA 1LIBA 1MDCA 2GJ5A 1MVGA 1KZWA 4DQ4A 1JYJA 4D6AA 3HWFA 5HA1A 3WJFA 3STKA 5H9KA 2FR2A 2XSTA 2FS6A 3I0AA 1UREA 1ZNLA 3NR3A 5L8OA 1S2PA 2BLGA 1U18A 5H8TA 1BSOA 2FLJA 4NYQA 1DC9A 1QQSA 3KFGA 4YKMA 4QGVA 2K23A 1P6PA 5IO7A 3U0DA 3TGAA 4AW8A 4I3DA 5LJEA 4YBUA 4OS8A 1DF3A 1HBPA 1YP7A 1T0VA 3WJGA 5F1EA 1OEKA 3BX7A 4RUNA 5B27A 4UU3A 1I06A 3EYCA 1QY2A 1QY1A 4ORXA 5HWZA 1KT7A 4OMWA 1DZPA 4Y0PA 5F58A 1ZNHA 4YDBA 1I04A 2DM5A 4NYRA 1CBRA 5HTDA 1CBSA 4AZQA 2MM3A 5IO6A 2ANSA 5H9LA 3MVFA 3BS2A 1B8EA 2LKKA 2CM9A 5LJHA 3AKMA 2WQAE 1BLRA 4YMYA 4YFQA 2WWPA 1KXOA 3U03A 3P6CA 3HWDA 2XKLA 2GC9A 5EEEA 3VG3A 1SY1A 3VG2A 2OVAA 1AELA 3I17A 3BDRA 3EM0A 3DSZA 3C78X 1BRQA 4ZHDA 1BSYA 2OVDA 1HQPA 3FLLA 3FELA 3STMX 4CK4A 3TF6A 2WSJA 1TOWA 3B2JA 1OEEA 1PBOA 1D3SA 3KFFA 2JN3A 5KIDA 1MUPA 1ADLA 5HTEA 2RQ0A 1ZNDA 1U17A 5DPQA 3BLGA 4ZH6A 4YCHA 1OEJA 4KIIA 5EDCA 3WJBA 1FENA 2EU7X 3RSWA 3NQ3A 2L9CA 3CQNA 3VG4A 1OBQA 2R74A 1X8NA 4OMXA 1DFVA 3WXQA 1EALA 3P6EA 1AB0A 2QO4A 4A1YA 3P6HA 1ZRYA 3F8AA 5HZ5A 2CBSA 5HCEC 1VPRA 2AKQA 1KGLA 4M7MA 1LPJA 3BY0A 1KT5A 4ZJ0A 2A2UA 4I3BA 4EXZA 2X46A 3MBTA 5C0NA 2JOZA 3P6FA 2OVEA 3APXA 1A57A 4HPCA 4NP1A 3KQ0A 1QFVA 1HMSA 2KT4B 3NQ9A 4K19A 2JU8A 4XMHA 1U0XA 3EBWA 4ORSA 1T68X 3NPOA 1EIIA 4BQUA 4XMFA 2R56A 4YFRA 2CZUA 2A0AA 1HMTA 4NLIA 1L6MA 1S7DA 1IFCA 3CWKA 5DG4A 2RD7C 1PEEA 4LKTA 5D4AA 1SXYA 3C76X 4HPAA 2QO5A 3PH6A 2NNQA 3F9DA 4OS0A 3APUA 3NADA 4QYNA 2HZRA 4ZHCA 1LIDA 1BWYA 4I3CA 1GGLA 4ZHHA 2WEWA 1S44A 2L67A 4HPDA 4ARHA 2W2AA 3QKGA 4M6SA 1T8VA 3ZUIA 1X8PA 4YGGA 1X89A 1GKAB 4ORYA 1AVGI 4EDEA 3Q6LA 1GX9A 1CBQA 5IO5A 3JSQA 4N7DA 1KT6A 5LJBA 3P6DA 3D95A 2Q9SA 1JZUA 3APVA 4IB8A 1SY3A 4TQ2A 1GT5A 2L68A 2K62A 5LKEA 3KZAA 4HFOA 4LKPA 1ERBA 1EIOA 1ZNKA 4YGHA 3VG5A 1GKAA 5LJGA 3FW5A 4AYHA 2ASNX 3CMPA 4LZVA 2G78A 1I4UA 1YP6A 1N0SA 4NNTA 1O1UA 2FTBA 1BRPA 5HA0A 1SXXA 3FENA 1B4MA 2Q4NA 4YH0A 1DZJA 4DQ3A 4BVMA 1PM1X 4Y0RA 1O1VA 1ZNGA 3PPTA 3WVMA 4AZMA 2A2GA 5F6ZA 2A13A 2RCQA 2HLVA 2FWVA 4GRJA 3S26A 5JR8A 4ZCBA 2WEXA 4ZHFA 1H91A 4IAWA 3BX8A 1E06A 4IMNA 5AQ6A 3U9PC 4A60A 1DZKA 1B0OA 2WR6A 3B2KA 1FTPA 3L4RA 5FENA 1EPBA 2POAA 2RCTA 2AH7X 2NNEA 4N7CA 4ZHGA 1IKJA 2Q2MA 2FT9A 1JYDA 3K3LA 4QAEA 2AT3X 3WJCA 2FR3A 1EW3A 4NNSA 2QOSC 1A18A 1BM5A 4O9SA 4Y0SA 2AT8X 2L5PA 3IA8A 4WFVA 2WUTA 4ODDA 5LKFA 3FEPA 1GT4A 1DV9A 1G5WA 3P6GA 4PSQA 1EPAA 2QM9A 5HZ9A 4QYPA 1O8VA 3FR4A 2CM4A 1YIVA 3IFBA 3UEWA 3PP6A 2P8GA 5HZ8A 4TKBA 1FDQA 1OBUA 2MJIA 3FEKA 3RZYA 4XMCA 1A3YA 3O2YA 4TKHA 4MVIA 1GX8A 1JV4A 1LIFA 1BSQA 1I05A 4XMDA 4AZNA 1DZMA 1FEMA 5L8NA 1QWDA 2JU3A 3FIQA 4GE1A 4IB6A 1KOIA 1SA8A 5FAZA 4RUUA 3FMZA 5EEDA 3VG6A 4D6BA 1G7NA 2RA6A 4WBKA 1NP1A 3JS1A 3KFHA 1JBHA 3FA7A 1A2DA 2HYSA 1D2UA 2LB6A 4I9RA 4Y0QA 2A3FX 4YFPA 2N93A 4TKJA 1X8OA 1HN2A 3O22A 3BRNA 1IIUA 4YDAA 5F6BA 3B2LA 1OPBA 4A1HA 4GH7A 1CBIA 4ORWA 2FRSA 5D45A 3VG7A 1YWBA 1KQWA 3SAOA 4ALBA 4IAXA 1SY0A 3BU9A 1SXUA 5CE4A 4AZPA 2AMMX 5D47A 3STNA 5KHPA 1X8QA 1LNMA 3CBSA 2FS7A 5BVTA 1NGLA 5D48A 1VYGA 3G7XA 2MO5A 1XKIA 5HZ6A 2YG2A 2LBVA 2Q39A 4UU2A 3D96A 1GT1A 5EZ2A 1ZNEA 2OFMX 2G79A 4YGZA 4AZRA 2OZQA 1BBPA 4IMOA 4QGXA 1X8UA 5LJCA 4XMGA 1EUOA 3EMMA 1IW2A 2LBAA 3FR2A 2IFBA 3CQRA 2CBRA 5HBSA 3HWGA 1ICNA 4NLJA 4TLJA 3CR6A 1YUPA 1R0UA 1QABE 4YBPA 4BOEA 5F7GA 2CZTA 2E4JA 4GNYA 1QY0A 1CJ5A 1GM6A 4A8ZA 3O19A 5EPQA 5BVQA 2ALLX 2HZQA 4ZFXA 3ZQ3A 4IBAA 1G85A 1FELA 3ZUOA 3FW4A 1TXLA 1AQBA 1FE3A 2JU7A 3B2IA 4QGWA 3NX1A 1KT4A 5BVSA 2GTFX 3FA9A 3CBCA 1YWCA 4IB9A 3ELXA 1X71A 1TW4A 4LZUA 3ELZA 1B56A 2R73A 3OJYC 2F73A 4ORUA 4QZUA 5H9NA 2KTDA 1EXSA 1GXAA 2HNXA 1QG5A 4ORRA 4ZR2A 3T1DA 4HPBA 1LFOA 3TGCA 2G7BA 3D97A 5KICA 1PMPA 4I9SA 2AT6X 3UEUA 2AT0X 1RBPA 3PH5A 1G74A 1VYFA 3FA6A 1BEBA 1JJJA 4YCEA 4TJZA 1EQDA 1GT3A 4AZOA 5FFHA 1ERXA 3AKNA 4GNWA 4GKCA 4EEJA 3TGBA 3B2HA 3UEXA 1LIEA 1HMRA 1E02A 3EBKA 3WJEA 1TOUA 1KZXA 3NX2A 3UEVA 1KT3A 3GAQA 4MVKA 2AT5X 4EFGA 3HWEA 3HK1A 1TVQA 1OBPA 1SY2A 5LJDA 2O62A 3FR5A 4ES7A 3BU1A 1ALBA 1E5PA 4R0BA 3KFIA 4ZH9A 2WQ9A 1Z24A 2HMBA 4IB7A 1ACDA 3NP1A 4QZTA 5B29A 2NNDA 2LFOA 4MVLA 5HZQA 1IKEA 1YWDA 3DTQA 1IFBA 5LJKA 1RLBE 4XMEA 1UZ2X 2NP1A 2ACPX 3C77X 5H9AA 2OFRX 2X45A 2PY1A 5D8JA 5EDBA 3WBGA 1MX7A 5K06A 3TZSA
chains in the Genus database with same CATH superfamily
1HBQA 1RXKA 1LCVA 1Y55X 2AL0X 4EKVA 1VWFB 1OPAA 1ML7A 4WFUA 3PEDA 1MX8A 1KQXA 2QO6A 4U8UM 2RN4A 4OS3A 1LCZA 3ZW0A 5HCCC 5HCDC 1ICMA 1LKEA 1XCAA 2ACOA 2W2BA 1JJXA 1Y9LA 3APWA 5L8NA 4FBVA 1BJ7A 3WJDA 1SXWA 5L8IA 3PECA 3BSZE 2W2FA 1NP4A 1QFTA 4GETA 4CPEA 5HAEA 4ZGUA 1CRBA 3EC5A 4BX5A 4MVEA 2FKJA 1LF7A 4TNNA 4ALOA 1YWAA 2IZBA 1E00A 1LICA 1LUQA 2QCBA 3FA8A 2Q2PA 4YKOA 1LIBA 1MDCA 2GJ5A 1MVGA 2RTHB 1SRHA 1SWJA 3LTWA 3SOTA 4DQ4A 1JYJA 3PQUA 4D6AA 4LQZA 4Z6JA 3OD9A 3RDOA 1KL4A 2RTBB 3HWFA 5HA1A 3S60A 3WJFA 3PK2A 5H9KA 2FR2A 2OY5O 2OY8A 2XSTA 3STKA 3X00A 3WZOA 2FS6A 3I0AA 1UREA 5AEOA 1K24A 1ZNLA 3NR3A 4DCBA 5L8OA 2OY1O 1VWQB 1S2PA 2BLGA 1U18A 5H8TA 1BSOA 2FLJA 2AF5A 2OF8A 2F09A 4NYQA 1DC9A 1QQSA 2G8CO 3KFGA 4Y5DA 4YKMA 2K23A 4QGVA 2RTIB 1P6PA 4YVBA 5IO7A 3U0DA 3TGAA 4AW8A 4CPHA 4I3DA 5LJEA 4YBUA 4Y59A 4OS8A 1DF3A 3N91A 1HBPA 4O4XA 1YP7A 2Z4IA 4INNA 1T0VA 3FIDA 3WJGA 4GUZA 1SWRA 5F1EA 1OEKA 3BX7A 5F2BA 4RUNA 5B27A 3VPJE 1SWNA 4KC8A 2VDFA 4UU3A 1I06A 3EYCA 1QY2A 4OEMA 1QY1A 2IZAA 4ORXA 1Y9TA 2I5VO 5HWZA 3RY1A 3ZZVA 3KVNA 3H3IA 3RY2A 1KT7A 2X34A 1HXZA 1DZPA 2IZJA 4OMWA 4Y0PA 4Y0QA 4BX6A 5AJBA 5F58A 1ZNHA 2RTGB 4FGIB 4YDBA 1I04A 2DM5A 4NYRA 4OELA 1CBRA 4FBRA 3SZIA 5HTDA 1CBSA 1LELA 4AZQA 2MM3A 5IO6A 2ANSA 5H9LA 3T6FA 3MVFA 3BS2A 1B8EA 2LKKA 2CM9A 5LJHA 2VFBA 3AKMA 4O4OA 2WQAE 3JQOA 2KD2A 4IRWA 3UAQA 4YMYA 1BLRA 4YFQA 2WWPA 4U9CA 5JD2A 1KXOA 3U03A 3P6CA 3HWDA 2XKLA 2GC9A 5EEEA 3VG3A 3HTYA 1VWMB 1SY1A 3VG2A 1AVDA 2OVAA 3MG5A 1AELA 3I17A 3BDRA 3EM0A 3DSZA 3C78X 1BRQA 4ZHDA 1BSYA 2OVDA 1HQPA 1STPA 3FELA 1UYNX 3FLLA 3ZWEA 3STMX 4CK4A 4NV7A 5CSEA 3TF6A 2WSJA 1TOWA 3B2JA 1OEEA 1VWCB 1PBOA 1DF8A 1D3SA 3KFFA 2JN3A 4OKAA 4B55A 3D4RA 4BGFA 1SWSA 3QQ2A 4I6SA 5IRUA 5KIDA 1MUPA 2IZEB 1ADLA 4GGZA 4JNJA 4ID2A 1EI5A 5HTEA 3RWXA 2FHNX 2RQ0A 1ZNDA 1U17A 2WPUA 5DPQA 3BLGA 1VWOB 4ZH6A 4YCHA 1OEJA 2FHLA 2RTOB 4KIIA 5EDCA 3WJBA 2G5LA 1FENA 2EU7X 2FKGA 3RSWA 1VWJB 4FBOA 3NQ3A 3S5VA 2L9CA 3CQNA 3VG4A 1OBQA 2IZDB 1X8NA 2R74A 1DFVA 4OMXA 3WZNA 1VWBB 4I60A 3WXQA 4GDZA 1EALA 3P6EA 1AB0A 2QO4A 1LDOA 3P6HA 1ZRYA 3F8AA 4GGTA 3RDSA 4A1YA 1SWKA 2CBSA 2OL7A 5HCEC 4CDFA 3RBYA 1VPRA 5HZ5A 2AKQA 1KGLA 4M7MA 1LPJA 2RTCB 1W4TA 1KT5A 3BY0A 2A2UA 4BX5B 1NDJA 4I3BA 4EXZA 2X46A 4ZJ0A 3MBTA 1MM9A 5C0NA 1SWUA 2JOZA 3P6FA 1VWEB 2OVEA 3APXA 1A57A 4ML7B 4HPCA 4NP1A 3KQ0A 1QFVA 1HMSA 2KT4B 3NQ9A 4K19A 2JU8A 4XMHA 4BX7B 1JMZA 1U0XA 3EBWA 5CYBA 4ORSA 1T68X 3NPOA 3SZHA 2C4IA 4L3RA 1SMPI 2C1QA 1STSB 1EIIA 4BQUA 3ZI8A 4XMFA 1W5RA 2R56A 4YFRA 2CZUA 2A0AA 5B5FA 1HMTA 2RTLA 4NLIA 1L6MA 1VWDB 2RTKA 1S7DA 1IFCA 3VE1A 3ZW1A 3CWKA 3NQKA 3Q34A 4O3XB 5DG4A 3VE2A 4CPHB 4Z2OA 5L3YA 4GU8A 2RD7C 1FJ1E 1PEEA 4BX7A 4LKTA 5D4AA 1SXYA 3C76X 4HPAA 2QO5A 3PH6A 2NNQA 3F9DA 4OS0A 4GK9A 3APUA 3NADA 4QYNA 1SWQA 2HZRA 4ZHCA 1LIDA 1BWYA 4I3CA 1GGLA 4ZHHA 2WEWA 2IZLB 4CDCA 1KL3A 1S44A 2L67A 5IRWA 4HPDA 4ARHA 2W2AA 5K68A 3QKGA 4M6SA 1T8VA 4QQ1A 1JIWI 3ZUIA 4KT5A 2ZSCA 4O3YA 5IXGA 1HXLA 1X8PA 4GZVA 5CHKA 4YGGA 3CKGA 4BX6B 1X89A 1GKAB 1VYOA 4ORYA 2JW1A 1AVGI 1STRB 4EDEA 3Q6LA 1GX9A 1CBQA 2ZAIA 1N9MA 5IO5A 3JSQA 4N7DA 1KT6A 3HOLA 3P6DA 3D95A 2Q9SA 5FQ7E 5LJBA 1I78A 1VWAB 3APVA 4IB8A 3T2WA 1JZUA 4BCSA 4C5PA 1RSTB 1SY3A 1GT5A 2L68A 4TQ2A 1SWFA 2GTLO 2K62A 5LKEA 1I9HA 3KZAA 3SLOA 4Z2PA 4HFOA 1N9YA 4LKPA 1ERBA 1EIOA 1ZNKA 2RTDB 4YGHA 2MHDA 3T6LA 2IZGB 1VWLB 3VG5A 1GKAA 1HQQA 2OF9A 5LJGA 3T2XA 3WYQA 3FW5A 4AYHA 2ASNX 3CMPA 4LZVA 4GGRA 3HPEA 2G78A 2JMBA 1I4UA 2HKDA 3D9WA 4GJVA 1YP6A 1N0SA 1GX3A 1N4JA 4HWMA 4KCAA 1LDQA 4NNTA 4DNEA 1O1UA 2FTBA 1BRPA 5HA0A 4Z27A 1SXXA 3FENA 3V8UA 1B4MA 2Q4NA 3GE2A 4YH0A 3MM0A 2RTRB 4CDDA 3OBLA 1DZJA 5FQ8E 4DQ3A 4BVMA 1PM1X 2RTNB 4Y0RA 1O1VA 1SWGA 1ZNGA 3F6ZB 1SWLA 1VWHB 3PPTA 3WVMA 4AZMA 2A2GA 5F6ZA 4O49A 2A13A 1Y52X 2I5ZO 2HLVA 2FWVA 1AVEA 2RCQA 3EW1A 4L1NA 3VHHA 4GRJA 3S26A 4CV7A 5JR8A 4ZCBA 2RTEB 2WEXA 5AJCA 4ZHFA 1H91A 1OSPO 4IAWA 3BX8A 1VWPB 1E06A 4MIRA 4IMNA 5AQ6A 1SRGA 3U9PC 1DZKA 1B0OA 4A60A 2WR6A 5K67A 3B2KA 1FTPA 5B5GA 3L4RA 2X55A 5FENA 2A8GA 1N7YA 4ZGFA 1EPBA 2POAA 1SWEA 2RCTA 1SLFB 2AH7X 2NNEA 4N7CA 4ZHGA 1IKJA 2BT9A 2Q2MA 1IJ8A 1Y53X 2FT9A 1JYDA 2Y3EA 3K3LA 4QAEA 2AT3X 3WJCA 2FR3A 3WYPA 1EW3A 2IZKA 2QMIA 2QOSC 4KC7A 4NNSA 2CAMA 1A18A 1BM5A 4O9SA 4Y0SA 2AT8X 2X8FA 3VHIA 2L5PA 1LCWA 3IA8A 4WFVA 2RTFB 2WUTA 1VWIB 2X8TA 4ODDA 3FEPA 5LKFA 3MX7A 4MISA 3RKGA 1RXJA 2IZCB 2OL8O 1GT4A 4BBOA 1DV9A 1G5WA 2UYWA 3P6GA 4PSQA 1EPAA 2QM9A 1SWBA 2DJFA 4QYPA 1O8VA 2Y3FA 2IZHB 1E2TA 2CM4A 3FR4A 5HZ9A 1YIVA 3IFBA 3UEWA 4KH8A 3PP6A 2VFCA 4JO6A 4U3QA 1SWHA 3ZW1B 4FQBB 2OYBO 1SRJA 2P8GA 2X32A 5HZ8A 4Z2VA 4IABA 4TKBA 1FDQA 1OBUA 2MJIA 3FEKA 5B10O 3RZYA 4XMCA 1A3YA 5BYPA 1HY2A 4WHIA 3O2YA 4TKHA 4MVIA 1WUBA 1GX8A 1JV4A 1LIFA 5FQ6E 1BSQA 1SRIA 1I05A 3RE5A 2LA7A 3WZPA 4XMDA 2FGSA 1RAVA 1RXHA 4AZNA 4JGLA 1DZMA 1FEMA 1NQMA 1QWDA 2JU3A 2OFAA 1MOYA 2RTAA 2RTMA 1KOIA 3EW2A 1SA8A 3FIQA 4IB6A 4RUUA 3FMZA 5EEDA 3E3CA 5FAZA 3VG6A 4D6BA 4CSBA 1G7NA 2RA6A 4WBKA 1NP1A 2BC3A 3JS1A 3KFHA 1NBXA 4U46A 1JBHA 1VWGB 3FA7A 1A2DA 2HYSA 1D2UA 2LB6A 3OE3A 2X4MA 3SLTA 2BHVA 4I9RA 2A3FX 1W6FA 2N93A 4TKJA 2IZFB 1X8OA 1HN2A 3O22A 4YFPA 2IZIA 2MF6A 1IIUA 3BRNA 1SLEB 3NBXX 4YDAA 3HOEA 5F6BA 3B2LA 1OPBA 4A1HA 4GH7A 1CBIA 1VWRB 2FRSA 4ORWA 5D45A 3RDXA 1YWBA 3RDMA 3VG7A 4O3WA 1KZWA 1KQWA 3SAOA 1SWOA 4ALBA 4IAXA 3PQSA 1KFFA 1SLDB 3SLJA 1SY0A 3BU9A 3FDCA 1SXUA 5CE4A 4AZPA 3VGWA 2AMMX 2YMSA 5D47A 3STNA 5KHPA 1X8QA 1LNMA 3CBSA 1VWKB 2FS7A 2Z4HA 5BVTA 1NGLA 5D48A 1VYGA 1RSUB 3G7XA 1JMXA 2MO5A 1XKIA 5HZ6A 2MWHA 2YG2A 2Q39A 2LBVA 4UU2A 2PI3O 3D96A 1GT1A 3P02A 5B11O 5EZ2A 1ZNEA 2OFMX 1MK5A 1N43A 1SWPA 2G79A 4YGZA 4AZRA 2OZQA 1BBPA 4IMOA 2GTLN 1K3BA 1PTSA 4QGXA 1X8UA 5B3MO 5LJCA 2OFBA 4XMGA 1EUOA 3EMMA 4PJ2A 1IW2A 3LHNA 2LBAA 3FR2A 3SZJA 1JQPA 2AVIA 2IFBA 3CQRA 2CBRA 5HBSA 3HWGA 1ICNA 2UZ2A 4NLJA 4TLJA 3CR6A 1YUPA 2OVSA 1R0UA 4U8UO 4QNIA 1KL5A 4EQAC 1QABE 4YBPA 4BOEA 4O4SA 5F7GA 2CZTA 2E4JA 3CKFA 4GNYA 1QY0A 3PDFA 1SWCA 4U8UN 1CJ5A 3ZW2A 1GM6A 1SLGB 2ZAGA 4A8ZA 3O19A 3P24A 5EPQA 5BVQA 2ALLX 2M4LA 2HZQA 4ZFXA 2BS6A 3ZQ3A 1VWNB 4IBAA 1G85A 2X56A 4O4UA 2F01A 1FELA 4MEEA 3ZUOA 1NQNA 3FW4A 1TXLA 1AQBA 1FE3A 2JU7A 3AEHA 1WBIA 3B2IA 3NX1A 1KT4A 4QGWA 5BVSA 1UYOX 4QRLA 3WZQA 4CPIA 2GTFX 3FA9A 3CBCA 1YWCA 4IB9A 3RDUA 3ELXA 1X71A 2OY7A 1TW4A 1SREA 4LZUA 3ELZA 5B2AO 2A5CA 3FYFA 4NV8A 1B56A 2A5BA 2R73A 2F73A 2KTSA 2OL6O 3OJYC 4GE1A 4ORUA 4I95A 4QZUA 5H9NA 3LV4A 1SWTA 2KTDA 3WOVA 1EXSA 1GXAA 2HNXA 3VU1A 1MEPA 1QG5A 4ORRA 4ZR2A 3T1DA 2KW1A 4HPBA 1LFOA 3TGCA 2G7BA 3D97A 5KICA 1PMPA 2Y32A 4I9SA 2AT6X 3UEUA 4CPFA 2C1SA 4Z28A 2AT0X 3AUMO 1RBPA 3PH5A 5IRAA 1SRFA 1G74A 4BJ8A 1VYFA 4GJSA 3FA6A 3VHMA 1BEBA 2RTQB 1SWAA 4TJZA 4YCEA 3S5XA 1JJJA 1EQDA 1GT3A 4AZOA 4COTA 5FFHA 1ERXA 3AKNA 4GNWA 4GKCA 4EEJA 2X8SA 3TGBA 3B2HA 3UEXA 1LIEA 1HMRA 4ON1A 1E02A 3EBKA 3WJEA 1TOUA 4NW4A 3NX2A 3RDQA 1KZXA 3UEVA 1KT3A 2DJGA 3GAQA 2JGSA 4MVKA 1JJUA 2AT5X 4EFGA 3HWEA 3HK1A 4GD9A 1TVQA 1OBPA 4GDAA 1SY2A 5LJDA 2O62A 2QOMA 3FR5A 3BU1A 4ES7A 1ALBA 1E5PA 4R0BA 3KFIA 2GH7A 2RTJA 1NC9A 1Z24A 2RTPB 2WQ9A 4ZH9A 2BSZA 2HMBA 4IB7A 1ACDA 3NP1A 4QZTA 4CDEA 2GTLM 2NNDA 2LFOA 4JHQA 5B29A 4MVLA 3ZW0B 5HZQA 1IKEA 1YWDA 3DTQA 1PBYA 1IFBA 1Y0GA 1SWDA 5LJKA 1RLBE 4XMEA 1UZ2X 2NP1A 2ACPX 3C77X 5H9AA 3RE6A 2OFRX 2BS5A 2PY1A 2X45A 5D8JA 5EDBA 3WBGA 1MX7A 5K06A 3TZSA 4O3ZA
chains in the Genus database with same CATH topology
1HBQA 2AL0X 1OPAA 1ML7A 4WFUA 3PEDA 1MX8A 1KQXA 2QO6A 4U8UM 2RN4A 4OS3A 5HCCC 3ZW0A 5HCDC 1ICMA 1LKEA 1XCAA 2ACOA 2W2BA 1JJXA 1Y9LA 3APWA 4FBVA 1BJ7A 3WJDA 1SXWA 5L8IA 3PECA 3BSZE 2W2FA 1NP4A 1QFTA 4GETA 5HAEA 4ZGUA 1CRBA 4MVEA 1LF7A 4TNNA 4ALOA 1YWAA 4YKOA 1E00A 1LICA 3FA8A 2Q2PA 1LIBA 1MDCA 2GJ5A 1MVGA 3SOTA 1KZWA 4DQ4A 1JYJA 3PQUA 4D6AA 4LQZA 3OD9A 3HWFA 5HA1A 3S60A 3WJFA 3STKA 5H9KA 2FR2A 2XSTA 2FS6A 3I0AA 1UREA 5AEOA 1ZNLA 3NR3A 5L8OA 1S2PA 2BLGA 1U18A 5H8TA 1BSOA 2FLJA 2F09A 4NYQA 1DC9A 1QQSA 3KFGA 4YKMA 4QGVA 2K23A 1P6PA 5IO7A 3U0DA 3TGAA 4AW8A 4I3DA 5LJEA 4YBUA 4OS8A 1DF3A 3N91A 1HBPA 4O4XA 1YP7A 2Z4IA 4INNA 1T0VA 3WJGA 5F1EA 1OEKA 3BX7A 4RUNA 5B27A 3VPJE 4KC8A 4UU3A 1I06A 3EYCA 1QY2A 1QY1A 4ORXA 1Y9TA 5HWZA 3ZZVA 3H3IA 1KT7A 4OMWA 1DZPA 4Y0PA 5AJBA 5F58A 1ZNHA 4FGIB 4YDBA 1I04A 2DM5A 4NYRA 1CBRA 4FBRA 5HTDA 1CBSA 4AZQA 2MM3A 5IO6A 2ANSA 5H9LA 3MVFA 3BS2A 1B8EA 2LKKA 2CM9A 5LJHA 4O4OA 3AKMA 2WQAE 3JQOA 2KD2A 3UAQA 4YMYA 1BLRA 4YFQA 2WWPA 4U9CA 1KXOA 3U03A 3P6CA 3HWDA 2XKLA 2GC9A 5EEEA 3VG3A 3HTYA 1SY1A 3VG2A 2OVAA 1AELA 3I17A 3BDRA 3EM0A 3DSZA 3C78X 1BRQA 4ZHDA 1BSYA 2OVDA 1HQPA 3FLLA 3FELA 3ZWEA 3STMX 4CK4A 3TF6A 2WSJA 1TOWA 3B2JA 1OEEA 1PBOA 1D3SA 3KFFA 2JN3A 3D4RA 4I6SA 5KIDA 1MUPA 1ADLA 4ID2A 1EI5A 5HTEA 3RWXA 2RQ0A 1ZNDA 1U17A 5DPQA 3BLGA 4ZH6A 4YCHA 1OEJA 4KIIA 5EDCA 3WJBA 1FENA 2EU7X 3RSWA 3S5VA 4FBOA 3NQ3A 2L9CA 3CQNA 3VG4A 1OBQA 2R74A 1X8NA 4OMXA 1DFVA 3WXQA 4GDZA 1EALA 3P6EA 1AB0A 2QO4A 4A1YA 3P6HA 1ZRYA 3F8AA 5HZ5A 2CBSA 5HCEC 3RBYA 1VPRA 2AKQA 1KGLA 4M7MA 1LPJA 3BY0A 1KT5A 4ZJ0A 2A2UA 4I3BA 4EXZA 2X46A 3MBTA 5C0NA 2JOZA 3P6FA 2OVEA 3APXA 1A57A 4ML7B 4HPCA 4NP1A 3KQ0A 1QFVA 1HMSA 2KT4B 3NQ9A 4K19A 2JU8A 4XMHA 1U0XA 3EBWA 5CYBA 4ORSA 1T68X 3NPOA 4L3RA 1SMPI 1EIIA 4BQUA 3ZI8A 4XMFA 2R56A 4YFRA 2CZUA 2A0AA 1HMTA 4NLIA 1L6MA 1S7DA 1IFCA 3VE1A 3ZW1A 3CWKA 3NQKA 4O3XB 5DG4A 3VE2A 4GU8A 2RD7C 1PEEA 4LKTA 5D4AA 1SXYA 3C76X 4HPAA 2QO5A 3PH6A 2NNQA 3F9DA 4OS0A 4GK9A 3APUA 3NADA 4QYNA 2HZRA 4ZHCA 1LIDA 1BWYA 4I3CA 1GGLA 4ZHHA 2WEWA 1S44A 2L67A 4HPDA 4ARHA 2W2AA 3QKGA 4M6SA 1T8VA 4QQ1A 1JIWI 3ZUIA 4KT5A 4O3YA 1X8PA 4GZVA 4YGGA 1X89A 1GKAB 4ORYA 2JW1A 1AVGI 4EDEA 3Q6LA 1GX9A 1CBQA 2ZAIA 5IO5A 3JSQA 4N7DA 1KT6A 3HOLA 3P6DA 3D95A 2Q9SA 5FQ7E 5LJBA 1JZUA 3APVA 4IB8A 1SY3A 4TQ2A 1GT5A 2L68A 2K62A 2GTLO 5LKEA 3KZAA 4HFOA 4LKPA 1ERBA 1EIOA 1ZNKA 4YGHA 2MHDA 3VG5A 1GKAA 5LJGA 3FW5A 4AYHA 2ASNX 3CMPA 4LZVA 2G78A 2JMBA 1I4UA 4HWMA 4KCAA 1YP6A 1N0SA 4NNTA 1O1UA 2FTBA 1BRPA 5HA0A 1SXXA 3FENA 3V8UA 1B4MA 2Q4NA 3GE2A 4YH0A 3OBLA 1DZJA 5FQ8E 4DQ3A 4BVMA 1PM1X 4Y0RA 1O1VA 3F6ZB 1ZNGA 3PPTA 3WVMA 4AZMA 2A2GA 5F6ZA 4O49A 2A13A 2RCQA 2HLVA 2FWVA 4L1NA 4GRJA 3S26A 4CV7A 5JR8A 4ZCBA 2WEXA 5AJCA 4ZHFA 1H91A 4IAWA 3BX8A 1E06A 4MIRA 4IMNA 5AQ6A 3U9PC 4A60A 1DZKA 1B0OA 2WR6A 3B2KA 1FTPA 3L4RA 5FENA 4ZGFA 1EPBA 2POAA 2RCTA 2AH7X 2NNEA 4N7CA 4ZHGA 1IKJA 2BT9A 2Q2MA 2FT9A 1JYDA 3K3LA 4QAEA 2AT3X 3WJCA 2FR3A 1EW3A 2QMIA 4KC7A 2QOSC 4NNSA 1A18A 1BM5A 4O9SA 4Y0SA 2AT8X 2X8FA 2L5PA 3IA8A 4WFVA 2WUTA 2X8TA 4ODDA 5LKFA 3FEPA 3MX7A 4MISA 3RKGA 1GT4A 1DV9A 1G5WA 3P6GA 4PSQA 1EPAA 2QM9A 5HZ9A 4QYPA 1O8VA 3FR4A 2CM4A 1YIVA 3IFBA 3UEWA 4KH8A 3PP6A 4U3QA 3ZW1B 4FQBB 2P8GA 5HZ8A 4IABA 4TKBA 1FDQA 1OBUA 2MJIA 3FEKA 3RZYA 4XMCA 1A3YA 5BYPA 4WHIA 3O2YA 4TKHA 4MVIA 1GX8A 1JV4A 1LIFA 5FQ6E 1BSQA 1I05A 2LA7A 4XMDA 4AZNA 4JGLA 1DZMA 1FEMA 5L8NA 1QWDA 2JU3A 3FIQA 4GE1A 4IB6A 1KOIA 1SA8A 5FAZA 4RUUA 3FMZA 5EEDA 3E3CA 3VG6A 4D6BA 4CSBA 1G7NA 2RA6A 4WBKA 1NP1A 3JS1A 3KFHA 1JBHA 3FA7A 1A2DA 2HYSA 1D2UA 2LB6A 3OE3A 2BHVA 4I9RA 2A3FX 4Y0QA 2N93A 4TKJA 4YFPA 1X8OA 1HN2A 3O22A 3BRNA 1IIUA 3NBXX 4YDAA 3HOEA 5F6BA 3B2LA 1OPBA 4A1HA 4GH7A 1CBIA 4ORWA 2FRSA 5D45A 3VG7A 1YWBA 4O3WA 1KQWA 3SAOA 4ALBA 4IAXA 3PQSA 1SY0A 3BU9A 1SXUA 5CE4A 4AZPA 2AMMX 2YMSA 5D47A 3STNA 5KHPA 1X8QA 1LNMA 3CBSA 2FS7A 2Z4HA 5BVTA 1NGLA 5D48A 1VYGA 3G7XA 2MO5A 1XKIA 5HZ6A 2MWHA 2YG2A 2Q39A 2LBVA 4UU2A 3D96A 3P02A 1GT1A 5EZ2A 1ZNEA 2OFMX 2G79A 4YGZA 4AZRA 2OZQA 1BBPA 4IMOA 2GTLN 4QGXA 1X8UA 5LJCA 4XMGA 1EUOA 3EMMA 4PJ2A 1IW2A 3LHNA 2LBAA 3FR2A 2IFBA 3CQRA 2CBRA 5HBSA 3HWGA 1ICNA 4NLJA 4TLJA 3CR6A 1YUPA 2OVSA 1R0UA 4U8UO 4QNIA 4EQAC 1QABE 4YBPA 4BOEA 4O4SA 5F7GA 2CZTA 2E4JA 4GNYA 1QY0A 1CJ5A 4U8UN 3ZW2A 1GM6A 4A8ZA 2ZAGA 3O19A 3P24A 5EPQA 5BVQA 2ALLX 2M4LA 2HZQA 4ZFXA 2BS6A 3ZQ3A 4IBAA 1G85A 4O4UA 1FELA 3ZUOA 3FW4A 1TXLA 1AQBA 1FE3A 2JU7A 3B2IA 4QGWA 3NX1A 1KT4A 5BVSA 4QRLA 2GTFX 3FA9A 3CBCA 1YWCA 4IB9A 3ELXA 1X71A 1TW4A 4LZUA 3ELZA 3FYFA 1B56A 2R73A 3OJYC 2F73A 2KTSA 4ORUA 4I95A 4QZUA 5H9NA 3LV4A 2KTDA 3WOVA 1EXSA 1GXAA 2HNXA 3VU1A 1QG5A 4ORRA 4ZR2A 3T1DA 2KW1A 4HPBA 1LFOA 3TGCA 2G7BA 3D97A 5KICA 1PMPA 4I9SA 2AT6X 3UEUA 2AT0X 1RBPA 3PH5A 1G74A 1VYFA 3FA6A 1BEBA 1JJJA 4YCEA 4TJZA 3S5XA 1EQDA 1GT3A 4AZOA 4COTA 5FFHA 1ERXA 3AKNA 4GNWA 4GKCA 4EEJA 2X8SA 3TGBA 3B2HA 3UEXA 1LIEA 1HMRA 4ON1A 1E02A 3EBKA 3WJEA 1TOUA 4NW4A 3NX2A 1KZXA 3UEVA 1KT3A 3GAQA 4MVKA 2AT5X 4EFGA 3HWEA 3HK1A 1TVQA 1OBPA 1SY2A 5LJDA 2O62A 3FR5A 4ES7A 3BU1A 1ALBA 1E5PA 4R0BA 3KFIA 4ZH9A 2WQ9A 1Z24A 2HMBA 4IB7A 1ACDA 3NP1A 4QZTA 5B29A 2GTLM 2NNDA 2LFOA 4MVLA 3ZW0B 5HZQA 1IKEA 1YWDA 3DTQA 1IFBA 5LJKA 1RLBE 4XMEA 1UZ2X 2NP1A 2ACPX 3C77X 5H9AA 2OFRX 2BS5A 2PY1A 2X45A 5D8JA 5EDBA 3WBGA 1MX7A 5K06A 3TZSA 4O3ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HBQ A;  2AL0 X;  1OPA A;  1ML7 A;  4WFU A;  3PED A;  1MX8 A;  1KQX A;  2QO6 A;  4OS3 A;  5HCC C;  5HCD C;  1ICM A;  1LKE A;  1XCA A;  2ACO A;  2W2B A;  1JJX A;  3APW A;  1BJ7 A;  3WJD A;  1SXW A;  5L8I A;  3PEC A;  3BSZ E;  2W2F A;  1NP4 A;  1QFT A;  4GET A;  5HAE A;  4ZGU A;  1CRB A;  1LF7 A;  4TNN A;  4ALO A;  1YWA A;  4YKO A;  1E00 A;  1LIC A;  3FA8 A;  2Q2P A;  1LIB A;  1MDC A;  2GJ5 A;  1MVG A;  1KZW A;  4DQ4 A;  1JYJ A;  4D6A A;  3HWF A;  5HA1 A;  3WJF A;  3STK A;  5H9K A;  2FR2 A;  2XST A;  2FS6 A;  3I0A A;  1URE A;  1ZNL A;  3NR3 A;  5L8O A;  1S2P A;  2BLG A;  1U18 A;  5H8T A;  1BSO A;  2FLJ A;  4NYQ A;  1DC9 A;  1QQS A;  3KFG A;  4YKM A;  4QGV A;  2K23 A;  1P6P A;  5IO7 A;  3U0D A;  3TGA A;  4AW8 A;  4I3D A;  5LJE A;  4YBU A;  4OS8 A;  1DF3 A;  1HBP A;  1YP7 A;  1T0V A;  3WJG A;  5F1E A;  1OEK A;  3BX7 A;  4RUN A;  5B27 A;  4UU3 A;  1I06 A;  3EYC A;  1QY2 A;  1QY1 A;  4ORX A;  5HWZ A;  1KT7 A;  4OMW A;  1DZP A;  4Y0P A;  5F58 A;  1ZNH A;  4YDB A;  1I04 A;  2DM5 A;  4NYR A;  1CBR A;  5HTD A;  1CBS A;  4AZQ A;  2MM3 A;  5IO6 A;  2ANS A;  5H9L A;  3MVF A;  3BS2 A;  1B8E A;  2LKK A;  2CM9 A;  5LJH A;  3AKM A;  2WQA E;  1BLR A;  4YMY A;  4YFQ A;  2WWP A;  1KXO A;  3U03 A;  3P6C A;  3HWD A;  2XKL A;  2GC9 A;  5EEE A;  3VG3 A;  1SY1 A;  3VG2 A;  2OVA A;  1AEL A;  3I17 A;  3BDR A;  3EM0 A;  3DSZ A;  3C78 X;  1BRQ A;  4ZHD A;  1BSY A;  2OVD A;  1HQP A;  3FLL A;  3FEL A;  3STM X;  4CK4 A;  3TF6 A;  2WSJ A;  1TOW A;  3B2J A;  1OEE A;  1PBO A;  1D3S A;  3KFF A;  2JN3 A;  5KID A;  1MUP A;  1ADL A;  5HTE A;  2RQ0 A;  1ZND A;  1U17 A;  5DPQ A;  3BLG A;  4ZH6 A;  4YCH A;  1OEJ A;  4KII A;  5EDC A;  3WJB A;  1FEN A;  2EU7 X;  3RSW A;  3NQ3 A;  2L9C A;  3CQN A;  3VG4 A;  1OBQ A;  2R74 A;  1X8N A;  4OMX A;  1DFV A;  3WXQ A;  1EAL A;  3P6E A;  1AB0 A;  2QO4 A;  4A1Y A;  3P6H A;  1ZRY A;  3F8A A;  5HZ5 A;  2CBS A;  5HCE C;  1VPR A;  2AKQ A;  1KGL A;  4M7M A;  1LPJ A;  3BY0 A;  1KT5 A;  4ZJ0 A;  2A2U A;  4I3B A;  4EXZ A;  2X46 A;  3MBT A;  5C0N A;  2JOZ A;  3P6F A;  2OVE A;  3APX A;  1A57 A;  4HPC A;  4NP1 A;  3KQ0 A;  1QFV A;  1HMS A;  2KT4 B;  3NQ9 A;  4K19 A;  2JU8 A;  4XMH A;  1U0X A;  3EBW A;  4ORS A;  1T68 X;  3NPO A;  1EII A;  4BQU A;  4XMF A;  2R56 A;  4YFR A;  2CZU A;  2A0A A;  1HMT A;  4NLI A;  1L6M A;  1S7D A;  1IFC A;  3CWK A;  5DG4 A;  2RD7 C;  1PEE A;  4LKT A;  5D4A A;  1SXY A;  3C76 X;  4HPA A;  2QO5 A;  3PH6 A;  2NNQ A;  3F9D A;  4OS0 A;  3APU A;  3NAD A;  4QYN A;  2HZR A;  4ZHC A;  1LID A;  1BWY A;  4I3C A;  1GGL A;  4ZHH A;  2WEW A;  1S44 A;  2L67 A;  4HPD A;  4ARH A;  2W2A A;  3QKG A;  4M6S A;  1T8V A;  3ZUI A;  1X8P A;  4YGG A;  1X89 A;  1GKA B;  4ORY A;  1AVG I;  4EDE A;  3Q6L A;  1GX9 A;  1CBQ A;  5IO5 A;  3JSQ A;  4N7D A;  1KT6 A;  5LJB A;  3P6D A;  3D95 A;  2Q9S A;  1JZU A;  3APV A;  4IB8 A;  1SY3 A;  4TQ2 A;  1GT5 A;  2L68 A;  2K62 A;  5LKE A;  3KZA A;  4HFO A;  4LKP A;  1ERB A;  1EIO A;  1ZNK A;  4YGH A;  3VG5 A;  1GKA A;  5LJG A;  3FW5 A;  4AYH A;  2ASN X;  3CMP A;  4LZV A;  2G78 A;  1I4U A;  1YP6 A;  1N0S A;  4NNT A;  1O1U A;  2FTB A;  1BRP A;  5HA0 A;  1SXX A;  3FEN A;  1B4M A;  2Q4N A;  4YH0 A;  1DZJ A;  4DQ3 A;  4BVM A;  1PM1 X;  4Y0R A;  1O1V A;  1ZNG A;  3PPT A;  3WVM A;  4AZM A;  2A2G A;  5F6Z A;  2A13 A;  2RCQ A;  2HLV A;  2FWV A;  4GRJ A;  3S26 A;  5JR8 A;  4ZCB A;  2WEX A;  4ZHF A;  1H91 A;  4IAW A;  3BX8 A;  1E06 A;  4IMN A;  5AQ6 A;  3U9P C;  4A60 A;  1DZK A;  1B0O A;  2WR6 A;  3B2K A;  1FTP A;  3L4R A;  5FEN A;  1EPB A;  2POA A;  2RCT A;  2AH7 X;  2NNE A;  4N7C A;  4ZHG A;  1IKJ A;  2Q2M A;  2FT9 A;  1JYD A;  3K3L A;  4QAE A;  2AT3 X;  3WJC A;  2FR3 A;  1EW3 A;  4NNS A;  2QOS C;  1A18 A;  1BM5 A;  4O9S A;  4Y0S A;  2AT8 X;  2L5P A;  3IA8 A;  4WFV A;  2WUT A;  4ODD A;  5LKF A;  3FEP A;  1GT4 A;  1DV9 A;  1G5W A;  3P6G A;  4PSQ A;  1EPA A;  2QM9 A;  5HZ9 A;  4QYP A;  1O8V A;  3FR4 A;  2CM4 A;  1YIV A;  3IFB A;  3UEW A;  3PP6 A;  2P8G A;  5HZ8 A;  4TKB A;  1FDQ A;  1OBU A;  2MJI A;  3FEK A;  3RZY A;  4XMC A;  1A3Y A;  3O2Y A;  4TKH A;  4MVI A;  1GX8 A;  1JV4 A;  1LIF A;  1BSQ A;  1I05 A;  4XMD A;  4AZN A;  1DZM A;  1FEM A;  5L8N A;  1QWD A;  2JU3 A;  3FIQ A;  4GE1 A;  4IB6 A;  1KOI A;  1SA8 A;  5FAZ A;  4RUU A;  3FMZ A;  5EED A;  3VG6 A;  4D6B A;  1G7N A;  2RA6 A;  4WBK A;  1NP1 A;  3JS1 A;  3KFH A;  1JBH A;  3FA7 A;  1A2D A;  2HYS A;  1D2U A;  2LB6 A;  4I9R A;  4Y0Q A;  2A3F X;  4YFP A;  2N93 A;  4TKJ A;  1X8O A;  1HN2 A;  3O22 A;  3BRN A;  1IIU A;  4YDA A;  5F6B A;  3B2L A;  1OPB A;  4A1H A;  4GH7 A;  1CBI A;  4ORW A;  2FRS A;  5D45 A;  3VG7 A;  1YWB A;  1KQW A;  3SAO A;  4ALB A;  4IAX A;  1SY0 A;  3BU9 A;  1SXU A;  5CE4 A;  4AZP A;  2AMM X;  5D47 A;  3STN A;  5KHP A;  1X8Q A;  1LNM A;  3CBS A;  2FS7 A;  5BVT A;  1NGL A;  5D48 A;  1VYG A;  3G7X A;  2MO5 A;  1XKI A;  5HZ6 A;  2YG2 A;  2LBV A;  2Q39 A;  4UU2 A;  3D96 A;  1GT1 A;  5EZ2 A;  1ZNE A;  2OFM X;  2G79 A;  4YGZ A;  4AZR A;  2OZQ A;  1BBP A;  4IMO A;  4QGX A;  1X8U A;  5LJC A;  4XMG A;  1EUO A;  3EMM A;  1IW2 A;  2LBA A;  3FR2 A;  2IFB A;  3CQR A;  2CBR A;  5HBS A;  3HWG A;  1ICN A;  4NLJ A;  4TLJ A;  3CR6 A;  1YUP A;  1R0U A;  1QAB E;  4YBP A;  4BOE A;  5F7G A;  2CZT A;  2E4J A;  4GNY A;  1QY0 A;  1CJ5 A;  1GM6 A;  4A8Z A;  3O19 A;  5EPQ A;  5BVQ A;  2ALL X;  2HZQ A;  4ZFX A;  3ZQ3 A;  4IBA A;  1G85 A;  1FEL A;  3ZUO A;  3FW4 A;  1TXL A;  1AQB A;  1FE3 A;  2JU7 A;  3B2I A;  4QGW A;  3NX1 A;  1KT4 A;  5BVS A;  2GTF X;  3FA9 A;  3CBC A;  1YWC A;  4IB9 A;  3ELX A;  1X71 A;  1TW4 A;  4LZU A;  3ELZ A;  1B56 A;  2R73 A;  3OJY C;  2F73 A;  4ORU A;  4QZU A;  5H9N A;  2KTD A;  1EXS A;  1GXA A;  2HNX A;  1QG5 A;  4ORR A;  4ZR2 A;  3T1D A;  4HPB A;  1LFO A;  3TGC A;  2G7B A;  3D97 A;  5KIC A;  1PMP A;  4I9S A;  2AT6 X;  3UEU A;  2AT0 X;  1RBP A;  3PH5 A;  1G74 A;  1VYF A;  3FA6 A;  1BEB A;  1JJJ A;  4YCE A;  4TJZ A;  1EQD A;  1GT3 A;  4AZO A;  5FFH A;  1ERX A;  3AKN A;  4GNW A;  4GKC A;  4EEJ A;  3TGB A;  3B2H A;  3UEX A;  1LIE A;  1HMR A;  1E02 A;  3EBK A;  3WJE A;  1TOU A;  1KZX A;  3NX2 A;  3UEV A;  1KT3 A;  3GAQ A;  4MVK A;  2AT5 X;  4EFG A;  3HWE A;  3HK1 A;  1TVQ A;  1OBP A;  1SY2 A;  5LJD A;  2O62 A;  3FR5 A;  4ES7 A;  3BU1 A;  1ALB A;  1E5P A;  4R0B A;  3KFI A;  4ZH9 A;  2WQ9 A;  1Z24 A;  2HMB A;  4IB7 A;  1ACD A;  3NP1 A;  4QZT A;  5B29 A;  2NND A;  2LFO A;  4MVL A;  5HZQ A;  1IKE A;  1YWD A;  3DTQ A;  1IFB A;  5LJK A;  1RLB E;  4XME A;  1UZ2 X;  2NP1 A;  2ACP X;  3C77 X;  5H9A A;  2OFR X;  2X45 A;  2PY1 A;  5D8J A;  5EDB A;  3WBG A;  1MX7 A;  5K06 A;  3TZS A; 
#chains in the Genus database with same CATH topology
 1HBQ A;  1RXK A;  1LCV A;  1Y55 X;  2AL0 X;  4EKV A;  1VWF B;  1OPA A;  1ML7 A;  4WFU A;  3PED A;  1MX8 A;  1KQX A;  2QO6 A;  4U8U M;  2RN4 A;  4OS3 A;  1LCZ A;  3ZW0 A;  5HCC C;  5HCD C;  1ICM A;  1LKE A;  1XCA A;  2ACO A;  2W2B A;  1JJX A;  1Y9L A;  3APW A;  5L8N A;  4FBV A;  1BJ7 A;  3WJD A;  1SXW A;  5L8I A;  3PEC A;  3BSZ E;  2W2F A;  1NP4 A;  1QFT A;  4GET A;  4CPE A;  5HAE A;  4ZGU A;  1CRB A;  3EC5 A;  4BX5 A;  4MVE A;  2FKJ A;  1LF7 A;  4TNN A;  4ALO A;  1YWA A;  2IZB A;  1E00 A;  1LIC A;  1LUQ A;  2QCB A;  3FA8 A;  2Q2P A;  4YKO A;  1LIB A;  1MDC A;  2GJ5 A;  1MVG A;  2RTH B;  1SRH A;  1SWJ A;  3LTW A;  3SOT A;  4DQ4 A;  1JYJ A;  3PQU A;  4D6A A;  4LQZ A;  4Z6J A;  3OD9 A;  3RDO A;  1KL4 A;  2RTB B;  3HWF A;  5HA1 A;  3S60 A;  3WJF A;  3PK2 A;  5H9K A;  2FR2 A;  2OY5 O;  2OY8 A;  2XST A;  3STK A;  3X00 A;  3WZO A;  2FS6 A;  3I0A A;  1URE A;  5AEO A;  1K24 A;  1ZNL A;  3NR3 A;  4DCB A;  5L8O A;  2OY1 O;  1VWQ B;  1S2P A;  2BLG A;  1U18 A;  5H8T A;  1BSO A;  2FLJ A;  2AF5 A;  2OF8 A;  2F09 A;  4NYQ A;  1DC9 A;  1QQS A;  2G8C O;  3KFG A;  4Y5D A;  4YKM A;  2K23 A;  4QGV A;  2RTI B;  1P6P A;  4YVB A;  5IO7 A;  3U0D A;  3TGA A;  4AW8 A;  4CPH A;  4I3D A;  5LJE A;  4YBU A;  4Y59 A;  4OS8 A;  1DF3 A;  3N91 A;  1HBP A;  4O4X A;  1YP7 A;  2Z4I A;  4INN A;  1T0V A;  3FID A;  3WJG A;  4GUZ A;  1SWR A;  5F1E A;  1OEK A;  3BX7 A;  5F2B A;  4RUN A;  5B27 A;  3VPJ E;  1SWN A;  4KC8 A;  2VDF A;  4UU3 A;  1I06 A;  3EYC A;  1QY2 A;  4OEM A;  1QY1 A;  2IZA A;  4ORX A;  1Y9T A;  2I5V O;  5HWZ A;  3RY1 A;  3ZZV A;  3KVN A;  3H3I A;  3RY2 A;  1KT7 A;  2X34 A;  1HXZ A;  1DZP A;  2IZJ A;  4OMW A;  4Y0P A;  4Y0Q A;  4BX6 A;  5AJB A;  5F58 A;  1ZNH A;  2RTG B;  4FGI B;  4YDB A;  1I04 A;  2DM5 A;  4NYR A;  4OEL A;  1CBR A;  4FBR A;  3SZI A;  5HTD A;  1CBS A;  1LEL A;  4AZQ A;  2MM3 A;  5IO6 A;  2ANS A;  5H9L A;  3T6F A;  3MVF A;  3BS2 A;  1B8E A;  2LKK A;  2CM9 A;  5LJH A;  2VFB A;  3AKM A;  4O4O A;  2WQA E;  3JQO A;  2KD2 A;  4IRW A;  3UAQ A;  4YMY A;  1BLR A;  4YFQ A;  2WWP A;  4U9C A;  5JD2 A;  1KXO A;  3U03 A;  3P6C A;  3HWD A;  2XKL A;  2GC9 A;  5EEE A;  3VG3 A;  3HTY A;  1VWM B;  1SY1 A;  3VG2 A;  1AVD A;  2OVA A;  3MG5 A;  1AEL A;  3I17 A;  3BDR A;  3EM0 A;  3DSZ A;  3C78 X;  1BRQ A;  4ZHD A;  1BSY A;  2OVD A;  1HQP A;  1STP A;  3FEL A;  1UYN X;  3FLL A;  3ZWE A;  3STM X;  4CK4 A;  4NV7 A;  5CSE A;  3TF6 A;  2WSJ A;  1TOW A;  3B2J A;  1OEE A;  1VWC B;  1PBO A;  1DF8 A;  1D3S A;  3KFF A;  2JN3 A;  4OKA A;  4B55 A;  3D4R A;  4BGF A;  1SWS A;  3QQ2 A;  4I6S A;  5IRU A;  5KID A;  1MUP A;  2IZE B;  1ADL A;  4GGZ A;  4JNJ A;  4ID2 A;  1EI5 A;  5HTE A;  3RWX A;  2FHN X;  2RQ0 A;  1ZND A;  1U17 A;  2WPU A;  5DPQ A;  3BLG A;  1VWO B;  4ZH6 A;  4YCH A;  1OEJ A;  2FHL A;  2RTO B;  4KII A;  5EDC A;  3WJB A;  2G5L A;  1FEN A;  2EU7 X;  2FKG A;  3RSW A;  1VWJ B;  4FBO A;  3NQ3 A;  3S5V A;  2L9C A;  3CQN A;  3VG4 A;  1OBQ A;  2IZD B;  1X8N A;  2R74 A;  1DFV A;  4OMX A;  3WZN A;  1VWB B;  4I60 A;  3WXQ A;  4GDZ A;  1EAL A;  3P6E A;  1AB0 A;  2QO4 A;  1LDO A;  3P6H A;  1ZRY A;  3F8A A;  4GGT A;  3RDS A;  4A1Y A;  1SWK A;  2CBS A;  2OL7 A;  5HCE C;  4CDF A;  3RBY A;  1VPR A;  5HZ5 A;  2AKQ A;  1KGL A;  4M7M A;  1LPJ A;  2RTC B;  1W4T A;  1KT5 A;  3BY0 A;  2A2U A;  4BX5 B;  1NDJ A;  4I3B A;  4EXZ A;  2X46 A;  4ZJ0 A;  3MBT A;  1MM9 A;  5C0N A;  1SWU A;  2JOZ A;  3P6F A;  1VWE B;  2OVE A;  3APX A;  1A57 A;  4ML7 B;  4HPC A;  4NP1 A;  3KQ0 A;  1QFV A;  1HMS A;  2KT4 B;  3NQ9 A;  4K19 A;  2JU8 A;  4XMH A;  4BX7 B;  1JMZ A;  1U0X A;  3EBW A;  5CYB A;  4ORS A;  1T68 X;  3NPO A;  3SZH A;  2C4I A;  4L3R A;  1SMP I;  2C1Q A;  1STS B;  1EII A;  4BQU A;  3ZI8 A;  4XMF A;  1W5R A;  2R56 A;  4YFR A;  2CZU A;  2A0A A;  5B5F A;  1HMT A;  2RTL A;  4NLI A;  1L6M A;  1VWD B;  2RTK A;  1S7D A;  1IFC A;  3VE1 A;  3ZW1 A;  3CWK A;  3NQK A;  3Q34 A;  4O3X B;  5DG4 A;  3VE2 A;  4CPH B;  4Z2O A;  5L3Y A;  4GU8 A;  2RD7 C;  1FJ1 E;  1PEE A;  4BX7 A;  4LKT A;  5D4A A;  1SXY A;  3C76 X;  4HPA A;  2QO5 A;  3PH6 A;  2NNQ A;  3F9D A;  4OS0 A;  4GK9 A;  3APU A;  3NAD A;  4QYN A;  1SWQ A;  2HZR A;  4ZHC A;  1LID A;  1BWY A;  4I3C A;  1GGL A;  4ZHH A;  2WEW A;  2IZL B;  4CDC A;  1KL3 A;  1S44 A;  2L67 A;  5IRW A;  4HPD A;  4ARH A;  2W2A A;  5K68 A;  3QKG A;  4M6S A;  1T8V A;  4QQ1 A;  1JIW I;  3ZUI A;  4KT5 A;  2ZSC A;  4O3Y A;  5IXG A;  1HXL A;  1X8P A;  4GZV A;  5CHK A;  4YGG A;  3CKG A;  4BX6 B;  1X89 A;  1GKA B;  1VYO A;  4ORY A;  2JW1 A;  1AVG I;  1STR B;  4EDE A;  3Q6L A;  1GX9 A;  1CBQ A;  2ZAI A;  1N9M A;  5IO5 A;  3JSQ A;  4N7D A;  1KT6 A;  3HOL A;  3P6D A;  3D95 A;  2Q9S A;  5FQ7 E;  5LJB A;  1I78 A;  1VWA B;  3APV A;  4IB8 A;  3T2W A;  1JZU A;  4BCS A;  4C5P A;  1RST B;  1SY3 A;  1GT5 A;  2L68 A;  4TQ2 A;  1SWF A;  2GTL O;  2K62 A;  5LKE A;  1I9H A;  3KZA A;  3SLO A;  4Z2P A;  4HFO A;  1N9Y A;  4LKP A;  1ERB A;  1EIO A;  1ZNK A;  2RTD B;  4YGH A;  2MHD A;  3T6L A;  2IZG B;  1VWL B;  3VG5 A;  1GKA A;  1HQQ A;  2OF9 A;  5LJG A;  3T2X A;  3WYQ A;  3FW5 A;  4AYH A;  2ASN X;  3CMP A;  4LZV A;  4GGR A;  3HPE A;  2G78 A;  2JMB A;  1I4U A;  2HKD A;  3D9W A;  4GJV A;  1YP6 A;  1N0S A;  1GX3 A;  1N4J A;  4HWM A;  4KCA A;  1LDQ A;  4NNT A;  4DNE A;  1O1U A;  2FTB A;  1BRP A;  5HA0 A;  4Z27 A;  1SXX A;  3FEN A;  3V8U A;  1B4M A;  2Q4N A;  3GE2 A;  4YH0 A;  3MM0 A;  2RTR B;  4CDD A;  3OBL A;  1DZJ A;  5FQ8 E;  4DQ3 A;  4BVM A;  1PM1 X;  2RTN B;  4Y0R A;  1O1V A;  1SWG A;  1ZNG A;  3F6Z B;  1SWL A;  1VWH B;  3PPT A;  3WVM A;  4AZM A;  2A2G A;  5F6Z A;  4O49 A;  2A13 A;  1Y52 X;  2I5Z O;  2HLV A;  2FWV A;  1AVE A;  2RCQ A;  3EW1 A;  4L1N A;  3VHH A;  4GRJ A;  3S26 A;  4CV7 A;  5JR8 A;  4ZCB A;  2RTE B;  2WEX A;  5AJC A;  4ZHF A;  1H91 A;  1OSP O;  4IAW A;  3BX8 A;  1VWP B;  1E06 A;  4MIR A;  4IMN A;  5AQ6 A;  1SRG A;  3U9P C;  1DZK A;  1B0O A;  4A60 A;  2WR6 A;  5K67 A;  3B2K A;  1FTP A;  5B5G A;  3L4R A;  2X55 A;  5FEN A;  2A8G A;  1N7Y A;  4ZGF A;  1EPB A;  2POA A;  1SWE A;  2RCT A;  1SLF B;  2AH7 X;  2NNE A;  4N7C A;  4ZHG A;  1IKJ A;  2BT9 A;  2Q2M A;  1IJ8 A;  1Y53 X;  2FT9 A;  1JYD A;  2Y3E A;  3K3L A;  4QAE A;  2AT3 X;  3WJC A;  2FR3 A;  3WYP A;  1EW3 A;  2IZK A;  2QMI A;  2QOS C;  4KC7 A;  4NNS A;  2CAM A;  1A18 A;  1BM5 A;  4O9S A;  4Y0S A;  2AT8 X;  2X8F A;  3VHI A;  2L5P A;  1LCW A;  3IA8 A;  4WFV A;  2RTF B;  2WUT A;  1VWI B;  2X8T A;  4ODD A;  3FEP A;  5LKF A;  3MX7 A;  4MIS A;  3RKG A;  1RXJ A;  2IZC B;  2OL8 O;  1GT4 A;  4BBO A;  1DV9 A;  1G5W A;  2UYW A;  3P6G A;  4PSQ A;  1EPA A;  2QM9 A;  1SWB A;  2DJF A;  4QYP A;  1O8V A;  2Y3F A;  2IZH B;  1E2T A;  2CM4 A;  3FR4 A;  5HZ9 A;  1YIV A;  3IFB A;  3UEW A;  4KH8 A;  3PP6 A;  2VFC A;  4JO6 A;  4U3Q A;  1SWH A;  3ZW1 B;  4FQB B;  2OYB O;  1SRJ A;  2P8G A;  2X32 A;  5HZ8 A;  4Z2V A;  4IAB A;  4TKB A;  1FDQ A;  1OBU A;  2MJI A;  3FEK A;  5B10 O;  3RZY A;  4XMC A;  1A3Y A;  5BYP A;  1HY2 A;  4WHI A;  3O2Y A;  4TKH A;  4MVI A;  1WUB A;  1GX8 A;  1JV4 A;  1LIF A;  5FQ6 E;  1BSQ A;  1SRI A;  1I05 A;  3RE5 A;  2LA7 A;  3WZP A;  4XMD A;  2FGS A;  1RAV A;  1RXH A;  4AZN A;  4JGL A;  1DZM A;  1FEM A;  1NQM A;  1QWD A;  2JU3 A;  2OFA A;  1MOY A;  2RTA A;  2RTM A;  1KOI A;  3EW2 A;  1SA8 A;  3FIQ A;  4IB6 A;  4RUU A;  3FMZ A;  5EED A;  3E3C A;  5FAZ A;  3VG6 A;  4D6B A;  4CSB A;  1G7N A;  2RA6 A;  4WBK A;  1NP1 A;  2BC3 A;  3JS1 A;  3KFH A;  1NBX A;  4U46 A;  1JBH A;  1VWG B;  3FA7 A;  1A2D A;  2HYS A;  1D2U A;  2LB6 A;  3OE3 A;  2X4M A;  3SLT A;  2BHV A;  4I9R A;  2A3F X;  1W6F A;  2N93 A;  4TKJ A;  2IZF B;  1X8O A;  1HN2 A;  3O22 A;  4YFP A;  2IZI A;  2MF6 A;  1IIU A;  3BRN A;  1SLE B;  3NBX X;  4YDA A;  3HOE A;  5F6B A;  3B2L A;  1OPB A;  4A1H A;  4GH7 A;  1CBI A;  1VWR B;  2FRS A;  4ORW A;  5D45 A;  3RDX A;  1YWB A;  3RDM A;  3VG7 A;  4O3W A;  1KZW A;  1KQW A;  3SAO A;  1SWO A;  4ALB A;  4IAX A;  3PQS A;  1KFF A;  1SLD B;  3SLJ A;  1SY0 A;  3BU9 A;  3FDC A;  1SXU A;  5CE4 A;  4AZP A;  3VGW A;  2AMM X;  2YMS A;  5D47 A;  3STN A;  5KHP A;  1X8Q A;  1LNM A;  3CBS A;  1VWK B;  2FS7 A;  2Z4H A;  5BVT A;  1NGL A;  5D48 A;  1VYG A;  1RSU B;  3G7X A;  1JMX A;  2MO5 A;  1XKI A;  5HZ6 A;  2MWH A;  2YG2 A;  2Q39 A;  2LBV A;  4UU2 A;  2PI3 O;  3D96 A;  1GT1 A;  3P02 A;  5B11 O;  5EZ2 A;  1ZNE A;  2OFM X;  1MK5 A;  1N43 A;  1SWP A;  2G79 A;  4YGZ A;  4AZR A;  2OZQ A;  1BBP A;  4IMO A;  2GTL N;  1K3B A;  1PTS A;  4QGX A;  1X8U A;  5B3M O;  5LJC A;  2OFB A;  4XMG A;  1EUO A;  3EMM A;  4PJ2 A;  1IW2 A;  3LHN A;  2LBA A;  3FR2 A;  3SZJ A;  1JQP A;  2AVI A;  2IFB A;  3CQR A;  2CBR A;  5HBS A;  3HWG A;  1ICN A;  2UZ2 A;  4NLJ A;  4TLJ A;  3CR6 A;  1YUP A;  2OVS A;  1R0U A;  4U8U O;  4QNI A;  1KL5 A;  4EQA C;  1QAB E;  4YBP A;  4BOE A;  4O4S A;  5F7G A;  2CZT A;  2E4J A;  3CKF A;  4GNY A;  1QY0 A;  3PDF A;  1SWC A;  4U8U N;  1CJ5 A;  3ZW2 A;  1GM6 A;  1SLG B;  2ZAG A;  4A8Z A;  3O19 A;  3P24 A;  5EPQ A;  5BVQ A;  2ALL X;  2M4L A;  2HZQ A;  4ZFX A;  2BS6 A;  3ZQ3 A;  1VWN B;  4IBA A;  1G85 A;  2X56 A;  4O4U A;  2F01 A;  1FEL A;  4MEE A;  3ZUO A;  1NQN A;  3FW4 A;  1TXL A;  1AQB A;  1FE3 A;  2JU7 A;  3AEH A;  1WBI A;  3B2I A;  3NX1 A;  1KT4 A;  4QGW A;  5BVS A;  1UYO X;  4QRL A;  3WZQ A;  4CPI A;  2GTF X;  3FA9 A;  3CBC A;  1YWC A;  4IB9 A;  3RDU A;  3ELX A;  1X71 A;  2OY7 A;  1TW4 A;  1SRE A;  4LZU A;  3ELZ A;  5B2A O;  2A5C A;  3FYF A;  4NV8 A;  1B56 A;  2A5B A;  2R73 A;  2F73 A;  2KTS A;  2OL6 O;  3OJY C;  4GE1 A;  4ORU A;  4I95 A;  4QZU A;  5H9N A;  3LV4 A;  1SWT A;  2KTD A;  3WOV A;  1EXS A;  1GXA A;  2HNX A;  3VU1 A;  1MEP A;  1QG5 A;  4ORR A;  4ZR2 A;  3T1D A;  2KW1 A;  4HPB A;  1LFO A;  3TGC A;  2G7B A;  3D97 A;  5KIC A;  1PMP A;  2Y32 A;  4I9S A;  2AT6 X;  3UEU A;  4CPF A;  2C1S A;  4Z28 A;  2AT0 X;  3AUM O;  1RBP A;  3PH5 A;  5IRA A;  1SRF A;  1G74 A;  4BJ8 A;  1VYF A;  4GJS A;  3FA6 A;  3VHM A;  1BEB A;  2RTQ B;  1SWA A;  4TJZ A;  4YCE A;  3S5X A;  1JJJ A;  1EQD A;  1GT3 A;  4AZO A;  4COT A;  5FFH A;  1ERX A;  3AKN A;  4GNW A;  4GKC A;  4EEJ A;  2X8S A;  3TGB A;  3B2H A;  3UEX A;  1LIE A;  1HMR A;  4ON1 A;  1E02 A;  3EBK A;  3WJE A;  1TOU A;  4NW4 A;  3NX2 A;  3RDQ A;  1KZX A;  3UEV A;  1KT3 A;  2DJG A;  3GAQ A;  2JGS A;  4MVK A;  1JJU A;  2AT5 X;  4EFG A;  3HWE A;  3HK1 A;  4GD9 A;  1TVQ A;  1OBP A;  4GDA A;  1SY2 A;  5LJD A;  2O62 A;  2QOM A;  3FR5 A;  3BU1 A;  4ES7 A;  1ALB A;  1E5P A;  4R0B A;  3KFI A;  2GH7 A;  2RTJ A;  1NC9 A;  1Z24 A;  2RTP B;  2WQ9 A;  4ZH9 A;  2BSZ A;  2HMB A;  4IB7 A;  1ACD A;  3NP1 A;  4QZT A;  4CDE A;  2GTL M;  2NND A;  2LFO A;  4JHQ A;  5B29 A;  4MVL A;  3ZW0 B;  5HZQ A;  1IKE A;  1YWD A;  3DTQ A;  1PBY A;  1IFB A;  1Y0G A;  1SWD A;  5LJK A;  1RLB E;  4XME A;  1UZ2 X;  2NP1 A;  2ACP X;  3C77 X;  5H9A A;  3RE6 A;  2OFR X;  2BS5 A;  2PY1 A;  2X45 A;  5D8J A;  5EDB A;  3WBG A;  1MX7 A;  5K06 A;  3TZS A;  4O3Z A; 
#chains in the Genus database with same CATH homology
 1HBQ A;  2AL0 X;  1OPA A;  1ML7 A;  4WFU A;  3PED A;  1MX8 A;  1KQX A;  2QO6 A;  4U8U M;  2RN4 A;  4OS3 A;  5HCC C;  3ZW0 A;  5HCD C;  1ICM A;  1LKE A;  1XCA A;  2ACO A;  2W2B A;  1JJX A;  1Y9L A;  3APW A;  4FBV A;  1BJ7 A;  3WJD A;  1SXW A;  5L8I A;  3PEC A;  3BSZ E;  2W2F A;  1NP4 A;  1QFT A;  4GET A;  5HAE A;  4ZGU A;  1CRB A;  4MVE A;  1LF7 A;  4TNN A;  4ALO A;  1YWA A;  4YKO A;  1E00 A;  1LIC A;  3FA8 A;  2Q2P A;  1LIB A;  1MDC A;  2GJ5 A;  1MVG A;  3SOT A;  1KZW A;  4DQ4 A;  1JYJ A;  3PQU A;  4D6A A;  4LQZ A;  3OD9 A;  3HWF A;  5HA1 A;  3S60 A;  3WJF A;  3STK A;  5H9K A;  2FR2 A;  2XST A;  2FS6 A;  3I0A A;  1URE A;  5AEO A;  1ZNL A;  3NR3 A;  5L8O A;  1S2P A;  2BLG A;  1U18 A;  5H8T A;  1BSO A;  2FLJ A;  2F09 A;  4NYQ A;  1DC9 A;  1QQS A;  3KFG A;  4YKM A;  4QGV A;  2K23 A;  1P6P A;  5IO7 A;  3U0D A;  3TGA A;  4AW8 A;  4I3D A;  5LJE A;  4YBU A;  4OS8 A;  1DF3 A;  3N91 A;  1HBP A;  4O4X A;  1YP7 A;  2Z4I A;  4INN A;  1T0V A;  3WJG A;  5F1E A;  1OEK A;  3BX7 A;  4RUN A;  5B27 A;  3VPJ E;  4KC8 A;  4UU3 A;  1I06 A;  3EYC A;  1QY2 A;  1QY1 A;  4ORX A;  1Y9T A;  5HWZ A;  3ZZV A;  3H3I A;  1KT7 A;  4OMW A;  1DZP A;  4Y0P A;  5AJB A;  5F58 A;  1ZNH A;  4FGI B;  4YDB A;  1I04 A;  2DM5 A;  4NYR A;  1CBR A;  4FBR A;  5HTD A;  1CBS A;  4AZQ A;  2MM3 A;  5IO6 A;  2ANS A;  5H9L A;  3MVF A;  3BS2 A;  1B8E A;  2LKK A;  2CM9 A;  5LJH A;  4O4O A;  3AKM A;  2WQA E;  3JQO A;  2KD2 A;  3UAQ A;  4YMY A;  1BLR A;  4YFQ A;  2WWP A;  4U9C A;  1KXO A;  3U03 A;  3P6C A;  3HWD A;  2XKL A;  2GC9 A;  5EEE A;  3VG3 A;  3HTY A;  1SY1 A;  3VG2 A;  2OVA A;  1AEL A;  3I17 A;  3BDR A;  3EM0 A;  3DSZ A;  3C78 X;  1BRQ A;  4ZHD A;  1BSY A;  2OVD A;  1HQP A;  3FLL A;  3FEL A;  3ZWE A;  3STM X;  4CK4 A;  3TF6 A;  2WSJ A;  1TOW A;  3B2J A;  1OEE A;  1PBO A;  1D3S A;  3KFF A;  2JN3 A;  3D4R A;  4I6S A;  5KID A;  1MUP A;  1ADL A;  4ID2 A;  1EI5 A;  5HTE A;  3RWX A;  2RQ0 A;  1ZND A;  1U17 A;  5DPQ A;  3BLG A;  4ZH6 A;  4YCH A;  1OEJ A;  4KII A;  5EDC A;  3WJB A;  1FEN A;  2EU7 X;  3RSW A;  3S5V A;  4FBO A;  3NQ3 A;  2L9C A;  3CQN A;  3VG4 A;  1OBQ A;  2R74 A;  1X8N A;  4OMX A;  1DFV A;  3WXQ A;  4GDZ A;  1EAL A;  3P6E A;  1AB0 A;  2QO4 A;  4A1Y A;  3P6H A;  1ZRY A;  3F8A A;  5HZ5 A;  2CBS A;  5HCE C;  3RBY A;  1VPR A;  2AKQ A;  1KGL A;  4M7M A;  1LPJ A;  3BY0 A;  1KT5 A;  4ZJ0 A;  2A2U A;  4I3B A;  4EXZ A;  2X46 A;  3MBT A;  5C0N A;  2JOZ A;  3P6F A;  2OVE A;  3APX A;  1A57 A;  4ML7 B;  4HPC A;  4NP1 A;  3KQ0 A;  1QFV A;  1HMS A;  2KT4 B;  3NQ9 A;  4K19 A;  2JU8 A;  4XMH A;  1U0X A;  3EBW A;  5CYB A;  4ORS A;  1T68 X;  3NPO A;  4L3R A;  1SMP I;  1EII A;  4BQU A;  3ZI8 A;  4XMF A;  2R56 A;  4YFR A;  2CZU A;  2A0A A;  1HMT A;  4NLI A;  1L6M A;  1S7D A;  1IFC A;  3VE1 A;  3ZW1 A;  3CWK A;  3NQK A;  4O3X B;  5DG4 A;  3VE2 A;  4GU8 A;  2RD7 C;  1PEE A;  4LKT A;  5D4A A;  1SXY A;  3C76 X;  4HPA A;  2QO5 A;  3PH6 A;  2NNQ A;  3F9D A;  4OS0 A;  4GK9 A;  3APU A;  3NAD A;  4QYN A;  2HZR A;  4ZHC A;  1LID A;  1BWY A;  4I3C A;  1GGL A;  4ZHH A;  2WEW A;  1S44 A;  2L67 A;  4HPD A;  4ARH A;  2W2A A;  3QKG A;  4M6S A;  1T8V A;  4QQ1 A;  1JIW I;  3ZUI A;  4KT5 A;  4O3Y A;  1X8P A;  4GZV A;  4YGG A;  1X89 A;  1GKA B;  4ORY A;  2JW1 A;  1AVG I;  4EDE A;  3Q6L A;  1GX9 A;  1CBQ A;  2ZAI A;  5IO5 A;  3JSQ A;  4N7D A;  1KT6 A;  3HOL A;  3P6D A;  3D95 A;  2Q9S A;  5FQ7 E;  5LJB A;  1JZU A;  3APV A;  4IB8 A;  1SY3 A;  4TQ2 A;  1GT5 A;  2L68 A;  2K62 A;  2GTL O;  5LKE A;  3KZA A;  4HFO A;  4LKP A;  1ERB A;  1EIO A;  1ZNK A;  4YGH A;  2MHD A;  3VG5 A;  1GKA A;  5LJG A;  3FW5 A;  4AYH A;  2ASN X;  3CMP A;  4LZV A;  2G78 A;  2JMB A;  1I4U A;  4HWM A;  4KCA A;  1YP6 A;  1N0S A;  4NNT A;  1O1U A;  2FTB A;  1BRP A;  5HA0 A;  1SXX A;  3FEN A;  3V8U A;  1B4M A;  2Q4N A;  3GE2 A;  4YH0 A;  3OBL A;  1DZJ A;  5FQ8 E;  4DQ3 A;  4BVM A;  1PM1 X;  4Y0R A;  1O1V A;  3F6Z B;  1ZNG A;  3PPT A;  3WVM A;  4AZM A;  2A2G A;  5F6Z A;  4O49 A;  2A13 A;  2RCQ A;  2HLV A;  2FWV A;  4L1N A;  4GRJ A;  3S26 A;  4CV7 A;  5JR8 A;  4ZCB A;  2WEX A;  5AJC A;  4ZHF A;  1H91 A;  4IAW A;  3BX8 A;  1E06 A;  4MIR A;  4IMN A;  5AQ6 A;  3U9P C;  4A60 A;  1DZK A;  1B0O A;  2WR6 A;  3B2K A;  1FTP A;  3L4R A;  5FEN A;  4ZGF A;  1EPB A;  2POA A;  2RCT A;  2AH7 X;  2NNE A;  4N7C A;  4ZHG A;  1IKJ A;  2BT9 A;  2Q2M A;  2FT9 A;  1JYD A;  3K3L A;  4QAE A;  2AT3 X;  3WJC A;  2FR3 A;  1EW3 A;  2QMI A;  4KC7 A;  2QOS C;  4NNS A;  1A18 A;  1BM5 A;  4O9S A;  4Y0S A;  2AT8 X;  2X8F A;  2L5P A;  3IA8 A;  4WFV A;  2WUT A;  2X8T A;  4ODD A;  5LKF A;  3FEP A;  3MX7 A;  4MIS A;  3RKG A;  1GT4 A;  1DV9 A;  1G5W A;  3P6G A;  4PSQ A;  1EPA A;  2QM9 A;  5HZ9 A;  4QYP A;  1O8V A;  3FR4 A;  2CM4 A;  1YIV A;  3IFB A;  3UEW A;  4KH8 A;  3PP6 A;  4U3Q A;  3ZW1 B;  4FQB B;  2P8G A;  5HZ8 A;  4IAB A;  4TKB A;  1FDQ A;  1OBU A;  2MJI A;  3FEK A;  3RZY A;  4XMC A;  1A3Y A;  5BYP A;  4WHI A;  3O2Y A;  4TKH A;  4MVI A;  1GX8 A;  1JV4 A;  1LIF A;  5FQ6 E;  1BSQ A;  1I05 A;  2LA7 A;  4XMD A;  4AZN A;  4JGL A;  1DZM A;  1FEM A;  5L8N A;  1QWD A;  2JU3 A;  3FIQ A;  4GE1 A;  4IB6 A;  1KOI A;  1SA8 A;  5FAZ A;  4RUU A;  3FMZ A;  5EED A;  3E3C A;  3VG6 A;  4D6B A;  4CSB A;  1G7N A;  2RA6 A;  4WBK A;  1NP1 A;  3JS1 A;  3KFH A;  1JBH A;  3FA7 A;  1A2D A;  2HYS A;  1D2U A;  2LB6 A;  3OE3 A;  2BHV A;  4I9R A;  2A3F X;  4Y0Q A;  2N93 A;  4TKJ A;  4YFP A;  1X8O A;  1HN2 A;  3O22 A;  3BRN A;  1IIU A;  3NBX X;  4YDA A;  3HOE A;  5F6B A;  3B2L A;  1OPB A;  4A1H A;  4GH7 A;  1CBI A;  4ORW A;  2FRS A;  5D45 A;  3VG7 A;  1YWB A;  4O3W A;  1KQW A;  3SAO A;  4ALB A;  4IAX A;  3PQS A;  1SY0 A;  3BU9 A;  1SXU A;  5CE4 A;  4AZP A;  2AMM X;  2YMS A;  5D47 A;  3STN A;  5KHP A;  1X8Q A;  1LNM A;  3CBS A;  2FS7 A;  2Z4H A;  5BVT A;  1NGL A;  5D48 A;  1VYG A;  3G7X A;  2MO5 A;  1XKI A;  5HZ6 A;  2MWH A;  2YG2 A;  2Q39 A;  2LBV A;  4UU2 A;  3D96 A;  3P02 A;  1GT1 A;  5EZ2 A;  1ZNE A;  2OFM X;  2G79 A;  4YGZ A;  4AZR A;  2OZQ A;  1BBP A;  4IMO A;  2GTL N;  4QGX A;  1X8U A;  5LJC A;  4XMG A;  1EUO A;  3EMM A;  4PJ2 A;  1IW2 A;  3LHN A;  2LBA A;  3FR2 A;  2IFB A;  3CQR A;  2CBR A;  5HBS A;  3HWG A;  1ICN A;  4NLJ A;  4TLJ A;  3CR6 A;  1YUP A;  2OVS A;  1R0U A;  4U8U O;  4QNI A;  4EQA C;  1QAB E;  4YBP A;  4BOE A;  4O4S A;  5F7G A;  2CZT A;  2E4J A;  4GNY A;  1QY0 A;  1CJ5 A;  4U8U N;  3ZW2 A;  1GM6 A;  4A8Z A;  2ZAG A;  3O19 A;  3P24 A;  5EPQ A;  5BVQ A;  2ALL X;  2M4L A;  2HZQ A;  4ZFX A;  2BS6 A;  3ZQ3 A;  4IBA A;  1G85 A;  4O4U A;  1FEL A;  3ZUO A;  3FW4 A;  1TXL A;  1AQB A;  1FE3 A;  2JU7 A;  3B2I A;  4QGW A;  3NX1 A;  1KT4 A;  5BVS A;  4QRL A;  2GTF X;  3FA9 A;  3CBC A;  1YWC A;  4IB9 A;  3ELX A;  1X71 A;  1TW4 A;  4LZU A;  3ELZ A;  3FYF A;  1B56 A;  2R73 A;  3OJY C;  2F73 A;  2KTS A;  4ORU A;  4I95 A;  4QZU A;  5H9N A;  3LV4 A;  2KTD A;  3WOV A;  1EXS A;  1GXA A;  2HNX A;  3VU1 A;  1QG5 A;  4ORR A;  4ZR2 A;  3T1D A;  2KW1 A;  4HPB A;  1LFO A;  3TGC A;  2G7B A;  3D97 A;  5KIC A;  1PMP A;  4I9S A;  2AT6 X;  3UEU A;  2AT0 X;  1RBP A;  3PH5 A;  1G74 A;  1VYF A;  3FA6 A;  1BEB A;  1JJJ A;  4YCE A;  4TJZ A;  3S5X A;  1EQD A;  1GT3 A;  4AZO A;  4COT A;  5FFH A;  1ERX A;  3AKN A;  4GNW A;  4GKC A;  4EEJ A;  2X8S A;  3TGB A;  3B2H A;  3UEX A;  1LIE A;  1HMR A;  4ON1 A;  1E02 A;  3EBK A;  3WJE A;  1TOU A;  4NW4 A;  3NX2 A;  1KZX A;  3UEV A;  1KT3 A;  3GAQ A;  4MVK A;  2AT5 X;  4EFG A;  3HWE A;  3HK1 A;  1TVQ A;  1OBP A;  1SY2 A;  5LJD A;  2O62 A;  3FR5 A;  4ES7 A;  3BU1 A;  1ALB A;  1E5P A;  4R0B A;  3KFI A;  4ZH9 A;  2WQ9 A;  1Z24 A;  2HMB A;  4IB7 A;  1ACD A;  3NP1 A;  4QZT A;  5B29 A;  2GTL M;  2NND A;  2LFO A;  4MVL A;  3ZW0 B;  5HZQ A;  1IKE A;  1YWD A;  3DTQ A;  1IFB A;  5LJK A;  1RLB E;  4XME A;  1UZ2 X;  2NP1 A;  2ACP X;  3C77 X;  5H9A A;  2OFR X;  2BS5 A;  2PY1 A;  2X45 A;  5D8J A;  5EDB A;  3WBG A;  1MX7 A;  5K06 A;  3TZS A;  4O3Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...