1HQRB

Crystal structure of a superantigen bound to the high-affinity, zinc-dependent site on mhc class ii
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
189
structure length
180
Chain Sequence
b'DTRPRFLQQDKYECHFFNGTERVRFLHRDIYNQEEDLRFDSDVGEYRAVTELGRPDAEYWNSQKDFLEDRRAAVDTYCRHNYGVGESFTVQRRVEPKVTVYPAHNLLVCSVNGFYPGSIEVRWFRNSQEEKAGVVSTGLIQNGDWTFQTLVMLETVPREVYTCQVEHPSVTSPLTVEWRA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA-DR ALPHA CHAIN
publication title Crystal structure of a superantigen bound to the high-affinity, zinc-dependent site on MHC class II.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 34
structure length 180
sequence length 189
ec nomenclature
pdb deposition date 2000-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1hqrB02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 1hqrB01
5LJYH 2F8XC 3CH1B 2PCPB 1QO3B 1UKQA 1U92A 4FQJH 5KZCD 4PJEE 1L7IL 1MCCA 2XWTB 2JIXD 2GJ6E 2WIIA 4NZUH 5C2UB 1XT5A 3MRCB 5ERWB 1MFEH 5CIPA 35C8L 1X5KA 4OD3L 4FQCH 4JKMA 3FO2B 4D9QD 1V3KA 4M1DH 4YQXL 1AY1H 5E2TH 2FZ3B 4RRPG 3ARED 3FTGA 3L3GA 2YD6A 3QQ9C 4K3EL 5KSVA 1EEUA 4HKJA 4PJXF 5I1GL 3SPVA 1S5HA 3K1KC 1JF1B 4TSCH 4BZ2H 4GUPA 4D9LL 5FO7A 2VLRB 5GHWL 1WWAX 1I3GL 2H45A 3QDJE 4RMRA 5AG9A 3DUUB 3H9SE 1QFOA 3DO7A 1ND0B 1F4XH 3I50L 2GSIA 1Z9LA 4QHUA 3B9AA 1DN2A 4HUUA 5GS0D 3S3PA 2AV7A 2BXZA 3OZ9H 3P9MA 5TDOA 1NUDA 2ESVB 1FZMB 5JNYB 5IJKC 1P1ZA 3D18A 1Q94A 1KC5H 2DQTL 2GAZB 3NIFE 3DV6A 1R5IB 3F6IA 4L8BB 1JNHB 5KVFL 2P8LB 4OFVA 2J7LA 2CMRL 4PJ8A 4EKXA 1J0IA 5ACZA 5T3XD 1P4LB 3D0VA 5D7JD 5DJ8B 4Z7VF 1N7MH 4JG1L 1GGIL 4IHOB 2O26U 5CJOL 5IB2A 4P23D 1G7MB 3RY4A 1CTNA 2FNBA 2YA2A 2X09A 1O7VA 3QPQC 3OTTA 3MXVL 1MFDH 3SGEH 4PJXA 1PG7L 4EOWL 1XGUA 4WI3A 4EBQH 1WCQA 4RA0C 3FN0L 4ZS7L 2P5WA 3FMGH 3JWOC 4GXVL 3RVUC 2CO6B 2XIDA 3PHOB 1YQ2A 2EXYC 2CIKA 3GSOB 1KUMA 3LB6C 2AJZA 2WBJD 5DD6B 3ZO0A 3QUXC 3RIAK 4TVPE 4LPTA 3MNZA 4UOW0 5TQ2H 3ECBB 1YN7A 5HHXH 4Y4FC 3VJ6B 3QRGH 4YXHL 4WFFD 4MB3A 1WCBB 2Y36H 1P84K 3EUUA 3LEVH 2ZCHL 3ZE1F 4WFHE 5K9OB 1W0YT 4HIJA 4FQQB 4U49A 1GGCH 5EFIA 2XNAB 4P48A 4Z7VA 2BRRL 3X14B 3T0EC 3ARPA 1B0GA 1PSKH 1QRND 4LDOB 3J8F7 3QXWA 5GSVA 5J1SC 4XHQA 4KKCC 2DM3A 5CP3H 5F1NA 5D7IF 3G9AB 3TV3L 1EEYA 5IQ7L 4P9HL 5HYSA 4KZDL 3KPMB 1RZ7L 3CSBA 4NJAL 2IGFH 2Q8AH 5IGXL 3WS3B 5K9JL 4XVTL 5BZWA 5DJZB 2A9MH 2FECL 1K8IA 3B6SB 3BEWA 1UT9A 3GBMH 4X4YB 4JFEA 4AM0B 3VFVA 3JWOH 2DRUA 4G80B 1N0LA 1RIVL 4L9LC 1ZLSL 1JYWA 4WUUB 1LHZA 4NN6B 2X05A 2BNQB 3VG9C 4L8CB 1KT2A 4WHDA 1N0XL 3C2AH 1BEYH 4JFOB 4YHPA 5E7FA 5BOZG 5FHAL 3O6FA 2Z93A 1ES0A 4PG2A 3W0WB 3QRFM 3FONA 2PW1B 4S1QL 5CJQH 3W9EB 1UB6A 1Z5LA 4I3RH 1NCAL 5EC2B 3MOBL 2NXYB 5KW9H 3QXAB 4B7LA 4NYLA 1P53A 3DNKA 3BRGC 3W11D 4LMQE 5BS0E 1T6VN 15C8H 1UG9A 4XGZB 3DUSB 2MWCA 4F2MA 1R3KA 3HE6B 1JNNL 2L7UA 1TETH 3G6JF 4KZEH 1GGBH 5BOPA 4K94L 4YDLC 4K71B 5D7IA 2IQAB 3SDAA 4PLNC 1FG9C 2XWJB 3I3BA 1CR9H 3QDGB 5B21A 4X83A 2V2WB 2DJUA 1JPFA 4P5TD 4P2RD 4KJPD 2V5SA 2H9GA 3RPIA 3PWJB 3RTQD 5C09B 1KLFA 3C60B 5BMFH 4XPHH 2A38A 3HZMA 2VLME 3L3OB 2VN4A 1ZMYA 2CSPA 1KCRL 2PYED 4Y4KA 4ODSH 4YBLC 4XNQB 4KDTA 4QCIA 1NCDH 2X4OB 4YFLF 3DX7A 4XAWH 4N0CD 1HSAB 3JBG7 2I07A 3S88L 1PZ5B 1KJVA 1S3KL 4UQ3B 4A6YL 1E4JA 1FFQA 5EO9A 3JV6B 5EZLB 3BKYL 1EUTA 5I8OL 4MAUH 1TITA 4M3JA 4MZ3A 3OF6A 4LP5A 3V6OA 2GCYA 3BAEL 3RKDC 1CDIA 2V9TA 3WNOA 5D7KE 5HJ3B 1QYGH 1ZT7A 1MRFH 5E8OB 5TE7H 4YE4H 2WQ8A 4NKDB 5TFSH 4NQDA 2QHLA 2PXYA 3U2SB 3IDXH 3G6JA 1JHKH 5DR5L 3CNKA 4IDJL 4R8WH 4MWFB 3R0MA 4OZHF 2XZZA 1NGWB 3SDDC 2NY7H 4PJHF 4RAVA 4HUXA 3GSVB 4GG8B 5KSBE 3FQTB 2HVJB 1J7VR 2X1XR 1P5UA 4XI5D 3S3JA 2DMCA 3QEGL 5IJVA 4EUPG 5BJTA 5JXED 1U8QA 2EH8H 4KKAC 5HYQB 3GI9L 3BKCH 4WWKB 1MVFA 3RUGB 5F7DB 2VDOH 2V9RA 4K23H 3BOVA 4OM0H 3HI5L 3ARBD 2CDFB 2E8YA 3QISA 5DT1H 1HDMB 2R2EB 4E42A 1WQVT 4N5ED 3WCYA 1ZGLB 2KQMA 3QZWB 4QF1B 1ZTXL 4QHNB 3QIBA 2XZCL 2E9JA 3I6GB 4OGAD 5JTWA 1FBIH 3MV7B 4MJ5A 4LASL 3O4LE 3BE1H 4K3JH 3O81A 3LKSB 3UZEA 5DSCB 2MOVA 2XTJB 4X99B 3T3PE 1JRHH 2VAJA 1B2WH 3JTSA 5F8RC 1FPTH 1FYTD 3FT3B 4GBXA 2NZ9D 4JFDA 4LL9A 4J3UA 1BVLA 4XP9H 4ZDHB 4Y16C 3O6KH 1QRKA 3LAFA 2X9YA 3VXTA 4OZHA 4Z7UF 2B0SL 4PJHA 4XC1H 4N0YL 3T3MF 5HHOB 3U82B 1R3JA 4P4KC 4HIEA 3CIQA 4M02A 5IB4B 2AXGB 3WIFA 5E8DH 2QSTA 1EGJL 3V2AR 1J8HD 4MJIB 4UBDC 5T1LD 1TQCC 4WTXA 4ODVH 1NMAL 4JVPA 1EZVY 1NBVL 4PGBB 1XCQA 3B2UC 2BVEA 3AY4C 3T4YB 1FL5B 2NY1D 1HYSD 1D5IL 5FHBH 4NPYA 5F1IB 5C0BD 4OCYL 4H88L 5FECA 1A5FH 3DX8A 4S1RL 4TVPH 4QRSB 1F3DJ 5IVZA 3DETC 3BSZH 4XTRD 3HNTL 1UEMA 2VXVL 4Y5YB 2VDQH 4PUBL 2FJGB 4JB9L 3SHSA 1AE6H 1SHMA 2J8OA 3CCHB 3D48R 4OT1H 4ZPVA 3MR9A 2H2SC 1PY9A 2DWEA 3OXRB 3BWAB 1T7ZA 4GRWE 1OAQH 5TE6H 1SBBA 5ESAA 1BD2A 1SY6H 1RJCA 2RCSL 2BX5A 3LKPB 1LO3H 4WV1B 1OSZA 5M95B 1J1OH 1DBBH 1RZ8A 4XZUA 1PW3A 1UCTA 4PRHB 5HGDB 4ESKA 1YEKH 4YNYB 3TA3B 1E4WL 4CU7A 4BFGA 1I4FA 4HDIA 4P5KA 2HT2D 5GRVK 1AXTL 1UWEH 3AU1A 4APQA 1ONQA 1C16A 1NCUA 1WBXB 2O61A 2EH7H 2H41A 5F88A 2O5ZH 2FX9L 3C6LA 2EDOA 4IM8A 3THMH 2OCFD 4PJBF 2DWDB 2EDTA 2D0FA 1T7XA 1TZGL 3EJZC 4QNPF 3NPSB 1FNGA 2VQUA 3FRPG 5GGVH 3WJJC 1WC7B 4I0PB 2A83A 3RAJL 1I1YA 4GKSB 5KSAC 2XFXA 1PZUB 1MJ7H 2Q76B 1AKJB 2Q6WA 3RI5F 4WJ5A 1MQKL 4P5TA 1S7QB 1QEWA 3MRGA 5B39A 4E41A 3GSUA 4HC1L 2PNDA 5EIQA 5C07D 3GSRA 3LPGA 3MJ8A 3FQRB 2LVCA 4Y2OA 1UZ8B 3TBTA 4I1NB 1N4XL 4R4FH 3QUYB 5E0QA 2EE2A 4TVPD 3C5ZA 3HNSH 1MJ8H 4Q6IA 2GTWA 3MGOA 4P9MH 4AZ8A 4Q97A 1TTUA 1RZFH 3PWLB 2OSLA 1FDLL 1IGCH 4MHHG 1FZOB 1LDPL 4MSWB 5K93A 1E4XI 5BV7L 3PL6C 4FG6D 4OQTL 1RK0A 3BD3A 1WZKA 2AJVH 1U6AL 3T2NL 2A6KB 5C0FA 3H7BB 3RVXC 4PJBA 2ATPA 4JM2D 1EDQA 1MIEH 2W9DL 5GS1B 5IMMB 4PGEA 3GK8H 2W9EL 1MHPH 4I2XA 4J4PA 2DM4A 1JIBA 5I1CH 4ELMF 3RPKA 2VLRE 3QG6B 5F96L 3FB8A 1RHHA 4X5XB 4GLRH 5ESVB 5JIPA 3IGAB 1LD9A 3BP4B 3PXHA 4XXCA 2G2RB 2V17L 4PYHA 3PIQB 3DVGA 1HEZB 3QIUD 2ESVE 4LAQH 4AJ0A 5IV2B 4KRMB 1T5XB 1RHFA 5C1MB 2FL5A 5FM4A 1BFSA 3BO8A 4XCEB 4YHZL 3SE3A 1EFQA 1SMOA 4LPUA 4FQXB 3SGJC 4PJIF 1BP3B 4ETQA 4KRPC 1Y6KR 1FGVH 3EOBA 4ODXB 1OAUH 2V2TB 4RMUA 1JHTB 3SCMC 5IM7A 1RUKL 3A67H 2FHCA 3STLA 2WM0A 3F58H 4TNWF 2W92A 1L7TL 1ZHKA 3RHWF 1J0JA 1NFIA 4H8WC 3CFKB 4AENA 1J9CT 1VGKA 3O2VL 3TC9A 3IFPA 5I1AB 5J4MA 1DLHB 3EKCA 3HUJB 4OLVL 3KYMA 3EDFA 4WO4D 4S0SD 5DUMH 1Q0XL 5FOBA 2P42B 1EBPA 5IVNA 3EHBC 5ETUB 4KHXL 3DO3A 3U36A 4JKLA 4ERSL 5HVWA 3W81A 5TDPB 5GGUA 3RZCD 4MNGA 1Q38A 1XGYL 5BVJB 4PJ9C 3SE9H 3TWCH 2ITCA 4OCSL 1NEZB 2XN9A 5DS8B 1FE8H 1WFTA 1E0OB 1M6OB 1T5WB 4PFEA 3FT4A 2J8UF 1T20A 2P24A 2G9HA 1MPAH 1FNAA 1JNLL 1RUPH 1EO5A 2JF1A 4L5FL 3G9VA 1O0VA 1GAFL 1RU9H 4PJIA 1UJ3A 5EIIB 2W0FB 3DARA 3OKLA 3ZT7A 4NRXA 5DTFA 4W6XB 5D6CB 2X4RA 1DDHA 4DK3A 1CGXA 3LIZL 2AP2A 5HHNB 3FQWA 1IGTB 3O45A 3QO0B 3NFPB 5KVEL 4C58B 3QEHB 4LPXA 1I8KA 4HCRA 1VGEL 1VFAA 4ZUTB 4ODHH 25C8H 1CF8H 3PDOA 1YEJH 3MREA 4PD4J 1RVFL 3KYOA 3OX8A 4NSKA 5DO2D 1RIHH 4X80H 2GFBA 1BJ1J 3WNLA 4HH8A 4WUUE 3QT2A 3NA9H 1T04B 2BVQB 3RGVC 1DUZA 4P49A 4R4BB 1VPOH 3SOBH 4GMTL 2NY3C 3BVNB 4KFZC 3HMXL 1G9NH 5GJSH 4NO5A 3W0WE 5IMLA 5JDSA 4M7LT 4GQPH 4HWEH 1UVQB 2J8UA 5EU3B 2EC9T 4OCWH 5CZXC 4GRWH 3BD5A 3HFMH 3OR7A 4LCWD 3RWDB 4QRPE 3STZA 2FEEI 2AJYL 5CBAB 4TSAL 3KLAB 3UTTE 5HPOA 3QCUL 4IOSD 2HLAA 3C8DA 1KB9K 3VFUA 1MI5B 2H32H 1G7LA 4JRYB 4RFEA 1BIIB 4LF3B 4ZOAA 4HXBH 4NRZA 1ORQB 4G6KL 4LLWA 4DKEH 1RK1A 3CH8A 3BN3B 4M5ZL 2R56L 3EYOA 3ROOA 5L2KD 3O11A 1A0QL 3QDGE 2VE6A 5TDNA 3EYFA 3MGTA 5H94A 7FABL 2Q3ZA 3T65B 1KJMA 5E95B 1OLLA 1N26A 5I74C 1ZKAA 1OD7A 5C09E 4RGNB 1QPPA 1KLUB 5D8JL 2VDRH 1XR9B 3RIFF 3RX7A 5GRZA 4JGMA 1UZ6F 4PRPA 3BP6B 1HN1A 4MXQD 3O3BB 5DUPH 3MUY1 1B4JL 3EO9H 4OZGB 1EAJA 4OKVB 3K4ZA 1TNNA 5IFJA 3FFDA 2DS4A 3ULUL 1O5DT 1ACYH 4HHAA 1CLOL 1FG2A 4Z5RA 4G7YH 4WW1B 4XNYL 2QEJA 2F9BT 4U3HA 1GPOH 5JW4M 1RUQL 3FL7A 1U3JA 3IFNH 1K2DB 3GBLA 1S78D 1I7RA 1PLGL 4HS8H 1DQQB 3VXPA 4NWUL 3S5LG 5E6YA 2BCKA 1N59A 1A21A 3B2VL 3P4OA 4LSVL 1CDYA 4MHHI 5HI3C 4OJFL 1HYRC 1MHEB 3F6LA 5E9DB 5DMGC 1KCVH 4J6RH 3WUWB 4XP4L 4JE4B 4BELD 2VJXA 5KSUA 3HKFA 1SEQH 2NY6B 4ZXBB 5IROA 4JFPB 2OQJB 3T1WA 4HKBB 3F5WA 3QB7C 1KEGH 4YHIA 1JPTL 3RUGE 4RWYH 2ZOLB 1FL6B 4TUOA 3FOLB 3MLXL 4M1DL 5HYJE 2BC4A 1WT5C 3VE0A 1TJIL 1CLCA 1AY1L 5E2TL 3BIBX 3OAUL 2ITDB 5J13B 1QBML 2AW2A 3MV7E 3KPRD 3L3HB 1I1AB 4QYOB 5E4EB 5C0ND 3ZDYE 4F7PB 4BZ2L 1YNLL 3DPBA 4UIKH 5GRVL 1EA9C 4JPVH 2HRPH 5J9PB 4OD1H 2YD2A 3RX8A 3C8KA 5CEXB 2R23B 2IADA 1Q9KB 5C0RH 5HHMD 4ZUVB 4DZ8A 3X13B 1F4XL 2AK1H 2YD1A 1JF6A 4OFIA 1DBKL 5DJDA 1OTUC 3SKOB 5J57B 3OZ9L 2DD8L 3QEQB 3FAXA 4HV8B 3D5OF 1KC5L 3GZKA 3OJMB 4F3FB 3ARFB 5HHOE 3VXQA 5HYFA 12E8H 2I07B 1J86A 2N1KA 1YUHB 2VERN 1QSEE 5IEHB 4FRWA 4JZOA 4MJIE 5EO9B 5EZJA 4P2OD 3FFCD 1I1FA 1BBJA 5TPWH 4JVUA 4GRLD 4LAJH 4QRQA 1N7ML 3BKJL 2KDGA 3NCBB 1HK6A 1ZANH 1D9KC 3LQAC 3I9GH 4D3CL 2MJWA 1F90L 2VB5A 4NFBA 5KG9A 1C1EH 1I9JH 1XF4B 2QKIB 2XXMB 4NN6C 2A6IA 5SWQB 5IKCB 5EULV 2VC2H 3ZKSD 2X41A 4EBQL 5E5RB 1P7QD 1YEHH 4WHYH 1UACH 2CUHA 1AP2A 1ZHNB 1FO0L 4LSRL 5D1ZC 4JFFD 3IKCB 1S7SB 5J6GA 3EOYG 3MRRA 4X4XB 5SX4I 2NXYC 1TFHA 4WFGD 3CSPA 3Q1SH 4I5BB 5TQ2L 3OAYK 4MS8D 3MLYL 4HULB 1NGYA 5HHXL 5GZOC 3GJFA 2Y1VA 1MREL 3VG0H 5MEND 2Y36L 2DKSA 1D5MA 4XWGH 1CXEA 4M1CC 3UO1L 3QWOA 5FKAB 2IBZY 1HHKA 5I30H 1S9YA 4K71C 4PRHE 4OGXL 3IU3B 3LEVL 5ACLA 3Q6FA 1CICB 4EEEA 3MGAA 3U9PH 1X3DA 5D7LD 2AJSH 1MFCH 3B9VA 2OTUB 3TBWA 1Y6MR 3GBNL 4LVOB 3ARUA 4LDLB 4GSDH 4A6YA 4LCWA 3WS6C 1I7UB 1IEBA 4PJ7F 5IUSA 2H26A 2IGFL 2NY0C 1QVOA 2Q8AL 1KN2L 1LO5A 5HDQL 5T5FH 4UV7L 4JANA 2A9ML 4JN1H 1FSKB 3GBML 1IM3A 3JWNC 5EOCH 4RGMB 4ZUUA 3ARSA 4DZBA 2CRMA 2AI0L 4X6BA 2IAMD 3LMJH 4CU6A 5EA0H 2ADIB 1BVZA 2YD9A 2D4FA 2CXGA 2QSCL 4MAYA 3LN5A 3C2AL 1BEYL 2BNRD 2CLRA 1J88A 3K2UL 1MFBH 4CU8A 3OXSB 3WXVH 3GMQA 4JO3L 1YMMA 4GAJH 3QR2A 5CJQL 1RZJC 5I2IB 3HB3C 5FF6B 1JGEA 2XA8H 4I3RL 2JLLA 3WLBB 5JZ7D 2WLZA 3KJ6L 4LKXA 1ORSA 2WWKT 5GRYA 2D7OA 2G75B 15C8L 2EZ0C 4ORGB 2Y9RT 2NR6C 3VFWB 1QSZA 1U58B 3WIHH 1ZLUH 4R96A 2CKBA 5ICXB 2Z4QA 4HFWA 1DN0B 1FVCA 4KZEL 5FYJD 5BZDA 3B5TA 4WWKC 5ADOL 4OD2A 4UIMA 2DJSA 2CRIA 4PJ7A 2OL3B 2DQDL 3AMLA 2GUOA 2LTQC 4Y4HA 4C83B 2YKLL 3TVMC 3UZQA 3CFBA 1NDMA 1S7TB 4XPHL 2FBJH 5BRZB 3I6LD 4KY1H 5T3ZD 1YY8A 3EFDL 4Z7UB 3ARDD 5DURB 5HY9B 5HI4D 4WI8A 3K3QA 2FEDD 3GIZL 4XAWL 3DMMB 5MEOB 1CE1L 2EYTA 3TNNB 3ZL4H 1TZIB 3IDJB 3OKMB 4HDIB 1RZKC 4MNQA 5IVXF 1W0WB 2IH1A 1EJOL 2OTPA 3BDYH 3HR5A 2X4UA 4LVHB 1RZJH 4M3KB 2OMNA 1AGEB 4MAUL 1UC6A 1Z9MA 3V4PH 5IOPA 5I16B 1S9VB 1J5OH 4N9GA 5D5ME 1BREA 1I9EA 4ZQKA 1X5GA 5JW3H 1EGJA 5JW4N 2R29L 5HI5C 1QYGL 4JJHA 2J5LC 3MLVH 4CGTA 5BW7C 5ICZA 2XTLA 1NGPH 5TE7L 3BT2H 3MBEB 5KOMC 5TFSL 1RFDH 2D31A 1ZVSA 1QBBA 4PTTB 4XPFL 3FCTB 4PLJD 7CGTA 1Q1JL 5AYUL 3UTTD 1WWBX 2I5YH 4OV5B 3UTSD 1KJ2L 4IMLB 1WTGT 4NQUA 4JDVB 5DVKA 3UTOA 3HUJE 4GKZA 1L6ZA 3BEVA 4C57C 1Q9LA 4DN4L 3BKCL 4KJWD 4YO0A 3TBTB 3D25B 5AG8A 4PRNA 2RQ8A 5IW3A 2KUTA 4R97C 2CJUL 5KS9F 4K23L 2C4FT 3ZDZE 4L3CB 4AYFA 4Y5YC 5DT1L 4C4KO 5IVXA 1KTDB 4W4OA 2BSSA 4J1UA 5T33L 2ZCKH 4P3DB 5GPRA 4RZCA 4YHLH 1FBIL 2DQJL 3LS4H 3BE1L 3X11A 4FN0A 2PO6D 3PWNA 5E00A 4RISL 4LQ1A 4WV1C 3OKKB 2YD8A 2BY0A 4M9OA 3R8QA 3V95A 3HS0B 1HE7A 1Y6NR 4XBGA 3ZYIA 2FJHA 4RX4D 2K7PA 1P7QA 1SM3L 1C08B 3CZFA 3L1OL 4Q6YA 3O3EA 4NQEB 1RIUH 1R3IH 1M7DA 3VFOA 4B7IA 3KPTA 1IC4L 4KVCH 4WDIA 4UUJA 3KXFA 4M03A 4GAYB 2ZSVA 2E27H 3NACL 3DRTB 5KS9A 4O5LH 2EZ0D 4UNVA 3LV3B 4KUCD 3NPSC 5EUKB 4HC1A 4JM4H 4I0PC 2H1PL 5FHBL 2Z0BA 3VXMD 4ZAKC 3KPSB 3MV01 3G5VB 1YNTA 4DW2H 2Y72A 3WBDA 2DQUH 3ULUD 3OR6B 4O4YH 5HYJD 2AS5M 1E4KA 3I75A 5BXFB 3RNQA 1NGZA 1MI5E 2JELL 1AE6L 3KS0H 5DEFA 2F74B 5F21B 3QUYC 4JZJA 2DBLH 3ARXA 5C0CD 2YR3A 3PWVA 3SBWC 4ELMB 4OQTA 3VXSE 4OQ1A 1FIGL 1UEYA 5F7FA 1NEZG 4OZ4B 3MCKA 1A7OH 1T2XA 4X98A 2Z31D 2ATKA 4S2SA 5IIEB 5F97E 4JDZB 5JLZA 4HUVB 4AMKH 1PX4A 5DK2B 3DRQB 4RGNE 4X7TB 4JRWA 1DBBL 3U30B 1BZQK 2MNUA 2HVKB 3SO5A 4X8JA 5I73C 1F3JB 4O2CB 1XF3B 1VCAA 4LOUD 1HILA 1DBAH 2FX8H 4HLZG 1NC4A 4IDLA 3WFEH 4OZGE 5LGHL 4HIHA 2EH7L 4Z95L 3RDTD 2YPLA 5K9QG 4EI6B 1KTRL 3M8OH 2EDXA 1DBMH 5LQBL 4HK0A 3ZHDA 1HH6A 2JCCB 4XX1E 1ZEAL 3QUMB 2EYRB 3CX2A 5L9DH 2LU3A 3QDMD 4QHLB 1LO0L 1UWGH 3WL9A 2DYPD 3TBVA 1LE9A 5JPNB 1DEEA 1JMZA 3BZFB 1JK8B 4FQXC 5J06A 5C6WH 4Y19A 5IWLA 3TJHC 5DK0A 3D39D 4TRPL 5I66A 5E9DE 4BK5A 1RUMH 5JHDA 1MCFA 4P59H 4B53A 1A1NB 3BN9C 1P84J 3CFDB 2HFGH 4M62L 4K3DL 3TT3L 3VWJD 2PTTA 3CDFA 4I48B 2IG2H 4N8PA 5HHVH 3U7YH 2CXKA 1KPRB 3HNSL 1MJ8L 3F7YB 3QNYA 5DK3A 4FABL 2Y23A 4S1SL 5CLWA 4DFHA 4P46B 1RZFL 4DGYH 3G5XB 3U46A 4N8VB 2MSPA 4QHKJ 5FYKE 4C56B 4POZC 3IFLL 1L0QA 1J1XH 1OB1A 4POYA 4X7SL 5SX5H 3NN8A 1IGYA 2FLRT 2AJVL 4ONFL 3V0VA 3KPQA 3P11H 4NZRH 2X70B 2AJUH 1FFOA 3GK8L 4GW5B 3L5HA 1XCTB 1KACB 1P4BH 4MMZC 3X12B 2CDEB 3GMMA 1OPGH 4JRXB 4KROB 3S4SB 1N3NA 2P1YA 4QRTA 5CEZD 1OAXH 3FO1A 2ADJA 1IAIH 4TYUA 3MLSL 3L3KB 1IC1A 4NO0B 3UTSA 1IQDB 4LLQB 3JXAA 3GMPA 1NC2D 2F54A 4XP6H 1T1YA 1QLFB 3QEQE 2F53A 4N0FB 4LIQE 4Y2DD 3MRNA 2BVPA 4ZPTA 3MJ9H 5E8PA 1LE5B 2AXFA 1AGCA 3ZT6A 3R06A 1U8KA 3ZHKA 4OAWA 2ZG2A 3C5SB 5J11B 1WIPA 3VXUB 3EYVA 4PTUA 1NCBH 4F33B 5MEPB 5LXGH 3QWRD 3ORJA 3SDYL 4ZS6C 2FR4B 3GM8A 4R2GB 4XP1H 3A67L 3NCYS 4P2QA 5DYOB 1T21B 2NTFB 3F58L 3HMXA 3GMLA 3QIWB 3UYRL 5IF0A 4RQQA 3WUWG 4M48H 1A7RH 4GXUM 2J3SA 1MCHA 3QQ3A 4HAFA 3IDYB 2VLLB 4HIIB 1A6ZA 3HPJB 1CE6A 4MNHA 5GJTL 3O9WD 3QEUB 3MLPA 2AQ3A 3ARTA 5D2LA 1CD9B 2R4RL 4KTDH 3HZVB 3PWUB 3KJ4B 3DTXA 2EYSA 3ES6B 4KTEL 2FEEL 1YYMH 4LHUA 3RL1B 2RAMA 1H5BA 3MUGB 3V52H 4FFZL 1GJIA 3WFBH 3PWPD 1JWUA 2X4PB 4KAQH 1QR1A 1NSNL 2QR0A 4PJGB 5FGBC 2D7MA 1MPAL 2DLIA 1RUPL 1TNMA 3OWEA 2E7BA 5DJ0A 2Y06L 2P5EA 3ARGA 4G7VH 4DGIH 1RU9L 4JPKH 5EU6A 1AC0A 2VSCA 3A0OA 4H1LH 5CUSH 4HPYH 3VW3H 3GMRA 1OGTB 1QFWI 2JJTA 3CVHB 5JW5B 1FZJB 5I1IH 3MFGB 1G9MC 4RGNC 2F8VA 3UDWA 2VUOA 5I1LB 4PJCF 3H8NA 1WV7T 3QXDB 4H8WL 1NBYA 3KLHD 5C08D 2AERT 3PP4H 1EXUB 4J3XA 1CG9A 5DD0H 1HI6B 3OB0K 4WRLA 5IESH 2IANB 3BPOB 4ODHL 3B3IB 1URLA 1G7QB 1MJJA 1JTPA 3HE7D 1YECL 5IW1B 3UAJC 1N5YH 3OKEB 1U8MA 1KJ3H 4HG4K 5K9KA 5D1QD 4X80L 5D1XA 1IGIH 3IU4L 3QYCA 4JO1H 3HI1B 3A6OA 4X8XA 5FV1L 4P3WA 5EC1A 3Q6GH 3QULA 2WNGA 1D3CA 2BXYA 2WK2A 3F7VA 4MQXC 1IMHC 1NAMB 5ACMA 1MUJA 2AQ2A 4OCWL 3JV4B 4JY6A 3WE6A 4BZ1H 3OG6B 4O51B 1EH9A 1L4IA 2FX7L 3HPLB 2AJ3A 5E6ID 3IJYA 3MXWL 2KL6A 4NKOA 3E6HB 3VWKD 2HJKA 1IQWL 1A6PA 4HXBL 2NY6C 4XNUH 1LNUA 4ZXBC 5HVHB 1G9MH 2H8PB 2IALA 4ZFGH 3CGTA 3RWHA 4G3YL 1K5NB 4HJ0D 1IKFH 3MFFB 4OF3A 5ID0A 4KDVA 5FUOH 4PJCA 5FA3B 8FABB 1AFVL 3WFDH 1INQA 3VXOB 5KVDH 4M1GL 4D8PB 5IHZB 1ZGLM 5K9QI 2DYPA 4Z0XA 4L4TB 4CW1A 3STBA 4N90E 1BQHA 4NC0B 1VKXB 4JFYB 3GHEH 4P57A 5EU5B 1IGJB 5A3ID 2C3WA 2CKNA 5F1SA 4OGZA 4FQIL 3D39A 3QFJD 5DUPL 4WU7B 5EO0B 2QQLL 1I1AC 4L8SB 5E4EC 3MQIA 1JZ3A 4NQCE 4OFKA 3GMOB 1UA6H 1TTGA 1LO2H 4G6ML 2C1OB 5GGSA 2EICA 3TJEH 1WUNT 4BKLB 3G5YB 4O9HL 4ZSOE 3VFSB 1ZT1B 5DXWA 4ZNEA 3HZYB 4I3SH 2MHAB 3IFNL 2D0GA 2GHWB 3S34H 4HS8L 2DTSA 3LEYL 2YA1A 5D72L 2I24N 2XPGA 1CZ8H 3ARFC 4KK9C 1MLCB 2YSSA 3IETB 1LGVA 3FQUA 1HCFX 5TJWK 4N0RA 3SGDI 1IM3B 1QD0A 2D7TH 4GG6F 4FXKB 1F11B 1S7WA 3HLAA 5CBEB 3IYLW 1FLRH 1RJLA 2AK4D 4EI5B 3O8XD 2JK5A 2ZUSA 3LEXA 4U7SA 5FYKH 1U8JB 3MRHA 1S7VA 4UTBH 4ZYKB 3D2UA 2DIBA 1YMMB 3JWDC 4CL7A 1N2RA 1AGFA 3IDIB 3R1GH 3GUTB 3HTLX 4PJFB 1NC2A 4FFWD 5A1AA 5KVGH 1A2YB 2K7QA 2V5MA 2IEPA 3GKWL 3RWIB 3TCXA 2V7NA 4NUGL 4XHJC 5F7KC 3MRIA 2ADGB 1EAPA 2DQGH 3OL2A 5IJKA 3TN0D 3E8UH 2VITA 2RR3A 3RKPA 3A6BH 5GRUL 4L4VA 3SKMB 1JTTA 5HVFB 5DVNA 3NH7H 1JHLH 5AZ2H 5D2NB 1J05A 1EFXA 1G0YR 4PREA 4FFVD 4OD1L 3L6FA 4K8RC 3RP1A 1J10A 4LIQH 4R7NA 4XCFH 5C0RL 2E8ZA 2UZYB 4GAFB 1VFUA 3B83A 4WI6A 4UT7L 3UXFA 5CP3A 3BDXA 1IAOB 5I8CA 5I8EA 1CICC 2QHRH 3T2OA 4Z7OE 4DCQB 4PGCB 5I1KH 1U8PB 2EO1A 5IB5A 12E8L 5GGRA 3VI3F 4F7MA 3CUPB 4NQEE 4YZFF 4OCRH 4F8QA 3MO1A 2DM7A 3C5JB 2FSEB 4LVOC 2IH1B 3ALWA 3VFMA 1JF5A 3P4NA 3FQXA 4QOKB 3JWDH 1QSVA 1WTLA 5F3HB 4UILH 1OSPH 3SJVB 3LPFA 4K7FB 3QUXA 4UINL 2PTVA 3D85D 4YGAB 1T7WA 4LEXL 3MRMA 3DURA 1OGAA 1FSKC 1BPVA 4RGMC 3PV7A 5IHLB 4NRYB 3K0WA 3TZVB 1AD9B 2NLJA 1AQDA 3KPSE 1LQSR 3DGGB 1C1EL 1RURL 1I9JL 2L4OA 2HTKD 4DGVH 5DJ2A 3OJDB 2VDKL 5B39G 4HQQH 3W2DH 4G8IB 4GXUN 1QSFA 4U6HA 1VEOA 3Q5TA 1FN4B 5FYKD 4CADB 1G6VK 4FHBD 1UACL 4ORZC 1XIWB 2VLJA 5JORA 4GT7A 3MV8A 4NKIL 4PJEF 1BQUA 5J7CC 4MQSB 3BKMH 3IXTA 4U1NA 4W70A 1K3ZA 2IPTL 3Q1SL 1XGQA 4UDTB 4WFED 2NX5D 3HE7A 4ENEC 4MCZB 1KLGA 1HHGA 3IS1X 3WHXA 3T77A 5E5UB 1DR9A 2D7NA 2QLVB 4OZFB 1NMBH 1TCRB 4MD4B 4DVRL 4M6ML 3KNBA 4BK4A 1KULA 4L9LA 5F44A 5J6HA 5F1OB 1I7TB 1KTKE 4UT6L 3LQAL 1RZIB 1DVFB 1UH3A 2ZSWB 2R1WA 3CK0L 4XNMB 3K4AA 5EIVA 5ID1A 4GSDL 4NHCH 4IRJB 4YPGA 4XWOC 3MRJB 4LSUH 4XMLH 3NPZB 5E6IA 5T5FL 2JCCE 1BX2B 3KPPA 4CAGA 1S9XB 5EOCL 2X4SA 4HGWA 2ERJC 1IAIM 4DOHB 2EDJA 2BVOB 3QHZH 3MV9B 4LVHC 4MD5A 2JB6B 4KXZI 4NKMB 5EA0L 3NIFF 4PJEA 1QFWM 2VXTH 3QO1B 1XGRA 4X9FA 2GJ6A 3PABA 4KVNH 1OAKL 3CDGB 4MDJA 4LCYA 1MFBL 4HUNB 3W39A 2P48B 5FA4A 2EC8A 5ALBH 5ISZB 1ZHLA 5J0BA 3MBEC 3EYUH 6FABH 5DD1H 1CFQA 1PVHA 1U91B 3QQNA 4EN3D 3HG1D 4OF8A 5DQDH 5F3BA 5SWZB 2RFXB 1A7NH 3WSQH 1JCKA 1T1ZB 1FAKT 2OL3H 4KQ3H 4LNRB 4NM8H 1MH5B 2VDPH 4E0RA 3VFPA 5ELIA 5FO9A 3QI9C 4C56E 3V6FA 2Q86B 1HQRB 2Z8WC 2R2BA 4OLUL 4A2MA 5FK9B 5T1DH 1KENL 5FYLE 3DXAD 3OGOE 3QDJA 1HQ4B 2SEBB 2WIMA 3H9SA 4V1DB 1UFUA 3LQZA 1WBZA 4PRID 3IJSB 4YX2H 4G43B 3UJIH 3NABH 5A2FA 2WBKA 3HC0A 2FBJL 3FB7A 32C2A 2HYMA 1KIQA 1YEFH 5IW6B 4JO4L 3Q5OA 2MPAL 1CL7I 4Z76A 4G6FB 2YBRA 1CGWA 1J0KA 1W0VA 4NGHH 4K7PH 3S96A 3TBYA 1XAUA 4FOMA 3SDDA 3OJVC 3BDYL 3WFHA 1YDPA 1RZJL 3GO1H 4PJ5B 3CAFA 5EU4B 1FVDB 5EZIL 4LKCB 2QTEA 5E08L 1J5OL 3GB7B 1HZHH 2LU4A 3SN6N 4MCYA 3VXUE 5JW3L 2JB5H 4L29A 4RAHA 3QHTC 1EEZA 2NY5H 1DBJL 1NH6A 3B9KD 4PY7A 4PV8A 1GXEA 1IM9A 2D4DA 1BBDH 3V5HA 5IBTL 2OK0H 2B1HL 5MHSD 2ZUYA 1GCFA 4JVWA 1M1SA 4TTGA 5HHQB 5DJYA 4W4NA 1IEAA 2DQIL 4S0TD 1IARB 3WEXB 2X4QA 4G8GD 4PGDA 4CMMA 4M43H 5DDHA 2YUXA 3T0AA 4G9DB 2PTTB 3L3IB 4JHAL 4CVZA 1T1WA 1AIFA 3ISWA 3L5XL 3GGWB 4OM1H 4HF5H 3UJTH 1A4KA 4Y16A 3CSYA 1RZKL 5GSRA 5DGQA 3ULSB 1U3HD 1R5WB 4HKXB 1LP9A 3GSWB 4WCYH 2BSTB 1FIEA 2ZCKL 1G1YA 3MYZA 2VMFA 3EOTL 4PJGE 4FXGB 2W65A 4YHLL 5ICYB 1ZT4B 3MLUH 1C5CH 4P4KA 3UTPD 4KJQC 2I9TA 3ULVE 1BJMA 1HHIA 1KXTB 2V9QA 3S4SG 3P77A 5DHVB 4G9FD 5HTSA 4PV9B 3U6RA 3L3JB 1RZGB 3AY4A 1F4AA 3PQYD 5C2BH 3G04A 3MACH 3TCLB 5I19H 3Q5YA 1FCGA 5AWNH 3BXNB 3V4VH 5EOTA 1R5VB 2IANE 5DFVD 1AO7B 3OB8A 1V3LA 4U1MA 5JOFB 5KTEL 1H9VA 1U8IA 4ODWA 1JWMB 5B4MD 3VD5A 1RIUL 4DK6A 2BVPB 1DQML 3EO0B 1UWXH 1AXSA 1XF1A 5MP6L 4JQXA 4LLUA 5CP7A 1VSCA 4IOIB 3QFDB 4FQLH 1I1RA 4M61A 3LS5H 3P0VH 4R3SA 4YHOL 5BS0A 5CJBA 4JM4L 3SDCB 1DE4B 1KG0B 5IBUB 5AEAA 4GRMB 4LFHD 1FP5A 4WY7H 4Z0BH 5B8CB 1WEJH 1QLRB 4WNQB 4F15B 3RNKA 1FL3A 2Y6SC 1DTUA 3P9LB 5IT2H 4OB5L 3NCMA 5KZCB 1DUYA 2AEIT 2JIXB 4JZNB 2W60B 3WV0A 5C92A 1XH3B 3PHQB 5KSBF 2X4NB 1SJEB 4L3ED 4ONHA 5HVGB 3OPZH 1QP1A 2F19H 2EC9U 4HBCH 1BZ9A 4AEHH 1MRCL 4H20H 5AUMA 4P46C 3L5WA 1A7OL 5DMKB 1XGPA 5IFAH 5FO8A 4YHML 5D71L 3GNML 3AREB 1GZPA 4N68A 4AMKL 1EZVX 5JR1H 1QPXA 5ADPH 4CVWA 1H8NA 3WJJA 1P2CB 3TBSB 3P30L 4F9LC 1P7KB 5KSAA 3BUYA 1IC5L 3FJTA 2P8PA 2Y7QA 3QNXB 3U0TB 4XPTL 3T3PF 1INDL 2GITB 2GTZB 4KROC 3TF7C 2ZUVA 4RMWA 1BHGA 5JA9A 1DBML 2JJSC 1X7QB 1MCBA 5D9SA 2Z92B 4X7CC 5LVEA 3ZKNC 4YDKH 1OAZL 4NBZB 4W6YB 4GW1B 2ZUTA 5KSBA 1U95B 2X7LA 3C6SA 4O2FA 3PL6A 5C3TA 5D7JB 5J11C 4XXDB 2OJEB 5T1MA 4X9GA 3G5ZA 1XF2B 1AI1H 2F58H 3LH2H 4P23B 3HZKA 4P59L 5D7SH 4JAMA 1LVEA 4R2GC 4DVBB 3U0WL 5L0QB 3U7YL 2Q8BL 1JV5B 1WK0A 2D03H 1BFVL 3QIWC 5FYLH 2H3NA 3C2SA 2R9HC 1T80A 4NJ9H 2ICCA 1Q0YH 4PJFE 4DGYL 4N9OB 3SQOH 3IDYC 4BH7B 5L8KB 5J1AA 3O4LA 3MNVB 1H15B 4QXTA 2WBJB 3F12B 5DRXA 1FV1B 3EGSB 3NZ8B 4ZUSA 4JJ5A 3KJ4C 4FQPA 1K8DB 4ZO8A 1IL1B 2UY7A 4JQVC 5CGYD 3T4AA 4PB0H 4XCNB 1X5IA 4CVXA 1UXSA 3P11L 2AJUL 3D69B 1R24B 3CFEB 4GRWF 2A1WL 4KMQA 2VQ1A 2HT4D 3SGJA 1JPSH 5TH2A 1TPXB 2OM5A 3DVNA 5KANG 5AAWA 5C0AE 3SCMA 1OAXL 4Z78B 4GW4B 5EBLB 2WWKO 1IAIL 3PE9A 4X6CB 1YA5A 3O2DH 4MX7A 2GW5A 2YXFA 3ILPB 2P8MA 3ROLA 1LK2A 3ULVC 4FXLA 1H3UA 1QFWL 1QRNB 1HOCA 4O58L 2A6JA 4U1IA 3MJ9L 3VFTB 4HH9B 5JOPD 3VRIA 1F6AB 2WANA 5CGMA 2OTWB 3INUH 4XP5H 4AIOA 3U4EA 1JBJA 2UWEB 4QOKE 3MRKB 4KJYB 4XBEH 1D6EB 3SJVE 1N8ZB 1KCSL 3BH8B 4ZFZA 5DA4A 1V7NL 1INEH 2A6DA 3BPOC 3QG7L 2LV4A 4XP1L 2WUCL 2BY1A 4PJ9A 3G6DH 2FGWL 1TZHB 2WLYA 5DHYB 4M48L 4L4JA 1QR4A 1SYVB 1BF8A 4JHZA 1MCPL 3NFNA 2HJLB 2FH8A 2Q7NA 2N7BA 3HC3H 4KI1A 5L6YH 4HPOH 2D0HA 5C70A 4F7CA 4DEPB 2BNQD 4KTDL 4G8EA 1C12A 3AXLA 3WHE0 4S1DC 4U2ZA 1Y0LB 4WTZA 4PPTA 3N85H 3LD8C 1T4KB 4OF6A 5GISH 2DBJA 1FRGH 5FUZL 1ZA6A 1JZ4A 5EO1B 3GSQB 1UXWA 2EDEA 4NO3B 5HDBE 5DI8B 2UVEA 3WFBL 3BQUD 2WINB 4IOFD 3T8XB 5HVHC 1IFHL 1Z3GL 4M6NL 3VXRD 3G6AB 5A40E 4B5EA 2UZIH 4KHTH 4P2RB 5IBLD 3HE6D 1MVUA 2V5TA 2DF3A 3IXAB 5CUSL 3VFGH 3RTQB 1ETZB 4HPYL 3WXWL 3ZTJH 3GSNH 4MA1B 1EJ6A 4R9HA 3CFJB 1FNHA 5I1IL 1T3FA 2PYEB 2AKRB 2A0LD 3N06B 1YN6A 4NUJA 1OWRM 4BFIA 3W9DA 2YEZA 3KLSA 1YYLL 4PJAB 4WEBH 1BM3H 5ILTL 4KPHH 1LO4H 4MXWH 1NFDA 4NOBA 2NY4D 4GG6B 5IESL 4NP4L 1K4CB 3VD7A 3CH1A 4DOHE 3O3UN 2PCPA 3MV9E 1N5YL 1QO3A 1KJ3L 2CIIB 1TJGL 2FIKB 3NIDE 5GRJL 1NAMH 1M05B 1OARH 1NLDL 4JO1L 3GEWB 4AEEA 3UTQA 1OT2A 5DVMA 3MRCA 4K9EH 4RGOL 5ERWA 3ZZ1A 1E27B 4YR6B 5ISZE 3WIIL 1EX0A 3FO2A 3SO3C 3V6ZB 3CMOL 5EDXA 3QBTB 4Y4FB 2FZ3A 2NYYC 3QNZB 3H2WA 4WI2A 2Z8VC 1CFNB 4HJGB 3KYNB 5D70L 2AEQH 1A3LH 3N9GL 4WENB 4YBQC 1Q72H 1JF1A 4EI5C 4U6HB 1W72B 4YIQB 3MLRL 4FP8H 4EIGB 1G9ML 3VCLB 2VLRA 1IKFL 4HS6B 4W68A 1ITCA 3ARBB 3WFDL 3T0EB 3DUUA 4MVBC 2FWOB 5KVDL 1ND0A 2IF7A 1OM3H 1F58H 2R2HB 2RHEA 3RBGA 4OLXL 4OZFG 3V79C 2DI9A 1B3JA 2ESVA 1FZMA 5JNYA 2QQQA 4J23A 3JUZA 4FTVD 5JUEH 4K2UH 1HHGB 4MJ2A 2GAZA 1MELA 5E94B 5C6TH 1R5IA 2XG4A 3C08L 4L8BA 1JNHA 1FYTB 2P8LA 3MROB 1LO2L 1P4LA 5I1EH 5DJ8A 3V0WH 4LU5H 4N0UB 4Y5XC 2XTJD 4IHOA 4PJ5E 3I85A 1G7MA 1T0NB 1CT8B 3AC0A 4I3SL 4IRSD 5GGVY 4YGVB 3DHJA 3LZFL 1CZ8L 4QTIH 5E2VH 1J8HB 1JGLL 2X89A 5T1LB 1UWXK 4XAKD 1WT5A 4HGWB 4CNIB 2D7TL 4QT5B 5CILL 3LKOB 3PHOA 3GSOA 2BHYA 2NY1B 4KK8C 3RQ3A 4P99A 4PS4H 1DQJB 3QUZD 4QXGH 5I6XC 2F5AL 5C0BB 4J3WA 1CU4L 4YDLB 3S9DB 1OW0C 3ECBA 4Y1AD 1CIUA 2A9NL 3TZVC 4UTBL 4XNZC 3VJ6A 1Z2KA 1JFQH 3QHFH 3JTTB 3CFCH 1WCBA 2EE6A 1EMTH 5KANI 5M7QA 1PX3A 3KPOB 5K9OA 1OVZA 3MLTB 4FQQA 2CRZA 2XNAA 1WAAA 3X14A 1OL0A 5SV3A 3NGBB 3U4BL 4NO2B 1JPGB 5DEGB 4QWWC 4PLKD 3NH7L 1HKLL 2VISB 3KPMA 5LWYH 4LIQL 2VXUL 3WS3A 1DLFH 2VDMH 1Z0NA 5DJZA 5DMIH 5SWSD 3B6SA 2APVA 2LABA 4X4YA 4NNPH 4AM0A 3DWTA 2HFEB 4H5SB 3D3VD 3EO1B 4G80A 3ESUF 4HUKB 4WUUA 3CDCA 2BNQA 3TESA 4L8CA 3TA3D 1SQ2N 1AO7E 4HX1B 4OCRL 4JFOA 1FH5L 4ONGL 3W0WA 3JWDL 4URTB 4IRJC 2PW1A 4KGJA 3W9EA 1OSPL 1G7JB 3CXDH 2E6JA 3DX9B 4PP2B 4TVSa 3QXAA 1G84A 1F2XK 2BRQA 2QADD 4XGZA 3DUSA 3HE6A 4HT1H 5I71B 5C0DB 1NCWH 3B8SA 5CJ8A 4WHTB 5C07B 3ARWA 1H3XA 4GO6B 4HQQL 3W2DL 2YRLA 4WUKL 2IQAA 2XWJA 3QDGA 1Q9WB 4K8RL 2V2WA 4BYHA 2X10A 1DL7H 5DJCB 3PWJA 5I17B 3QA3B 5C09A 3C60A 1WITA 3IAPA 4LK4A 4NNYB 2QQNL 1RI8A 3L3OA 4IEFB 4D9QE 1B6DA 4DAGH 3DUHA 3L95B 3RUGF 2H6PB 4QO1A 1GRWA 4JQIL 2X4OA 4XMKL 1V7MH 3LRSB 4ZUWB 4P3CH 1HSAA 4I4WB 1GGTA 1PZ5A 2C7UB 5C0GB 4UQ3A 5EOCJ 1NMBL 2ENSA 2X4TB 4JM2B 3ZE0E 3BISA 1A6WL 4JHWH 4PJ8C 2B4CC 2HMID 3F62A 3JV6A 1OLZA 1VADB 5CIPH 5EZLA 2ZPKH 4EXKA 3ZDYF 1HWHB 1A3RH 3BZEB 2R0LH 4G6AC 3TO4D 4N8CH 4QRRD 5E8OA 1CL7L 1FYHB 4NHCL 4YHNB 1IC7L 2ZKHL 3KLDA 3QIUB 4NKDA 5HDOA 3U2SA 3ABZA 4GMSH 3HI6L 1OWWA 4MWFA 1DSFL 1HHHB 4ZOBA 1NGWA 4U1JA 4OFYA 2UUDH 3MCG1 3GSVA 4GG8A 2XRAH 3FB6B 2HVJA 3FQTA 4G6JH 3PP3H 5T3XE 1K85A 3IDUA 2DDQH 4UTAH 2IBZX 5HYQA 5ECJE 4R0LB 4AL8L 4WWKA 3KHQA 3RUGA 2VLKD 5F7DA 3ZKMC 3S36H 5F7NC 2ICES 5F93C 5FCUH 3N1FC 1MCNA 2CDFA 1QFHA 3TVMA 3S8WA 5HGAB 2N7AA 1HDMA 2R2EA 4JFDE 5DQDL 1YEGH 1MEXH 2A73B 3E6FB 3E1F1 3QZWA 4LSSH 5GZND 4QF1A 1ZGLA 3T0VA 3DROB 3LRGA 1A7NL 2B4CH 2OR9L 4M93B 4QHNA 3UPCA 3WSQL 3I6GA 4XCCL 3BP5B 2OL3L 3QSKB 4KQ3L 4WO4B 3MV7A 1CQKA 2FCBA 2YK1H 3H0TB 3LKSA 5DSCA 5AD0B 4X99A 2QV2A 5F9OH 5INCB 3BP7B 5T1DL 3BJLA 1SJHB 3FT3A 3RZCB 2CLZB 4EDWH 2Y07H 5EBGA 1D5ZB 4HG4J 4XNXH 5JPMB 1U36A 4ZDHA 1Z9OA 3V4UH 2V6HA 2ADFH 5BW7A 4OKDA 3KHOA 5FM5O 1X5LA 5HHOA 4M7LH 4X6CE 5IB4A 2AXGA 1F13A 2APWA 4MJIA 2BZDA 5J3HC 1QRNE 4TQEH 3T1FB 2J88H 3FQNB 1GIGH 2B39A 3M1BB 3I3DA 5TF1H 3FOMB 2ENYA 3P9WB 3VDBA 4PGBA 1AGDB 4U6YB 3GO1L 4U6VH 3T4YA 1FL5A 5AYQA 1HXYB 3X3FH 1HZHL 2I26N 2DTMH 4M6OL 2E7MA 1YEEH 1MHHB 2UWEE 5F1IA 3RWGB 5EN2B 2EDFA 4QRSA 1BD2E 3OSKA 4KI5D 4Z7QE 4G42B 1LEIB 3NZHH 1TJHL 3MLWH 4R90H 4AIZB 1A7PH 3KDMB 1QBLH 4HD9A 4JKPH 4Y5YA 5CWSB 4BSWB 5DZNA 4YJZL 2FJGA 2C1PB 1ZOXA 1EHXA 3CD4A 3CCHA 4FMFA 1ERNA 4RFOH 5C9JB 2IQ9H 3OXRA 1MRDH 3BWAA 3LKNB 1BQLH 4XVUC 4YC2B 2HKHL 2I9LB 5C86A 1WWWX 3LKRB 3LKPA 3MYJB 1CK0H 4OGYH 4YDIL 4KDTC 1CTOA 4WV1A 1D5BB 4PRHA 1KFAH 5HGDA 4HF5L 2XZAH 4YNYA 3TA3A 3UJTL 1RJZB 1H3VA 1CGSL 5L2KB 2APBA 1DQLH 1WBXA 1C5CL 4JRYD 4P2RE 5ITBL 5H2BB 5EPMB 1OF2B 3IF1B 2E6PA 2P5WD 2DWDA 3AREC 4DUWA 1BQHG 1I8IB 2XKNB 3T2PA 1MWAB 4XPBH 2PYEE 1JUFB 5JA8B 4KRPB 1WC7A 3MBXL 4I0PA 1JGUH 2AV1B 3RVVD 4X6DB 5E2UH 4GKSA 5CZVL 4PJAE 1TMCB 4H26B 5C0IB 2Q76A 1AKJA 4X6FB 5I19L 1J11A 3RX5A 3OHXB 3O3DB 1YEDB 2F8OA 1S7QA 2K3TA 3FT2B 4KMTH 4JLRB 4RA3A 1NCCH 4HLJA 4KK6D 1BF2A 2Q1EA 2UYLB 1QA9B 1EHLH 5GS0C 3FQRA 1UZ8A 5JIKA 3QUYA 2ORBH 5DHXB 5D5MF 3SBWA 4UI2A 2LVEA 5AZEH 3IVKB 4I2XE 4WEUD 1NL0H 5JQ6L 1F42A 2O5YL 2VDLL 3KPNB 4X4ME 1KGCD 3PWLA 4OIIL 4C55A 2EDYA 3D9AH 3R4DA 1FZOA 4Z0BL 5D7JC 4Y5VB 4ODUB 1E6OL 4NZTL 4H0IA 2A6KA 4P23C 3H7BA 2CDGB 4JFED 2XZQH 5GS1A 5IMMA 1AGBB 4GRWB 5L0QC 3HUJF 1A1MB 3QG6A 1RD6A 3GKZA 5L7XH 4HBCL 2H32B 3KGRA 5ESVA 3VFNA 1I3RB 3IGAA 1Z6JT 4WW2B 4X0KB 3O6FD 3BP4A 2DL9A 5IFAL 2G2RA 5BCAA 3ZDZF 3PIQA 5E7BA 3QUKB 1HEZA 2WBJC 2WMPA 1A9BB 5JR1L 4ODTH 3UX9B 5IV2A 3KPRB 5L2JB 1T5XA 5GS0H 4XPGH 4HMDA 4TTDD 1NANI 2XT1B 4NQSB 4XCEA 1FVEB 2Q20A 2B1AH 4PRDB 5DRNB 4YHYC 4FQXA 2ZJSL 1FYTE 1VEMA 4OLZL 3QUML 1TPXC 3AS3A 2YD7A 1CFVL 4ODXA 4B50A 2V2TA 5D6DC 3CLFL 1JHTA 3MJ9A 3SDAD 4N0UE 3RGVB 2CLVB 3MX0A 1I9IH 2J1KA 3VA6A 1X5XA 3MODH 4Y0GA 3U0PB 3CFKA 1MF2H 4FQ2H 4Z8FL 2VXSH 3X3GL 2K9UA 5I1AA 4Y4KD 2HTLD 4P2OB 4Q9RH 1DLHA 3FFCB 1F4WH 3HUJA 3TGXA 4ELKB 4GRLB 4O02L 1GOHA 5F9JB 2UVFA 1ADQL 3OQ3B 4YK4B 5ETUA 2C3VB 5IFHH 4EDXB 4JY5L 5TDPA 5C0BE 3UTQB 3IFOB 5JXAH 5BVJA 3OF6D 4Y8DC 9CGTA 1NEZA 5FYLL 5A16B 3U7WL 5DS8A 2IJ0C 5I74B 1M6OA 1T5WA 4RBPH 4XVSH 5CSZB 1U2CA 3SQOL 2AGJL 4JFFB 3SY0B 3TFKD 5EIIA 4NQDD 4OBSA 2W0FA 2PXYD 4DEPC 1YPZB 2HFTA 5FM8A 5D6CA 1X9QA 3W11C 4LPWA 3ZKXB 4HWZB 5HHNA 1IGTA 2R0KL 1UM6L 3QO0A 3NFPA 1QFUL 3H9HB 4NKQB 3QEHA 5MENB 4U1GB 3HCVB 4X5WB 4TULL 1T2QH 3J7HA 1JWSB 1QNZH 4O2EB 4ZUTA 4GKOA 5DUBB 3B5HA 4X9BA 2AEPL 2YPVH 4KC3B 2H2PD 1G9EA 3MNWB 3E2HB 4QRUB 3I2CH 5EU7E 2VRAA 4P5TC 4KJPC 5ALCL 3P4MB 5D7LB 1BFOB 2JKXA 3RTQC 1BZ7B 1HCVA 4NQXB 4MA1C 4G5ZH 4WWID 4G8FB 2IC2A 4HUWB 1T04A 2BVQA 4OZGF 1PGRB 1MFAH 3QIBD 4R4BA 3MA9L 3BVNA 4PR5B 1T6WA 4N0CC 1BVKB 4J12A 4FZ8H 4XBEL 5EBMB 1UVQA 1KN4H 1QLEH 5EU3A 4ONOA 5LAXB 2XACC 3SE8L 1F45A 1A8JH 2W38A 1INEL 3RWDA 5DD3L 2J4WH 2IAMB 4GBXD 4LSPL 4MQ7B 5CBAA 3KLAA 4BH8B 5CINH 2A74B 4M7JL 1TENA 2D2OA 4JFDD 1LEGB 3PP3K 1MI5A 4NWTL 4JRYA 1CN4A 3ILQD 4HWNA 1BIIA 4LF3A 4EVNB 2BNRB 2I25N 1ORQA 5FGBA 1OD9A 2IWGA 5C07E 3KR3H 1BOGB 2G60H 4Q9QL 4ZO9A 5TE4L 1RMFL 4HPOL 3WD5H 2VQTA 3QDAA 4BQ6A 3S3SA 3T65A 1FHGA 1EVUA 1KLUA 4YAQB 3DBXB 2QSQA 4DTGH 1XR9A 4OI9A 5EORL 1PG7W 3ULVL 2I60H 2HLFD 4XI5C 2C9AA 2NCMA 4U1LB 3BP6A 5JXEC 2D9QB 3N1GC 2YMXL 3O3BA 3CVHL 2DLEA 5I1HH 3ETBF 4OZGA 2I27N 2YUVA 4ISVB 4OKVA 5CD3A 5J89A 1GZQB 4TUKH 3UCRA 3ARBC 4XBPB 1NBQA 1EVTC 4WW1A 5F89B 1FAIL 3PGCB 1NQBA 4PRBB 1HWGB 4N5EC 4TPRH 1QKZH 1IE5A 3ESVF 4Q2ZB 1MJUH 1K2DA 1T89C 2OLDA 2KH2B 4LCUB 5EOQH 4OGAC 3ARDB 1DQQA 1U8NB 1WBYB 5BO1L 1V8HA 4DQOL 3C87A 2EIDA 1D9KB 3VD3A 5LBSL 4WEBL 5BRZD 1BM3L 1AR2A 2WP3T 1BD2D 2VKWA 1QBAA 4TUJB 4KH2A 1IGFH 1MHEA 3S35H 3O0RH 2NZ9C 5E9DA 5DLMH 3AGVA 3WUWA 5FDYA 3DMMD 4BJLA 5CCKL 1JPST 4OTXH 1NAML 4ZXBA 3MRQB 4JFPA 1AR1D 2OQJA 1ULVA 3E0GA 4APQD 4HKBA 3UBXB 5D1ZB 3MZGB 4GKNB 3QCTH 1K3IA 2ZOLA 4ZTPH 1FL6A 3C6LD 4QRPB 1W72H 3FOLA 3UJJL 3UTTB 2WBWB 4UT9H 1IBGL 2OR8A 2R1XB 2ITDA 3SDXB 2BJML 2PKDA 1EV2E 2NY1C 1HYSC 4J3SA 1VEPA 4DKFH 1HINH 3L3HA 1I1AA 4QYOA 2HWZH 4MMXC 4FP8L 4F7PA 2NMSA 2JJVA 2N4IA 5J9PA 2OJZH 1V3MA 3MCLH 1BWMA 1A6TB 4XTRC 5CEXA 2R23A 1Q9KA 2VH5H 3DYPA 4ZUVA 2VXQL 4E41D 1J0HA 3X13A 4OSUH 1F58L 1KELH 2JJWA 1KOAA 2VOTA 3SKOA 4FA8A 2DKUA 3C5ZD 3QEQA 4HV8A 2NY0B 4D0CB 4JEGB 5C8JB 5JUEL 4F3FA 4WI9A 3ARFA 3NGBC 5TQ0L 1A22B 1YUHA 4YXKL 2PO6B 5IEHA 3NCEB 3L9RB 3LHPL 1H0DB 1ZXQA 4YLQT 4AT6B 4JHBA 3P0YL 4NFDA 4LU5L 4OLYL 3SKNB 1RPQA 2HT2C 1BGXL 3S98A 3SEPA 2FBOJ 4J4PD 3RWJB 1UM4H 1XF4A 2GEEA 2QKIA 5SWQA 3RU8H 5IKCA 5IK3B 5FYJU 4QTIL 4F7TB 2NNAB 2X1QA 4YWGH 3HAEB 4U1JB 1T7VA 1ZHNA 1YC7A 4JG0H 3RWCB 4UNUA 3UPAA 3IKCA 1S7SA 5HD8D 5F70A 4X4XA 4GFTB 4JGUA 4NDMB 4FNLL 3VXMB 3BW9B 4I5BA 4JDTH 1E6JH 3V8OA 1MCIA 3V9FA 3DI3B 3L3DB 4LCWE 5I71C 1JFQL 3VGEA 3QHFL 2LTQB 5HYJB 3TVMB 4LCCB 2CKBL 1KPVB 1XGTB 2XXCB 1EMTL 1CLZL 5FKAA 4KUZL 3H3PH 1F4YL 1TVHB 3BH9B 3IU3A 5C0CB 1T2JA 5DA0B 1CICA 1HH9B 2CR3A 5L2KE 1A7QL 1FGNH 1L7IH 1AQKL 1PKOA 2OTUA 4OZIB 4L1HA 5F6HJ 3P3YA 4YDJB 2Z31B 3FO9B 5DF0A 4KKLD 4NT6B 1X4YA 5LWYL 5D93C 4UZGA 1M4KA 1SVZA 1I7UA 4FG6C 1GGYA 4Y88A 1MCLA 35C8H 1DLFL 3JUYA 1OCWL 4HWBL 5HGHB 5HBBA 3MMEB 3PGFL 4YQXH 2J5LB 5GGTL 4NNPL 1G7IB 4JM2C 1ZLWH 3S36X 1BWWA 2P7TB 4F7EB 4X6DE 1SBSL 4K3EH 2ICWB 2ADIA 5I1GH 2XN9D 4NZDA 3RDTB 2KKQA 1ZHBB 1QSEB 2HN7B 2DJ4A 3CVIL 3OXSA 2EDWA 5GIRB 5DQJB 1I3GH 4JPIB 4JY4B 3QIUC 5I2IA 5E99L 1NEUA 1IILE 2GK0B 5FF6A 3I50H 3QDMB 1A02N 5HXMA 3WLBA 1KPUB 1U8HB 3MLZL 5HHPB 1N5AB 2G75A 4NIKB 4R97B 1FORL 4ORGA 2DI8A 4HT1L 2EIZB 1ZVHA 3K81A 2DQTH 3VFWA 3Q2CA 2NXZD 1U58A 5ICXA 1DN0A 1JE6A 4R0LC 5KVFH 3IAQA 2IH3B 3VWJB 2CMRH 3KWWB 3S37X 4I18C 4JKKA 2OL3A 4JG1H 1GGIH 1NUFA 5CJOH 5DD5H 4C83A 1S7TA 5BRZA 3REVB 2E7HA 4Z7UA 3IDMB 1WFOA 4M93C 4YUEL 4DAGL 2PR4H 3MXVH 4U2YA 2IMNA 4YEEA 1JGDB 4WO4C 5HY9A 1PG7H 3SKJL 1V7ML 4EOWH 3DMMA 1D7FA 5MEOA 4ZFOB 1T83C 3TNNA 1TZIA 3IDJA 3OKMA 4YH6A 3UC0L 4LSTH 4ZS7H 1W0WA 3KPRE 2NQCA 2Y5EA 3RZCC 4JHWL 5M94B 4Q74A 1AGEA 3HRZB 1GOFA 5I16A 1S9VA 1IAKB 5DVLA 4GQ9L 4QKXB 5HHME 2R0LL 1F8TL 1UCBL 1CD1B 4HWUA 1FO0B 3MBEA 1YZZA 4JRXD 4Y2DB 4PTTA 4GMSL 1AHWB 1VB9A 3BJ91 3FCTA 2LAGB 4ZAKB 3PV6A 4OV5A 1QQDB 4Z7OF 1T22B 4J8RB 2BRRH 3RRQA 4IMLA 3L5IA 3V5KB 4PRPD 4M5YH 2W07A 4JDVA 1FZKB 1C5DB 3ZDXE 3FFCE 1IGML 5FB8B 1NMCC 3AM8C 4UTAL 2FH6A 1MAKA 4P9HH 3D25A 4LARL 1MY7A 4NJAH 3RL2B 5IGXH 2ZOKB 3S36L 5K9JH 4XVTH 5DO2C 1R6VA 4L3CA 5FCUL 4HEME 3O3AB 3B9DA 3MJ7B 1YEGL 1MEXL 1G7PB 1KIPB 2VZ3A 1KTDA 4AK1A 1D6VH 2VZ1A 2ZG3A 3TEUA 3VDAA 2B4CL 4P3DA 1LEKB 3O9WB 1WZ1L 1X5FA 4XB7A 2YK1L 4YC2C 2Z8SA 1N0XH 4JFFE 5I73B 2BHZA 5FHAH 3VD4A 4WTZG 1YPZE 4WFGE 5DJAB 1QOKA 5E56A 3OKKA 2OP4H 3MOBH 3TYGL 5MERB 4XNXL 3VFNB 5F9AC 3PWPB 3HS0A 5MENE 1MQ8A 3WDHA 1MAML 3C9NB 3I6KB 3N1MC 4BFEA 4F80A 2FATL 1C08A 4M7LL 4A2LA 4NQEA 1JNNH 3AUVA 3CJJA 3S37L 3BPLB 5D7LE 2NW2B 4K94H 4ZFFB 3GJFH 4GAYA 2PF6A 3CU7A 3DRTA 3DSNA 5D5MB 5TF1L 2DLFH 3LV3A 1J1PL 5T1KB 3EIFA 1A6VL 4HFUH 1UGNA 4XB8A 5E8NB 1UYWH 5EUKA 1XF5B 4MXQC 5C08B 3BGFB 3WN5B 2DTML 4LMQI 1YEEL 1IZKA 3KPSA 5EWIH 1KCRH 1XZ0B 3G5VA 2FB4L 5E03A 1P6FA 2JCCF 2R2CA 3OR6A 2FGZA 4R90L 5D1QB 3WLWD 5BXFA 1QBLL 1S3KH 1RY7B 1YNKH 1KIUA 4A6YH 2F74A 5LGJB 1S78C 2WV3A 2BNRE 4C54A 4RFOL 3BKYH 2IQ9L 4ELMA 1MRDL 3BAEH 4OZ4A 5LCVH 5DJ6B 4RMQA 2YPLE 4PJDB 5IIEA 4JDZA 1NLBH 5D96C 4HUVA 1B88A 1T1XB 5DK2A 3DRQA 5IVOA 4X7TA 4Y5VC 2X6MA 2QJDA 1G9NC 4UQ2B 2HVKA 5DR5H 5B3JE 1KFAL 5E2JA 3VWKB 1G6RB 1I9RL 2XZAL 4IDJH 1F3JA 1II4E 2HJFB 3N1PC 4GLRI 2HH0H 4O2CA 3TM6A 1XF3A 4R4ND 1IAMA 1U93B 4XVJL 2G5BB 5FYJE 1MWAH 4PP1D 3FO0L 1HIML 4LBEB 3GI9H 4HZLB 2FHBA 4WW2C 2K1MA 4XT1C 4Z7WB 3I6LE 4EI6A 5T3ZE 4F58L 1KEMH 3HI5H 1IVLA 2JCCA 3TYFB 3MRFB 1B90A 3G08B 3QUMA 2EYRA 4KK5D 4H1LB 3VMNA 3QFJB 4QHLA 1JGUL 4I9WD 5C0NC 4L4TD 1ZTXH 3Q48A 2XZCH 5JPNA 4NHUB 5I18L 3BZFA 3FZUD 1JK8A 4XC3L 2GSGB 4Z7NE 5B38B 4LCIL 5ESQB 2IPKB 1X44A 4NOFA 3WKML 2YUZA 4TOYL 2ARJB 1A1NA 1OQOA 1EHLL 3CFDA 4KTYA 4I48A 4KKBD 1OQXA 2R0WL 2ORBL 1BOYA 3GHBL 1KPRA 1GSMA 3F7YA 1BLNB 5CEYB 4KV5E 1NL0L 2C4XA 4K3HA 4D0BB 1ADQA 4P46A 3LKQB 2P47B 2MMXA 1MIML 3G5XA 3V7MA 2B0SH 1CXKA 4N8VA 3DSFL 4N0YH 4LLDB 4P2OC 4C56A 3L7EB 4CJ1A 2XOTA 1RUAH 4GRLC 1FFNB 4S10A 3UTSE 2AK4B 3SDXE 1A14H 4YK4C 4LLAA 4FMKA 3O8XB 4F9LA 1EO7A 1NFKA 1NMAH 2X70A 4RWHA 3VXSB 4GW5A 4WHYG 1IEHA 1XCTA 3X12A 2CDEA 1D5IH 3P4LA 4JRXA 4MAYD 1GYAA 3S4SA 3U79A 4OCYH 4H88H 1NDGB 5HGBB 3L3KA 5F9DC 4NO0A 4LEOB 4MDIB 1I7ZB 5E2WL 1YMMD 3VH8B 2E9BA 2DQHL 3HNTH 1S7XB 2JJSA 1IQDA 3DECA 3RJDA 3DVFA 4LLQA 3TN0B 2VXVH 5DFTA 1Z0MA 4ODTL 1QLFA 4PUBH 4N0FA 4RAUB 4JB9H 3U4AA 3CC5B 1LE5A 3L7FB 2PW2B 4MS8C 4PJGF 4OCLC 3ZKXC 5CD3B 4JFQB 1EBAA 1WWCA 3C5SA 3VXUA 3ULVF 2NW3B 2C3GA 2D7PA 3EYSH 4U1GC 3UYOD 5FDWB 4F33A 5MEPA 5D2LE 2Z35B 1FNEB 2FR4A 2DB8A 3IS0X 4IS6B 4XCYB 2RCSH 1ZLWK 3E2HC 1I9IL 4PB9L 5T3XL 5H37H 2VKXA 5DYOA 1T21A 5DJXB 2NTFA 3GSXB 3RVWD 4CRPA 3MODL 4NN5C 4Y4HD 3QIWA 1NKOA 1E4WH 4K3GA 3NCJL 5LKNA 1AXTH 1TDQA 5F72S 4JZJC 5EZOL 2VLLA 4HIIA 3HPJA 4NCC2 4Q9RL 3QEUA 1PYWB 2VDNH 3OKDB 3HZVA 3PWUA 3D85B 4FQJL 4NNXB 4JQVA 5FIEA 4MNQD 2EXWD 3ES6A 3VGAC 5IFHL 4NZUL 3VXME 3RL1A 2PYFB 2IAMC 3B43A 2XWBB 4WI7A 5IHUH 5HPMB 4JFHD 1V3JA 3BZ4B 4K07A 3MUGA 1MFEL 4LLYB 4FQCL 2CD0A 3ULUE 2DQEH 2X4PA 4PJGA 3LQMA 2BERA 2VL5B 3WKNA 43C9B 4HC1H 5KN5B 5C0CE 4Q9BA 1OGTA 2MQ3A 5JZ7C 5DRZB 1CGYA 3CVHA 5JW5A 3GJEB 4CN4A 1FZJA 4TSCL 1N4XH 4AQOA 4OZIE 4LQFH 3JSSA 1XIWD 2NX5B 5I1LA 1FQ9C 4HS3B 4EUPB 1SVCP 3VGBA 3QXDA 1WF5A 1T2QL 4OCNC 1QNZL 1EXUA 3DV4B 5E1HB 1BQSA 2YPVL 1VFBB 3W82A 3TNMB 1HI6A 1KNOB 4N5UA 2IANA 1LDPH 3I2CL 5F7UA 5BV7H 3B3IA 1G7QA 1D5XB 2VR5A 3RY5A 3BFOA 3OKOB 5IW1A 3OKEA 2AEWA 4K7PY 1U6AH 1JI2A 3V5DB 3ARZA 5F1KC 4PGZA 2W9DH 3HI1A 2W9EH 5IMOB 3ARDC 3WYRA 2GY5A 5F96H 5HI4C 2FEDC 1V05A 1OTTD 1CWVA 4FZ8L 1DVFD 5IB3B 5I0DA 3QXVA 1NAMA 2GT9B 3QDME 2YD4A 3JV4A 3MRLB 3T2QA 2J4WL 4HW6A 4O51A 5CINL 4NM4H 1MFDL 3NTCH 3HPLA 1W8NA 4QXUH 3E6HA 3D39E 3I02B 5DRWB 2H8PA 1VA9A 1U8LB 1K5NA 2G60L 3FMGL 3MFFA 4LLMB 3UMTA 4YFEA 5FA3A 8FABA 4U1HB 3VXOA 4EN3B 3HG1B 2FO4B 3DX6B 5FFLA 4D8PA 5FYJH 4D9RD 2R15A 5IHZA 4PLJC 3TIEB 1RUKH 4L4TA 1B0RB 3QZWG 3KXFD 3EOAB 1VKXA 4RIRB 2HFFB 5SV4A 4JFYA 1PY4A 2DLHA 1L7TH 1IGJA 5EU5A 3QRGL 3AVEA 2I60L 2IFGA 4PJFF 5T3ZH 1A1OB 3O2VH 4WU7A 5SWZD 5EO0A 4ACPA 4L8SA 1HHJB 4KJWC 3DXAB 2MKLC 1TIUA 3GMOA 1YC8A 4HGMA 1RJYB 4I3GA 1HSBB 2C1OA 4OLVH 4W81A 5C0EB 1GGCL 4NQVB 1Q0XH 4PRIB 4JREB 4BKLA 3G5YA 4U1KB 2ZUXA 3VFSA 3O41B 2RGSA 1PSKL 1ZT1A 5H8DA 5T5NF 4ZD3H 3HZYA 3IDGB 3RVTD 3BMVA 4ERSH 2MHAA 5I0ZA 4R7DB 4XMPH 5CEZE 2YC1B 3BMWA 1XGYH 5IR1B 3M17B 4OCSH 4UMGA 1MLCA 3IETA 5FYKU 1H3GA 4DKDC 3JWOL 4L5FH 1IGFL 2PO6C 1EUUA 4FXKA 4RMSA 5AAMA 1GAFH 1F11A 5CBEA 1NGXB 4G6FD 3F7PC 1QG3A 2PN5A 4L1DA 4EI5A 2CUMA 3LIZH 1U8JA 3B9KB 5FM5M 1OTSD 1NC4D 1ED3B 3WJLC 1I8MB 4ZYKA 5JMOC 2GJZB 4NQTA 2V2XB 2Z91B 3QCTL 3IDIA 2W0KA 2VSDA 4PYGA 4LNVA 4PJFA 3GUTA 2WZPD 2UZXB 2YPLD 1A2YA 5KW9L 1PFCA 1W72L 3RWIA 3REWB 3WMSA 2ADGA 5EBWB 1RVFH 1YY9D 3OGCB 1BECA 2V7HB 4G8GB 2QQKH 3UPRB 1TETL 1WFNA 1GGBL 1HINL 3SKMA 4X6EB 5D2NA 3H3KA 3UDWC 1CR9L 3EFFB 4GMTH 3HMXH 3ULUC 1T66D 4Y19D 2VH5L 5L88H 3ARVA 5MEQB 2Y5TB 4LCCC 5BMFL 5JHDD 1KELL 1U3HB 3PWPE 1IAOA 2AJYH 5HDBF 4TSAH 4ODSL 4DCQA 1NCDL 4HKZB 4PGCA 4PRAB 4QY8B 1SEBB 4HWBA 3BYTA 1U8PA 2R1YB 4NQCB 1A9EB 1ZSDB 3CUPA 2QBWA 4G6KH 3C5JA 3CFIC 2FSEA 2Z31C 3ALXA 2ERJB 4G9FB 5GGTA 4M5ZH 4M8QB 4QOKA 4MJ6B 4ZSOB 2BSRB 3SGKA 5F3HA 1XR8B 3SJVA 4K7FA 4QXWA 2VABB 4I0CC 3PQYB 4LOUC 5D8JH 3HAEH 5C08E 1MRFL 3P2TA 1P4IH 4NRYA 3TIDB 4QHMB 1AD9A 3TZVA 2B5IB 3QPXH 4YE4L 3DGGA 3RWEB 1UM4L 3VXNB 3OJDA 5CJ5A 3RDTC 3IDXL 1FFPB 5DC9B 1JHKL 1KB5B 4G8IA 4R8WL 1FN4A 1ZA3B 3PV6B 4CADA 1I8LC 2NY7L 1XIWA 4JG0L 4IRZH 4NZJA 3ULUH 1CLOH 1OT1A 3NIDF 4XNYH 4J2XA 2F54D 3QI9B 2F53D 3EYQD 3FRUB 5BQ7B 2EH8L 2MTPA 2MQCA 4UDTA 1U8OB 5J12C 1HXMB 1K9TA 5DVOA 2VDOL 1DZBA 2L7JA 3MOAH 4OM0L 3K2MC 4PJDE 3F65A 3BGMB 4MCZA 2HKFH 4MA3B 3ZKQD 1FJ1B 4LSVH 4HMCA 4OZFA 3MA7B 4OJFH 2E9WA 1TCRA 4MD4A 3VWJC 4P2QD 4L3EB 1A6AB 4XP4H 2LFGA 4F9PA 1I7TA 4MXVE 1PKQE 4K3JL 1FGNL 1RZIA 5GRXG 1DVFA 1JRHL 1B2WL 2VIRB 2ZSWA 4XNMA 1RULH 1FPTL 2BFVH 3CPLB 4IRJA 4Z7WE 3MRJA 1G1CA 1JPTH 3D87B 4XP9L 3DVIA 3MRBB 3MLXH 3O6KL 1BX2A 1S9XA 1TJIH 1PQZB 3QFJE 1MCKA 4UU9B 2BVOA 3OAUH 4LHUD 3MV9A 4FZEH 4UV4H 4XC1L 3KPLB 2C3HA 2JB6A 4NKMA 4YDVB 1QBMH 4RDQF 4E5XB 3QO1A 5E8DL 3CDGA 2D7QA 1YNLH 3VI4E 3ARRA 4U6TA 4P5MB 4JO2H 3WNKA 4ODVL 2BOCB 5ISZA 2P5ED 3ARGD 3ZYZA 5EU6D 3VFRB 4HIXH 1U91A 3LN4B 4Y2DC 4PBWD 1AHWC 4QTHB 5SWZA 3QJFB 3RWFB 1DBKH 1R0AH 2RFXA 2DD8H 1A5FL 3MRPB 4TVPL 2MCPH 2OYPA 2OI9B 1T1ZA 3UTZB 3JVGC 3TH3T 4LNRA 4L8DB 3BSZL 1MH5A 3AS1A 4HAGA 4DKAA 4I77H 3U48A 1CXIA 2VDQL 2Q86A 4KDWA 1HQRA 5IG7B 2ICEB 1XMWA 5FK9A 2AK4E 3O2WH 1XFPA 1HQ4A 2SEBA 4OT1L 4V1DA 5LGKA 3PNWB 4OF0A 3BKJH 5I76B 3IJSA 1X5ZA 1OAQL 1Q8MA 3EW3B 4G43A 4LSQH 5DD5L 5TE6L 4D3CH 5D1XD 1F90H 1FNLA 1SY6L 1I1CA 3PXJA 5IW6A 2PR4L 3O9WC 1WGOA 1LO3L 3K1DA 1J1OL 3UP1A 2ICWI 1ZS8B 5CEZH 1MOEA 1YEKL 1F5WA 1LK3H 3PJSB 3PGDB 4LSTL 1CVSC 1KBGH 2Q3AA 1UWEL 2D9CA 1FO0H 4KRNA 4LSRH 5B22A 2HG5B 5KVMC 2NY2D 4PJ5A 5EU4A 1FVDA 4LKCA 4Q0XH 4MD0B 3GB7A 2O5ZL 5C0JB 4I13B 4H1LG 1JYVA 5CSGA 2Y25A 3MLYH 5EUOB 3O6MH 2VZOA 3THML 2Q7YB 4MLIA 1MREH 1C8PA 5K59E 5B38G 1S9WB 3BPLC 3QJHB 5GGVL 1NGQH 1UM5H 3UO1H 5IEKB 5KJRH 4OGXH 1MJ7L 1KIRB 5HHQA 2EEAA 3EJYD 4NBXB 1LP9E 2EKJA 4PY8J 3WEXA 4M5YL 3KLHC 3BGFC 5CMAB 3WN5C 3GBNH 4O00A 4IIQB 4G9DA 2YOCA 5CJXC 3L3IA 4R4FL 5IHBA 4JFZH 5FKPB 1TVBB 3HE7C 1KN2H 5HDQH 3GGWA 4UV7H 3LN9A 5D1QC 5DWUH 4P9ML 2WP3O 1IGCL 3ULSA 1D6VL 1R5WA 2AI0H 4HKXA 3GSWA 3NCCB 4BSVB 2BSTA 4U33A 3S5LB 4FXGA 2E5EA 5ICYA 3M45A 1ZT4A 2YPKB 4XRCB 2QSCH 4AH2B 3K2UH 5DHVA 1MIEL 4JO3H 4PV9A 1Q9OB 3L3JA 1MHPL 3DIFB 5I1CL 3VH8G 3QQ9D 4WFEE 1RZGA 5E6IC 2OP4L 2NX5E 4UB0H 3VWKC 3BQUB 3KJ6H 3VXRB 3NA4A 4HJ0C 3TCLA 2EKSB 4MYWB 3D2UD 1FFRA 2WQRA 3VGDA 2BVTA 3BXNA 4F37K 1R5VA 3ZSTA 4MB4A 1AO7A 2UY6A 3TLRA 5JOFA 4LAQL 1YEIH 2RBLA 3ZE0F 1JWMA 5ENWB 3LDBB 3EO0A 5ADOH 4Q7DA 4XX1G 4TNVF 4WGVB 3IJHB 5A3IC 2DQDH 4IOIA 3CDYA 3QFDA 2DLFL 4HFUL 2YKLH 5H35B 1UYWL 1EIBA 1FGVL 1OAUL 3SDCA 5E70A 3EFDH 1DE4A 1KG0A 2P45B 4L4VD 2LAAA 1G0XA 2NY4B 2W0PA 3U9UB 1JZ7A 1EFXD 4GRMA 5EWIL 1Y18B 4NC2B 1G7HB 2VAAB 5B8CA 2L0DA 1QLRA 3D6GA 4WNQA 3GIZH 4P4RB 3P9LA 1CE1H 1AD0B 4FS0A 2FDBP 2JIXA 4JZNA 1YNKL 2W60A 1EJOH 1XH3A 3PHQA 5E5MB 43CAB 3QPQD 2X4NA 1SJEA 3TPUB 5DUML 1WLHA 4XH2B 4TN9A 1G6RH 3Q3GB 2R29H 5CZKA 4CMHB 3PDDA 5LCVL 3CX5K 3HG1E 5DMKA 4IJ3B 5C71A 3BIAX 5F9WB 4N1EA 4X7EC 3RVUD 3AREA 1NLBL 2EXYD 3LB6D 3QUXD 3SE9L 3B5GA 3TWCL 4XPFH 1ZLUK 2YD3A 1FE8L 1P2CA 3TBSA 1Q1JH 3O8XC 2HH0L 1P7KA 5AYUH 1OGAD 1U3ZA 1KJ2H 4Y4FD 1IAII 1R3HB 5INDB 1MWAL 2CK0H 3QNXA 4BA8A 3DXAE 3GRWH 3U0TA 5IQ9B 2E7LA 2GITA 2GTZA 4FFWC 2J6EH 3KYKH 4P2YA 1CFTB 1QSFD 4PRIE 4DN4H 4HGKC 3LSOB 5CKGA 1KEML 2VLJD 2CJUH 3TN0C 1X7QA 3MV8D 3T0ED 3P40A 4FTVB 1ACZA 2Z92A 3MRDB 1DP0A 3GSNB 5I9QB 4KKCD 3T0WA 3D0LB 4GW1A 1U95A 5T33H 25C8L 1CF8L 4FFVC 5I1DB 4X6CF 1YEJL 2DQJH 5D7JA 1DFBH 5CGTA 2ZNWA 3QAZB 2OJEA 2M26A 4JPWH 4XXDA 1RIHL 1XF2A 5J8OA 5DQ9B 2A2QT 3BPNC 4P23A 3BIKB 2Z8RA 2B8OT 3NA9L 1CFBA 5E8EB 4DVBA 3S7GA 1YMHB 4IRSB 4RISH 1VPOL 3BWUC 3SOBL 2LE9A 1JV5A 1G9NL 1ZLVH 5GJSL 2UWEF 1CBVH 5KOVC 4HWEL 4JFXB 3MJGX 1NJ9B 3LD8B 2BY2A 4Z7QF 1SM3H 4BH7A 3HFML 3L1OH 5MHSE 3MNVA 1H15A 4I0KA 2XI9A 2WBJA 3F12A 1FV1A 1RUAL 2FJFB 3EGSA 3NZ8A 1K8DA 1A14L 3QUZB 1IL1A 1IC4H 5MI0C 4G8GE 4XCNA 4Y1AB 3VRLE 4BQBA 4OUUB 2EECA 3BHBB 3NACH 4DKEL 3D69A 1R24A 3CFEA 4DUVA 3IKKA 2C3XA 2HTKC 3H3BC 2GJ6D 2BMKB 2H1PH 4Z77B 5D6DA 3AAZB 1UB5B 4Z78A 4GW4A 4LP4A 5EBLA 2VDRL 4X6CA 3ILPA 2EDDA 3GMNB 1BIHA 1EERB 1QRNA 1JJUA 2QSVA 2JELH 3IDNB 3UTPE 4M00A 5GRWA 3EO9L 4HH9A 3VFTA 1F6AA 2APTA 4JQXC 1CDBA 2OTWA 1CDJA 1M7IB 5ITFB 3C09B 4G9FE 1ACYL 2UWEA 4G7YL 3EYSL 1FIGH 1NPUA 1WSST 3PHSA 3MRKA 4V2CB 4KJYA 5SWSB 1D6EA 5JMRA 1GPOL 1N8ZA 3BH8A 1S7RB 2Q87A 1L9MA 3QDJD 1E4XH 3PQYE 2VZVA 3D3VB 2CR6A 3H9SD 3PUCA 1KTLB 3RKDD 1TZHA 3VRJB 4PJAF 3SO3B 5DHYA 1M71B 1SYVA 2CPCA 4AG4H 1CFSB 2HJLA 1RV6X 5LGHH 4PG9B 1ZWIB 1KCVL 3TH2T 4Z95H 4J6RL 3BDBA 1OP5H 2VDNL 2FYYA 3FHQA 3BRDA 1Y0LA 1SEQL 4FQHB 3FB5B 1DQDH 1T4KA 3SDDD 5LQBH 2QADB 5CHNB 1ZEAH 5EO1A 5IHUL 3GSQA 1KEGL 4NO3A 5DI8A 5DEZA 1LO0H 4RWYL 4KKAD 2WINA 1UQSB 2DQFB 3T8XA 2DQEL 3G6AA 1DANT 2V5RA 5A43C 1NFDE 3WFCH 1IM9D 2R0ZH 1T0MB 4P2RA 3OKNB 4EUPH 4WU5B 4LLVB 3IXAA 4L3EE 1ETZA 4TRPH 3RTQA 4U1SB 4EN3C 3EBAA 4M62H 1VFOA 4K3DH 3CFJA 1J0YA 2DI7A 3TT3H 4UIKL 1FLTX 4JPVL 2HRPL 2PYEA 4LQFL 2AKRA 4K55A 2VR9A 4FABH 1A4JB 5C0AB 2W1NA 4PJAA 4S1SH 4Y5XB