1HQRB

Crystal structure of a superantigen bound to the high-affinity, zinc-dependent site on mhc class ii
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
189
structure length
180
Chain Sequence
DTRPRFLQQDKYECHFFNGTERVRFLHRDIYNQEEDLRFDSDVGEYRAVTELGRPDAEYWNSQKDFLEDRRAAVDTYCRHNYGVGESFTVQRRVEPKVTVYPAHNLLVCSVNGFYPGSIEVRWFRNSQEEKAGVVSTGLIQNGDWTFQTLVMLETVPREVYTCQVEHPSVTSPLTVEWRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA-DR ALPHA CHAIN
publication title Crystal structure of a superantigen bound to the high-affinity, zinc-dependent site on MHC class II.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 34
structure length 180
sequence length 189
ec nomenclature
pdb deposition date 2000-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1hqrB02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 1hqrB01
3ZE1E 3B5TA 2VLKA 3GSNA 4Z95L 1CFVL 1BMGA 3NPZB 4JKKA 1ZOXA 4PJBE 2VDLH 4P99A 1LD9B 4G6JL 1KTRL 4OZIE 5DK2B 4L3EE 1C5CL 2Q8BH 5C0AE 3DSFH 5EIIB 3RGVC 5C6WH 1LD9A 2OI9B 5E8EA 5DK2A 4MD5B 5EIIA 4KFZC 3QIWB 4MD5A 5L7XL 1JFQH 4TPRH 3QIWA 2BSTA 5GGSB 4JKPH 4KHTH 3QDMD 1FORH 4ACPA 1CFNB 2D0HA 1ZLWH 2GHWB 5GGSA 4L5FL 4RAVB 1CFNA 1V3JA 1OARL 2NY7H 4RAVA 2P49B 5I8KH 5DA4A 5IHBA 2FHBA 4KPHH 1F3JB 2WNGA 1MVUB 4KMTL 2J6EH 1F3JA 1MVUA 5KVDL 3TN0C 1KN2L 4BSJA 4UIMB 4XCNB 4QXGH 2AS5M 3MLVL 4UIMA 3BESR 4XCNA 4XHJD 3CFCL 2VDMH 1KJ3H 1F8TH 4K8RL 1I1YB 4C83B 2E3VA 4YUEH 4YZFF 1I1YA 4C83A 2NY5H 3HUJF 4O4YH 3HE6B 4PJIE 1F4XL 5HYFA 3GRWH 5I74B 1FNLA 2DJSA 4OB5L 3HE6A 1LWRA 2MWCA 2QQKH 3ULUL 1IRAY 3AREC 4WFEE 1J0JA 5CUSL 1RAMA 2CD0A 2ZP0T 1OL0A 5GRUL 4PBXA 1FRGL 4KHXH 5T3XE 4Y2DB 4KRPC 3SJVE 3RWCB 3ZDZE 4RMWA 2RFXB 4Y2DA 1PAMA 5EZIH 3RWCA 4LFHG 1DEEA 2RFXA 4Y4KB 1T21B 1IM3B 4GBXC 4Y4KA 1IM3A 4LLQB 3EYQD 2C4FT 4GW4A 4BSWB 4LLQA 5D9SB 4EN3B 4BSWA 3RX8A 3BEWA 5F70A 1RHFA 4EN3A 4JDTH 2Z8SA 5IB3B 2F53B 1Q0XH 4MQ7B 5IB3A 2F53A 3RGVB 2O5ZL 4MQ7A 1QSFD 3RGVA 2LVCA 3LZFH 4NQDB 5J0BA 4MAYC 5CSZB 1GOFA 2EEAA 1JGUH 3QCTH 1HCFX 3M8OH 2I9TB 2IPUG 5CSZA 3MBXL 4MDJA 3IFPB 4L8DB 2I9TA 3RI5F 2PXYD 3VFVA 1HINH 4WFGE 3QDJD 2ZPKH 3MUZ1 2PETA 3IFPA 4MB5A 4L8DA 3RX7A 5A1AA 1CE6B 4YJZL 1ZHBB 1CE6A 1DE4B 2DN7A 1ZHBA 3OG4B 2H2SD 1DE4A 1SHMA 3TN0B 3HAEB 4Z77B 3A6CL 1G1YA 2FLBT 3HAEA 4Z77A 3VXMD 4OLYH 3QI9D 3AB0C 2BVTA 2VDQL 2XQYG 5JW3L 4HQQL 2R69H 2XN9E 5E95B 2W9DL 2EDXA 3E8UH 2EYSB 4BK5A 3O6ML 3Q3GA 1FC2D 3E2HC 5EIQA 3UYPA 4OLVL 4ZSOA 3U9PH 1TZHB 2NYYC 3O6FD 2OJZL 1H3GA 1TZHA 3E1F1 2C3HA 3AREB 4FFZL 3WUWG 43CAB 1R0AH 5LGHL 1YMMD 2P8PB 43CAA 2FDBP 1FFNB 5D7KD 3HG1D 4AL8H 1H3UA 2P8PA 5C2BH 3VFPB 5FUCE 3O81A 3PWUB 2IPUK 4KRPB 4P5TC 2JJWA 1MFDL 3VFPA 1ROWA 3PWUA 3RWEB 3U7YH 1A6TA 3GDBA 4JM4H 1PZ5B 2VLKD 4DTGH 4YXLL 3RWEA 1PZ5A 4GBXB 1T66D 4PIRF 1N4XH 2F58H 4JO3L 3WFBL 2FBJH 4FQ1H 5BS0E 3FQRB 3S35X 4QLRA 1AIFB 2P48B 3FQRA 5BZWB 1DCLA 2XQYK 1AIFA 1HYRC 2FECL 2JB5H 4OCSL 3QWOB 5BZWA 4CMMB 1LO4L 3IU4L 3C2AH 3QWOA 2D3VA 4CMMA 2Y5EA 1G6RB 1QACA 4MAYB 4F9PA 2J8UE 3KLAB 1G6RA 4FQCL 4HUKB 4MAYA 3ULUF 3KLAA 2F74B 3F65A 5GGSY 4XPFH 5AEAA 4OLXL 2EE9A 2F74A 4RWHA 5AAWA 4JRWA 5H94B 2C4XA 2F54E 3KXFD 3T0AA 3MRJA 3AM8C 2D9CA 3UC0H 5H94A 4CL7A 5M95B 4U1SB 4M43L 1P4IL 3QQ4A 3CSGA 3P3YA 1Q72L 4U1SA 1K6QH 1KCVH 1YY9C 4JR9L 4NUGL 4M6AA 2VH5L 4G8GB 4N0YL 1FDLH 2W0KA 5D8JL 1I3RB 4G8GA 2ZG2A 3AB0B 3T09A 4N9OB 5E1AB 4OLUH 4IRJC 4DGYH 1I3RA 4GRMB 4X9GA 3PWVB 1JTTA 4ODBD 5E1AA 4GRMA 3JTTB 2W9LA 3PWVA 4L4VD 1A6ZB 5E8DL 3E2HB 3JTTA 1A6ZA 5BV7H 5DJ6B 3GBML 1HZHH 1JL8A 4L9LC 4UTAL 5DJ6A 1RI8A 4OCRL 1GRWA 2EC9U 3EJJX 3PP3K 4FXLA 3ZHKA 3VGFA 4Y2DD 5GHWH 1F90H 1B3JA 5KS9B 1UCBH 4WUUE 4HUVB 1II4E 1WWAX 1MJ8H 1DL7L 5KS9A 3MUY1 4O58H 4HUVA 2FO4B 4P5TB 1U93B 3O9WC 2CH8A 1VPOL 4ENED 3PE9A 4P5TA 3GNMH 1U93A 1YQ2A 5HHVH 5FYLE 1MNUL 3P4LA 1BFSA 1NMBL 3U36B 3WNOA 2FJFB 4XP6L 1QFPA 3U36A 2DQIH 2HFGL 2FJFA 4HEPG 2F53D 5DEZA 3LB6C 5IK3B 3WKML 1L7TH 3RGVD 4ZUTB 5IK3A 4B41A 3D69B 3IRPX 3QFDB 4HXAH 4ERSH 4NQDD 4ZUTA 2ZCLH 3D69A 1RJZB 3PWPB 3QFDA 2PYEE 1PG7W 1E6OL 1A7OL 1FYTE 4M7JL 4MNGE 1RJZA 3PWPA 4GAYA 4Z5RB 5DJXB 3X14B 2WWMD 5DUPH 4Z5RA 4JG1H 5DJXA 1OAQL 2FB4L 2AXHA 3X14A 2K3TA 1I7ZB 2OMNA 3PGCB 4X7EC 1T83C 4U3HA 1I7ZA 5GRZA 3PGCA 5HYSB 3NAAH 1A6VL 3Q6GH 3CUPB 4D9LL 1T7XA 3AROA 3TN0D 2IQ9H 4AEIH 1IC4H 5F7EL 3AM8A 3CUPA 3QO0B 2FBOJ 5EZJB 2IEPA 5ICZB 5HHOD 3QO0A 1T22A 5EZJA 5HPOA 4N8VG 5M94B 4XC3L 4OGAC 1TQBC 5ICZA 4NCC1 2IFFH 4NCC2 4IRJB 5TPWH 1MCWM 2ATKA 1IM9B 4IRJA 5TDPB 4M6OL 1IM9A 3P77B 4DJMA 1A47A 5TDPA 1QKZH 1CTOA 2H6PB 3ARED 1IT9H 3P77A 5HHPA 4JLRB 3ORJA 3W0WB 1K3IA 2H6PA 4YX2L 3IU3B 4JLRA 4F15C 3W0WA 1T0MB 1FBIH 4DKFL 1ZLSH 4YDLC 3G5ZB 4EBQL 1ZGLM 3IU3A 1T0MA 3C09C 4KRPD 2ICES 3G5ZA 4F7EB 1JPTL 3LPGA 2OM5A 2VAJA 5BOPA 2UV3A 1NAMB 3EFDH 4CAGA 4TSBH 4F7EA 1WCBB 3VXRD 3U2SB 1RQ5A 3O9WB 1NAMA 4WIQA 3U2SA 1WCBA 4FQPA 4OAWB 5CZVL 1Q9WB 4GBXD 4HPOL 3A6BH 3O9WA 4F57H 4HWBL 3MNVB 4OAWA 3BKJL 3RRQA 1Q9WA 1QBLL 4WTZG 4OZ4B 2QADB 4P2CG 3MNVA 4KV5E 4CVUA 3TJHC 4OZ4A 2K1MA 2XXCB 2ZG1A 1NL0H 5DD5L 4H0GA 3VG9B 3GZKA 4OZHE 2MKWA 2G5BB 4GAFB 2G5BA 1F4WL 3C08H 1MCSA 1NC2B 1XH3A 2G75A 4MAYD 1UKSA 2LABA 3VGGA 3WFDH 1NC2A 1U9KA 5J6GB 5CEZD 3WIHH 3I2CH 3N9GL 4XNXL 2MCG1 4Z7UB 3ZE0F 5J6GA 1XR9B 1OP3H 1S9VB 1HHGA 4Z7UA 3MMEB 4X6CF 4PP2B 1ZSDB 2YUVA 2VISB 1S9VA 3MMEA 2Q6WA 4PP2A 1ZSDA 2VISA 4YHKH 3JWOC 5CILH 1T83A 1DBKH 4G8GD 3CGTA 5BOZG 4CGTA 3AMLA 2ZZUT 3TNMB 3IS0X 3FN0L 5C0RL 1S7TB 5IB5B 3TNMA 2AXJA 5T33H 3MLPA 1N6QL 1TQBB 1S7TA 1KFAH 5IB5A 3WJJC 1NCNA 4U1LB 5HGBB 1UACL 1LP9B 4U1LA 4UDTB 5D7SH 5HGBA 3VXNB 2NYYD 5I1IL 2XRAL 4UDTA 1OAXH 4WI3A 5FYJH 5KSBE 4PREB 5AAMA 3GGWB 3MYJB 4CKVX 2ZOLB 5K59F 1PJ9A 3FMGH 4PREA 3GGWA 3MYJA 5L0QC 4F15B 1EVTC 3SE8H 4YDLB 4RFOH 3SOBH 4FZ8H 1KLUB 1CK0H 2D7OA 4YFLI 4P5TD 1INQA 1AJ7L 1J1OH 5I8OH 1KLUA 1AXSB 3PWNB 4UT6H 3WMSA 4W81A 1NUGA 1AXSA 1CQKA 1H9VA 3PWNA 1PKOA 4M7LH 1RZJC 3N50A 4R4NC 2V5SA 4ODVH 5GRVL 1WEJL 2CDEB 4HT1L 1FFOB 3BGAA 2CDEA 1FFOA 5JPNB 3DYPA 2DQEH 3KJ6H 3IDJB 4OJFL 4KZDH 4LRIC 3T0DA 3WXVH 1KLGB 5JPNA 3KPOA 4N1CA 2OYPA 2GJJA 3IDJA 3FTGB 3PWPD 5DHVB 1KLGA 2ADFL 2M1KA 3CLEH 3FTGA 5DHVA 4B5EA 3VA6A 3PV6B 1HIMH 1YEKL 1IGFH 3PV6A 4PJGA 5F6IC 4LGRB 2XQBL 2MOVA 5FEBA 1X5JA 1DZBA 2VXSL 5J06A 1AR1C 5ISZE 4P3WA 2HWZL 5F6HJ 1UVQA 3QXWA 1HH9A 1TJGH 2X4RB 4HC1L 1YY9D 4P3CH 2EYTB 2X4RA 2O61B 3UCRA 5TGBA 4PY8J 4KUCF 1YJDH 2O61A 1BQHB 4IRJD 1NUFA 1ADQA 1BQHA 2OK0H 5I9QC 1F42A 1MOEA 1IM9D 2HFTA 3TH2T 1WT5C 4BZ1H 2OZ4A 1KACB 3QUZB 2M8XA 4H8WL 3WJJA 4Z7WE 2WW8A 3QUZA 1BFTA 1ULVA 2YN5A 3V6OC 3W0WD 5DZNA 2XXMB 4ONFL 2OSLB 1I85A 5K9JH 4S1RL 1OTSC 1U8PB 4LLAA 5SWQB 4PRHA 3TF7C 1I9IL 2OSLA 1KXTB 2ICCA 1BF8A 1U8PA 4FQLH 5SWQA 3GBLA 3FN3A 5L0QB 3CC5B 3S4SG 1E0OB 1G6VK 3OZ9H 3I3BA 3O9WD 3QXVA 5FYKE 1NCCL 2CXKA 2EDHA 1B4JH 3B2UC 2EIBA 4LVHC 1F5WA 1RUPL 4PJ5B 4X9HA 5KVGL 4PJ5A 5DUML 4Z0XB 1ZA3B 2XTLA 1KCLA 4P59L 1MY5A 4NZJA 5TF0A 4Z0XA 5CGTA 4JGJA 1ZA3A 1MRFH 4ZO9A 2CR3A 4H1LH 5B3JF 4G6ML 2BVPA 1P4BL 4KTEL 1YC7A 3LB6D 4XP1L 2J4WH 1FCGA 1F4HA 4JY4B 4U4BA 1FFPB 4HH9B 4JY4A 1EUUA 4LRIA 2I07B 2QSVA 1FFPA 4HH9A 1A5FH 3RWJB 1JI2A 2R0ZL 4TYUA 2I07A 4HWUA 3RWJA 3OBAA 2A9MH 4U6XB 5D7IF 4BUGA 5ICYB 4U6XA 4NKIL 4H1LG 5ICYA 2QQLH 2DLTA 3ARTA 5F9AC 1X5FA 2NY5C 1E28B 1L6XA 3QXAB 2H32B 1CLOH 1E28A 3GKWL 1MFBH 5H35B 3QXAA 1WAAE 3IKKA 5H35A 1HKFA 3RL1B 4L4TE 3C87A 4KI5F 4OGAD 3RAJL 3WXWL 3RVWC 3TM6A 3RL1A 3EGSB 4NFDA 3CSPA 3BRGC 3GJFH 1EFQA 3EGSA 1QRNE 5T1DL 4PG2A 1T1XB 5FDWB 1H3PH 1QRKA 5A16B 1G0XA 4LSRL 4XPHH 2XI9A 5FDWA 5A16A 2DTMH 1S7QB 5I1HH 1JE6A 3BYYA 1P53A 1PQZB 1S7QA 4Z7VB 1CGVA 4X9IA 1PQZA 4K9EH 1PKQE 2CUMA 1EAPA 4Z7VA 3FQNB 1XCQB 4QT5B 5IHUL 1A9EB 3S36H 3FQNA 1IEAB 4RAUB 5ECJE 4XVJH 1XCQA 4QT5A 1A9EA 1AE6H 1MI5B 35C8L 1IEAA 5TH2B 4RAUA 1JF6A 2CKBH 3H9SB 4LVHB 3GEWB 1OY3B 1MI5A 5KW9L 5TH2A 5JMRA 3H9SA 1JIBA 1PLGL 2NZIA 3SGEH 1M7IA 1DQDH 1U92B 3NTCL 3TJHD 3P4OB 4LSVH 4ODTL 3CZFB 1QNZH 3P4OA 1QEWB 4W6XB 1RIVL 5INCB 2R4SL 1QEWA 3JV6B 1ZVSB 2OTUB 5INCA 5I17B 3UZEA 3JV6A 1OM3H 4A6YL 1ZVSA 4O2CB 2OTUA 1DQMH 4EUPH 5I17A 3DOSA 2J6EA 3UO1L 4O2CA 4GAJL 1G7QB 3IAQA 4KJWC 1JPFB 1G7QA 3GBNH 1S78C 1JPFA 4K3JH 4LKXA 4LSDA 4NM4L 1YEHH 4OD1H 2ZUVA 3KPNB 3X17A 2DMBA 1BF2A 4M6MH 3X13B 1QSVA 4HG4K 4JB9H 4H5SB 1T3FB 2K9UA 3X13A 4B50A 1S5IL 3O3UN 5IP4A 1QFWL 5GGTH 3GRWA 2VXQH 4H5SA 1T3FA 3B9DA 3GK8L 4UTBL 1T5XB 2FH6A 2P8MB 4NQEE 4U33A 2AKRB 2NNAB 1T5XA 2P8MA 4PJCB 2AKRA 1HKLL 2ENSA 4JFDB 3LEYH 4BFEA 2NNAA 3MTRA 4PJCA 1JZ2A 2FEEI 2VLLB 4JFDA 4MNQE 4E41A 3I50H 1UQSB 1PSKH 3V52H 2VLLA 2YD4A 1BFVL 4JFQB 1UQSA 4OCWH 3QZWG 4NO5B 4JFQA 4O9HH 4UT9L 4OM1H 4PS4L 5T3XL 1PG7H 3VFWB 4F9LC 1J8HE 3TPUB 4NO5A 5GRXG 2NW2B 5BO1L 4N0FB 4D9QE 5IJKC 5HYJE 3VFWA 1DLFH 2VITB 2NW2A 1HHIB 4N0FA 4NM8H 4ONGL 2R56L 2A6KB 2VITA 1JTPA 1HHIA 4JJHA 3S35L 2B1HL 1KV3A 5FDYA 2XKUA 2A6KA 4OF8A 4PJ5D 5C8JB 1BEYH 4F7MB 4HGMA 5F96L 3NOIA 2DIJA 4FFVC 5JUEH 5C8JA 4F7MA 4PJ7B 4R4ND 2DKSA 3SE3C 4UB0H 1L9NA 5F7KC 4PJ7A 2VLME 4A2LA 4MD4B 2BY1A 4NO0B 1XEDA 3C9NB 2A77L 2E27L 4MD4A 3P73B 4NO0A 3QXUA 3C9NA 5DRNB 4FOMA 4JHAL 3P73A 2PN5A 4RGOH 1DBAH 2BJML 3J8F7 3P2TA 2FGZA 3V0WL 4GFTB 3SKJH 4K2UL 1ZTXH 1T7WA 5TE4L 2E6JA 2YC1A 2MMXA 2NY0C 3HPLB 3O0RH 3MLYL 1GVIA 3LPFA 1OGTB 1NCBL 4RFEB 3WD5L 5JZ7C 1AR1D 1O5DT 2AJSH 4DVRL 3HPLA 4CNIB 2OL3B 3UTZB 1OGTA 2OJEB 4RFEA 1JGVH 3PWJB 4U2YA 4CNIA 4R90H 2OL3A 4TOYH 3UTZA 3V4UL 2OJEA 5CJXC 3PWJA 4R97B 4TSAL 5JIPA 3TBWB 4XMPH 3MFGB 3TBWA 4LNVA 5LVEA 3RUGF 1HE7A 3H42H 5FA3B 5BMFH 3UMTA 4PJEB 5FA3A 2Q3ZA 4YHLH 4FFYH 2D4FA 5E4EC 4PJEA 5BZDA 1TTUA 3VWJC 1VFOA 5E56A 2BXYA 4CADB 5FGCE 3DURB 1OTSD 4GG6A 4CADA 4QTIH 4K3EL 2UUDK 2FHFA 3DURA 5D93C 1P9MC 1ODAA 3KYKL 4U49A 1W0VB 1Z5LB 1OSPL 5L8JB 2ZSWB 3C6LA 1W0VA 1Z5LA 4XPTH 3TIDA 2ZSWA 2EDDA 3B2UD 2ERJC 3H9SD 4X6BB 2DIAA 4R4FH 4ORGB 5ACMA 3ZMRA 3QSKB 5DTFB 4X6BA 1FZOB 4HPYH 1J0ZA 1Z6JT 5H2BB 2O93L 4ORGA 3UJJL 1IGML 4NUJB 5DTFA 3MXVL 5EUOB 3FJTA 1FZOA 5H2BA 2Y06H 5DK0B 4NUJA 5EUOA 2N7AA 3SE3A 3JUZA 5DK0A 2Z93B 3BP6B 4G8EB 3WFCL 4HAGA 2PNDA 2Z93A 1K8IB 1EZVX 4G8EA 1RZKL 4JM2C 2B1AH 3RBSA 1K8IA 4NHCH 1OW0A 2FH8A 4AEEA 2HFEB 5IT2L 2AJZB 4DKEL 2HFEA 3OPZH 2AJZA 1WZ1H 4JPWL 1LEIB 1EGJH 2VZOA 4U6TA 4E5XA 2DICA 1LEIA 1QOKA 3Q1SL 4YQXH 5D1QC 1I3GH 3WEXB 1N0XH 3VRLE 2VUYA 1SMOA 5HGAA 2AQ2A 5C0BE 3ZZ1A 4H0HB 2G2RB 5GGRB 5T1MB 3WEXA 3VFNB 3LHPH 4EI6A 1X4ZA 2G2RA 5GGRA 3DI2B 5T1MA 5CJXA 3VFNA 2FYYB 1DDHB 2K7PA 3RVWD 1ORQB 2FYYA 3EYVB 4B0MM 4S1SL 1DDHA 4V1DB 4Z9KB 5AWNH 1ORQA 5FM5O 3EYVA 4G6KL 4V1DA 5HI5D 3RVVC 4Y1AB 2Y9RT 3ECBB 4OF0A 4TSCH 3HRPA 3HC3L 1R3IH 2CDFA 3LQAL 4GJTB 1CDCA 3EO0B 4Y1AA 4LSTL 1RULL 5JIKA 3VWJB 4IS6B 1MFAL 4LLVA 4GMSL 1BQLH 3EO0A 5J1SC 3VWJA 4IS6A 4OI8A 2FX9H 5HD8C 4PLNC 5KSUB 4DOHB 4TULH 5D93B 2CGRL 5KSUA 2A2QT 3FRUB 4LARL 2EH7L 5FHBL 3FRUA 3VRIB 4ZUVB 3TIEB 1OAZH 5IMKB 5F97E 1U8LA 3VRIA 4ZUVA 3TIEA 4XC1L 1H15B 4PB9H 1AXIB 5IMKA 1H15A 4NO0D 3O2DH 5I1JL 5TQ2L 1Z0NA 3UDWC 4CVXB 3QFJB 4OQTH 4RGMC 4CVXA 3QFJA 3CVHH 4HKZB 4RMSA 1GYAA 1CF8H 5KVFL 3NA9H 4Z7QF 2YSSB 4HKZA 3QG7L 2MTPA 2CJUH 3B9AA 3MCKB 4IEFB 1U8MB 3WIIL 4QYOB 4DAGL 2YSSA 4JM2B 3MCKA 1I9JL 1U8MA 4QYOA 4OZGF 4JM2A 2J8OA 4J3WA 2X10A 4KJWD 1TFHA 4QXTB 2EEBA 1J18A 2AI0L 4HJ0C 1B4RA 1S78D 4NZRL 4QXTA 2RBLA 4XAWH 1FNHA 3MX0A 4KVNH 4E42B 2FSEB 3ARZA 5D1QB 5I1LB 3MCLH 1UADC 4E42A 2FSEA 4F8QA 5IESH 1MCOL 12E8L 5D1QA 5I1LA 4FN0A 3DVIA 5IUSA 1W0WB 4MXVE 4M3KB 4P9HL 2OBGA 1W0WA 3MLZH 4R0LC 5DJYB 1TDQA 4JRYE 3FL7A 1N64L 1CG9B 4XMKH 2X41A 4HHAB 5DJYA 3MZGB 1CG9A 4FQJL 4HHAA 4ZUSB 1TLKA 1FVDB 1GAFH 3X3GL 4ZUSA 4GH7B 1FVDA 2OXGA 5EPMB 2FECI 1RUKH 5EPMA 3BT2L 4KMQA 4XXCA 1KN4L 3EFFB 1AGEB 2WBWB 3B43A 1KCSL 4NJ9H 1WCQA 3RZWA 1UA6H 3EFFA 1AGEA 2P5WE 4S2SB 4X6FA 4F7CB 2C1PB 4S2SA 3IAGC 4OUOA 1IGYB 5L2JB 2NLJB 3QH3B 2C1PA 1IGYA 3TBSB 3QHZL 5L2JA 2NLJA 4FFVD 3FO2B 3QH3A 3QEHB 4NC1C 4OGYL 3TBSA 3P30L 2R4RL 3FO2A 5TDOB 3QEHA 5DUBB 5MHSE 5IVXB 5L88L 2UWEE 5TDOA 1AC6A 3DHMA 5DUBA 4JO4H 5IVXA 1BQSA 3LKPB 4YC2C 5C0FB 1CFBA 4M3JA 2CLRB 3LKPA 4ZUUB 5C0FA 3UDWA 1IC1A 3WIHA 1WFTA 2CLRA 1EJOH 2ZUSA 4ZUUA 4YHOL 5GJSH 3BYTA 2DQCH 4HH8A 4ZOEA 3SDXE 3OKNB 3V4PH 2ZNWA 2WZPD 3GM8A 3OKNA 2W59A 1DFBH 2KQNA 4JCMA 1YJDC 1JYWA 2NY0D 2WAHA 1NAKL 1Z9SA 4JQXA 4PJHE 2E7LC 5JZ7D 5IF0B 5CJOH 1JNLL 4I9WD 5IF0A 1AO7D 5E8PB 1GC1L 3ZE2E 5E8PA 1OGAD 2XZQH 4Z95H 1CFVH 4R0LB 2Z8WC 5GGRY 4V1DD 1YA5A 4R0LA 5C0NC 5FXCH 4N0UE 2FD6L 3ZYZA 2BDNL 1YYML 4Y1AD 3H9ZA 5L7XH 1PX4A 1I8MB 4K3DH 4HS8L 4QGYA 2VQTA 3CK0H 3VWJD 3FT3B 1J87A 1VCAA 1I8MA 3DYMA 3QUMH 3CZJA 1FZKB 1OARH 1KC5H 3FT3A 5JXEC 1G9MH 4WI9A 4K7PH 1OAUH 1FZKA 4D0BB 3SDCC 1XF4B 2MCPH 4KMTH 4YHMH 4ZSOE 4D0BA 1XF4A 4DN3L 3VFMB 2C3WA 3T2OA 5KVDH 3I3EA 3QR2A 3VFMA 1KXVC 1WV7T 4KKBC 4NN5C 4BZ2L 4U1JB 5FCUL 3CFCH 1G9NH 2OP4H 2BC4B 1DBML 4U1JA 1I3VA 4RMTA 5EU7C 1MY7A 2BC4A 3THML 4AEHL 3MNZB 5HVWA 2HKHH 2XTJC 1CGYA 5D72L 1YN6B 5I19H 1AI1L 3VXSB 3MNZA 2VZVA 4ZTOL 5D2LE 5E00B 5DJAB 5H8DA 1YN6A 4J3SA 2J12B 1V3LA 3VXSA 1U58B 4XB7A 5FCSH 3O4LA 5E00A 1MJUL 5DJAA 3QJHB 3ULUH 8FABB 1J0KA 1DQJB 1U58A 4FZEL 4JM2D 3QJHA 5A3IC 4NKOB 8FABA 3AS3A 1VESA 1DQJA 3SO3C 5T1LB 5HHMB 4NKOA 4HDIB 3ARGB 5T1LA 2QSCL 3HI5L 3CDGA 3HMWH 3RDTC 3GHEL 4HDIA 1MAKA 3ARGA 1BP3B 5D1QD 1QPXA 4POUB 5TFSH 2WUCL 1JBJA 4LDLB 4OGXL 1F3RB 4NNYB 5EFIB 2E7LA 4OIIH 1IKFH 4NNYA 5EFIA 1V8HA 1CE1H 4HGWA 5JQ6H 4O5LH 1NEZG 1NLDL 3T04D 5ADOL 2PR4L 4MAUH 5MI0C 4KDWA 4F3FB 1YEEL 2ZUWA 1EHLL 1BM3H 2XG4A 4ZTPL 1F6LL 3I6LD 3PGFH 4UQ3B 3EHBC 4F3FA 5KSVB 3OAUL 3AS2A 5E2VH 5I1CL 4DKAA 4UQ3A 5KSVA 3NCMA 4I18B 5SX5K 3RVVD 4BQ8A 3QQNA 4EOWL 1EXUB 5FUOL 4I18A 3PP4H 1EXUA 3CMOH 4Z7OE 4DK3A 3PWLB 5BRZB 1VKXB 4XWOC 3IXTA 1U8NB 3PWLA 5BRZA 1VKXA 5DXWA 1JGDA 1U8NA 5HD8D 3IKCA 3K2MC 1E4JA 3SDCB 3OKKB 4AY0A 1QO3B 1HQRB 1DUZB 2BRRH 3MJ7B 3OKKA 3K8MA 1QO3A 4XGZB 1HQRA 1DUZA 3VGDA 3MJ7A 3ESUF 3N1GC 1ZMYA 1DBBH 4H1LA 1SEQL 2IPKB 4XAKD 3SDAC 4XGZA 4OF7A 2LU7A 4MA7L 4RWYH 2X4SB 2IPKA 4ZNEA 2VDQH 4R2GB 1KJ2H 4MJIA 2X4SA 1U0QA 2OQJB 4XZUB 3K3QA 3HMXA 4D3CL 1RK1B 2OQJA 4XZUA 2XTJB 1RK1A 5IBLC 5ILTL 4JREC 3U4BL 1CBVL 5HHNB 3L5XL 3EYFB 3O2WL 1NDMB 4X6DA 5HHNA 4WI7A 1WLHA 2BVUA 3EYFA 4OSUL 3VFGL 1NDMA 2I5YL 3KR3L 4UZGA 2VDPH 1F11B 3SO3B 2X1OA 3L3HB 1F11A 2WANA 2ZUUA 3VI4F 1I9RH 3BN3B 4HJ0D 2AJYH 3L3HA 3F58L 4CU8A 3MLSL 5LQBL 1DP0A 2YZ8A 1T7ZA 3GJFB 1GIGL 2Y25A 3EYSL 3GJFA 3L7FB 2EIZB 5C70A 2X4UB 3L1OH 4XX1E 4YE4L 3BDBA 4PJ9C 2XT1B 1VA9A 3SDYL 3L7FA 3OTTA 3S96B 5EZLB 2X4UA 3IT8D 1VFBB 4LGPB 5MI0B 3S96A 1MCCA 5EZLA 3ZT5A 5DMKB 1EAJA 1VFBA 2G60H 4QRTA 4JPVH 5C09E 5HJ3B 5DMKA 2R0KL 1LO4H 3CMGA 3IU4H 1JHKL 1TCMA 3HNTL 5EORL 5HJ3A 3TBYB 1LDPH 1J05A 5ALBL 1P84K 2O5XL 4NBZB 1MCIA 4X7DC 1CLYH 1YZZA 4XVSH 3GMOB 4BQ9A 3GMOA 2CKBB 2B0SL 1VACA 1WTLA 1G1CA 1I7RB 2CKBA 4M02A 4QRPB 1YPZB 4LSPH 1QBMH 2ESVD 1I7RA 1U8JB 5I6XC 1YPZA 1LO5B 2J5LB 2JLLA 3KG5A 3VGHA 4CW1B 1U8JA 4F7TA 3S3JA 4JR9H 3TJEL 4Q58C 4CW1A 4GSDL 2FX8H 2P43B 4CU7A 3KDMB 5D8JH 5GS1C 3DV4B 4JY5H 4JGUA 4NKQB 1IAIH 3B5GA 3KDMA 1WFOA 3DV4A 1UZ8A 5JDSB 3VXSD 2AEQH 4EUPB 2WUBL 3MRBB 5JDSA 4PJXE 4EUPA 5EA0L 2JCCE 4KDTC 3T0EC 3MRBA 4HBQA 4IOFC 5L8LB 4JREB 1CN4A 2FEDC 2MFNA 5I1AB 3GSXB 5T1LD 4OCRH 4KK9C 5I1AA 3GSXA 2APXA 4J4PC 4QY8B 3VXTB 2QJDA 5DVKA 5BVJB 5D96C 2X9XA 4QY8A 2F19H 5FYKH 3VXTA 3IYLW 5BVJA 4M1CC 3ETBF 5ACZB 2Z8VC 1D6VL 2Q8AH 5ACZA 4XWGL 2BSSB 1GSMA 1KSRA 3GMQB 1FL5B 5DC0A 1MNUH 1UEMA 2BSSA 3LDBB 1MEXL 3GMQA 1FL5A 4XP6H 1R5VB 4X8JB 4U1MB 4E9LA 3OR6B 4J6RL 1U3HB 2ARWA 1IZKA 3IDMB 1FLTX 4PJ9B 4X8JA 2JE8A 2OR9L 4U1MA 3OR6A 1U3HA 1MJJB 1AGBB 3IDMA 5KVMC 3AY4A 4PJ9A 5C0ND 1KULA 1MJJA 1AGBA 1PW3A 2SEBB 1HXMB 2Q76B 4RRPG 5EUKB 2SEBA 1C12B 1HXMA 2Q76A 4XCYA 5FA4B 5EUKA 3AU1B 1A2YB 2J3SA 5D7LE 4N1EA 2M2DA 1C12A 1JRHI 2I27N 3QNYB 5FA4A 5FHAH 5BRZD 4D0CA 3AU1A 1A2YA 4BH8B 1FZJB 3QNYA 1VGEL 3G6DL 3LVEA 1EHXA 1OAQH 4FQIL 4Q6IC 4BH8A 1FZJA 3DUUB 1FLRH 3SDCD 4O02H 2EH8H 3DUUA 4ZD3H 4GRWE 1UEYA 1A6VH 1MLCB 2RCSL 1WWWX 5IFHL 4MA3B 4IDJL 4AQ1B 1MLCA 2VABA 4KKBD 5I6XB 3E6HB 2JK5A 2RB8A 4YXHL 3STZB 3D3VB 3E6HA 3BDYL 4FQQB 4JRXD 5GJTH 5DDHA 1RZ8B 4QTHB 4PJDB 3STZA 1MCQA 3D3VA 5GS1B 1KCRH 4FQQA 3EOTH 1FPTL 4QTHA 4PJDA 1NCAL 4PGDB 2XTJD 5GS1A 2A1WL 1AD9B 2OR7A 4PGDA 2YUZA 3CSYA 3UJIL 2IALB 4JN1H 2WQRA 2NQCA 3T0EB 1AD9A 2XA3A 4IMKC 5D2NE 2IALA 3CCHB 4RA3A 4KDTA 2EKJA 4HKXB 2GY7B 5A3ID 1RZ7H 3CCHA 1MHPH 4HCRH 1F2QA 4HKXA 4F8TA 4YX2H 4PJBB 3RDTD 1D5XB 3WHE0 1IGJB 2YMXL 5FOBB 1X5YA 5EB9A 4DGVL 4OZIB 5D96B 1CLZL 4L3EB 4PJBA 4J4PA 1D5XA 1IGJA 5FOBA 5C0AB 1Z9MA 2AQ1A 2YK1H 4L3EA 5C0AA 4HWBH 1U6AH 3HR6A 3TYGL 4PJGE 5C0GB 2OR8A 1QHPA 1MCEA 2V5RA 4PYGA 1YY8B 4YGVB 3SQOL 5FIEA 1VHPA 4CN4A 2W0PA 1YY8A 3GHBH 3JWNC 2FATL 5DD5H 4YGVA 4J23A 4LCWA 1EEYB 1K4DB 3EHBD 4UBDC 5F1NB 3I85A 4XBEL 4PJFF 1EEYA 1K4DA 1N6VA 3LH2H 4QOKE 5F1NA 3UYRL 2XA8L 3LKQB 3OV6A 5ADPL 1C1EH 4QGTA 4OUUB 5CWSB 1HOCB 3LKQA 4XPAL 5IVZB 3EJZC 4OUUA 5CWSA 1HOCA 3MBEB 1MIEL 4XNXH 1HXYB 5IVZA 3IDXL 3VD7A 4XWOD 1EMTL 3MBEA 3HI6H 3O2VH 4K94L 5AG8A 5IB2B 1RZFL 1HXYA 4QRPD 4RGNE 4Q6IB 3MV7E 4PJIB 1H3TA 2AEPH 3G6JE 4OV5B 4Q6IA 4HIHB 1OT1A 4PJIA 2R0LL 4OV5A 4HIHA 2WV3A 5C07E 3TP4A 2R8SL 4ZDHB 3CXHK 3MR9B 1T03L 5A2IH 3SDAD 4WW2F 1C08B 4PRHE 4ZDHA 3MR9A 4KJQC 4EIGB 1C08A 1AY1L 2P7TB 5FUCC 2B2XL 3SJVB 1BJMA 2NY1C 4LVNC 3OGOE 2P7TA 2OMBA 3SJVA 4Q9CA 5IBLD 2J2ZA 1DSFH 2W9EH 1P7QD 5DFVC 1X3DA 3UPRB 2D4DA 3RKDC 2F5AH 1EGJA 3IS1X 3UPRA 4Q0XL 1A9BB 4M8QB 4J8RB 4IMKA 1OAKL 1A9BA 4M8QA 1DBJH 4J8RA 4I8DA 1RURL 3BPNC 3NCJH 1BAFL 4M7LT 4OZFG 5KSAB 1ZK9A 4YDIL 4CU6A 5KSAA 1YECH 2AABL 3TT1H 4MA8L 1PVHA 4J3UA 1IE5A 3BZ4B 3VFOB 3WLBB 4AH2B 5J4MA 1UGNA 3BZ4A 3VFOA 3WLBA 3VI3E 4AH2A 1U3HD 1EX0A 3FHAA 2V7NB 4PJ9D 3TO4C 2VC2H 2V7NA 4NWTL 3P0VH 3W0WE 2GK0B 4DUVA 2XV6B 1MJ7H 2ICWI 1TCRB 1W72H 5EIVA 2GK0A 3B2VH 4GLRI 5DJCB 5TDNB 3WUZA 1TCRA 3TBVB 5DJCA 5TDNA 3FQXA 2BSRB 4WUKH 3WS6C 3HNVH 3GFUA 4WDIB 1EFXD 2ADGB 2BSRA 5HGDB 5GGVH 4WDIA 1F97A 1IARB 2ADGA 2XQBH 5HGDA 3STLB 4PJAE 1JGEA 1FVCB 5DR5L 3QRGL 1VGKB 2XN9B 3UTPD 2VXSH 4PGBB 3STLA 1FVCA 2HG5B 1VGKA 2XN9A 4PGBA 4LLWB 2E6QA 3CVIH 2HG5A 1TVBB 4X4YB 2AV7A 4NKMB 1IC7L 3O2DA 4LLWA 1GGIL 1F3DH 5FKAB 4OQTA 3CVHB 1TVBA 5DWUL 4X4YA 4NKMA 1EO7A 5FKAA 1JF5A 3UBXI 3CVHA 4FMFA 2R9HC 4FS0A 5GISL 5FM4A 4CBPA 5JHLH 3B6SB 2VLRE 2E8ZA 4LCIL 3B6SA 5CINL 1QFHA 1MHCB 1NCTA 4KVCH 4WY7H 5T3ZL 2NY1B 3T0ED 4LVNB 1YEJL 2ZCKL 1MHCA 4KJYB 4PBWD 3GSNL 2FEDD 1MI5E 4HMEA 4MCZB 1IL1B 1T20B 4ONFH 1A6WH 3KYMB 3C8DA 4KK9D 1DQLH 1IL1A 4MCZA 4S1RH 1T20A 4LPYA 3OKDB 4J4PD 1I9IH 5I71B 4TNVK 2P44B 4L3ED 5BS0B 1RIUH 3BEVB 1A6PA 5C0AD 1XAUA 4M1CD 4G3YL 1ITBB 5BS0A 3BEVA 2D7TH 3VDAA 3S3SA 5CS7A 2JJTC 2MKLC 3RVUC 5GRVK 4M03A 4F37F 3V5HB 1LK3H 1QTYT 3DGCR 2JIXD 3PNWB 4U2ZA 3V5HA 2J8UB 3I9GH 5HDBE 3PNWA 5IQ7L 2J8UA 3MQIA 1P4BH 1D6EA 3TO4B 3IDIB 2PTTB 1G9MC 2IGFL 2D7MA 2F54B 3TO4A 3IDIA 1TQCC 2PTTA 1RIHL 1JRHH 4NC0B 3FHQA 1UWXH 2F54A 1KIUA 3WFEH 4QO1A 4LMQE 5DK3A 4XNZC 2R0ZH 3KLSA 4P9HC 3P4NB 3TLRA 3ZKNC 2JJUA 1G9NC 1JYVA 2Q7YB 4TNWF 4CDHA 1XZ0B 5D6DC 3P4NA 2DKUA 4KGLA 1PEZA 4ZFOB 3FKUS 2Q7YA 4R96B 4PJCE 1A7PH 4XBGB 4E41E 4Y0GA 4R96A 2KKQA 1NGPH 4XBGA 2Q87A 4JFOB 5I16B 1CL7L 4NZTH 4WFED 5I16A 3WSQH 4U6VL 3LD8C 1X44A 3Q6FB 4X98B 2AJXL 1INDH 5J6HB 3Q6FA 4X98A 5EOQL 5T3XD 5J6HA 1CWVA 3SJVD 2FX7L 4WI6A 1NFDF 4WUUB 4HGKC 4LHQB 3QPXH 5B38B 2ZJSL 1NCDH 3MODL 4KQ4L 4WUUA 1QLEL 3BMWA 5B38A 4U7MA 1ES0B 1IILE 1EHAA 4PV8B 3HR5B 4R3SB 5A2KH 1ES0A 2CPCA 4U1IB 5MEPB 4PV8A 4R3SA 3HR5A 1QSEB 4Y16B 4EXKA 1LO2L 4U1IA 5MEPA 1QSEA 3IJHB 4Y16A 1VADB 2FGWH 4RFNC 3TVMC 1ZA6B 4DQOL 1FO0H 1VADA 2CO6B 4JE4B 1ZA6A 5IHUH 5F44A 2B7DT 3LEXB 1FAKT 5F88B 3UJTH 2CRMA 3MOBL 3QRFM 4HLJA 4WEBL 3BKYL 5FV1L 3F6IA 32C2B 3LEXA 2B4CH 3HZMA 2PYEB 5F88A 1FYTB 2H3NB 3MREB 3MRRA 4MNGB 4PR5B 3HA0A 4FFWC 32C2A 5HYEA 1OPGL 2PYEA 3BSZH 2H3NA 3MREA 4MNGA 4PR5A 4U7KA 2IG2L 5J56B 4KK8C 4WFGD 3QEGH 3D18B 3UP1A 3AMKA 1SVZA 3QUMB 4WWID 3D18A 2IBBA 4UBDD 4YBHA 2YR3A 3QUMA 2R4SH 3WNMA 3MRPB 1TQCB 4Z78B 2V17L 1U36A 2YBRB 2IF7A 2AK1H 3MRPA 4Z78A 3RA7H 4NFCA 5E6IC 4XNZB 3EJZD 3ULVE 3UO1H 4L8BB 3AUVA 1CZ8H 5F3BB 5GS2H 1QD0A 3RZCC 5IBUG 4L8BA 5IHLB 2XN9D 4AK1A 5F3BA 2MQCA 1FAIH 5D6DA 2GYSA 1EBAA 5EWIL 2WBKA 1FNSH 4MJ2A 4HK0B 3GSOB 1XR8B 4H20H 5CSBA 4HK0A 3LD8B 3WLWC 3H3KA 4GG6E 3GSOA 4O51B 1XR8A 3TGXA 3N0PB 4KJQD 4UTBH 3MUHL 2C3GA 4G9DB 4KZEH 1MVFA 4O51A 2HRPL 3UYOD 3W9EB 4G9DA 3RQ3A 2NY1D 3W9EA 5E9DB 5DD1H 5FYJU 4GO6B 3RWGB 1KPUB 3MRCB 4XHQA 5DFVD 5E9DA 5JOPE 2A6IB 3OF6A 1JMXA 3RWGA 1KPUA 3RKDD 3MRCA 2A6IA 1JHLH 1X5GA 5I8EB 2YD9A 1YEIH 5I8EA 1UM5L 5BO1H 5BS0D 5EUOE 5K9QI 1SBSL 1VSCA 4NJAH 4RFNB 3TVMB 5JORB 4OZHB 4IMLB 5JORA 4OZHA 3GSWB 4LHUB 4TUOB 3S37H 4IMLA 1G6RL 2X70B 4ZFGH 3GSWA 3DO3A 4LHUA 4TUOA 4XNQB 5C6TH 4OCXH 4XCCL 2X70A 3S88L 2KDGA 4XNQA 2W1NA 5F7NC 3WN5C 1UXWB 2IFGA 3TO4D 2XPGB 1NBZB 4GLRH 4AZ8A 1UXWA 3B3IB 2F54D 4Q9QL 4LEXH 3B3IA 2ICEA 4EZMA 2VB5A 3D85A 2AGJL 5L9DL 3L5JA 3F7VB 1IGTB 1FGNL 1UC6A 1L7IH 2V9TA 3F7VA 2CDGB 1IGTA 2AERT 3B9KC 3WDJA 4X9BA 4R4BB 4RBPH 4TVPL 5E6IB 4QRUB 2XZCH 4CN1A 4R4BA 3JV0A 1RJCA 5E6IA 4QRUA 4HIXL 3MACL 1KJ2B 3UXFA 4B53A 4UI2A 2XZAL 2EDQA 1KJ2A 2DQTL 3V4UH 4YNYB 1A02N 4PB0H 2P4AB 2NY6C 4YNYA 3BAEH 5KSBB 1CFSA 3A67L 2R9HD 5KSBA 2R0WH 5E2JA 1IC5H 4DOHE 3ALWA 4XP4H 2Z31B 3HG1E 1JNNL 4S1DC 2Z31A 3PJSB 3B8YA 5DLMH 4DUWA 5FYLD 4ODSH 1XIWC 2P24B 1Q0YH 3PJSA 3T2NH 4M8VA 3UBXG 4LSQL 3RY4A 2P24A 1ZGLB 1CXFA 3RP1A 3AVEA 4PRPE 5IFAH 5E08H 1ZGLA 4M7KL 4ELME 4NOFA 1CDHA 3DWTA 3WBDA 3INUL 5ETUB 2IAMC 1L4IA 2PYED 3RVUD 1FYTD 4J3TA 1MCNA 4K55A 1KEML 2EDWA 5C0CE 4P2QE 2ZCHL 3BMVA 1IGMH 3MV9E 3MXVH 2YRPA 4JFPB 1W8OA 1WBXB 4X0KB 4BFBD 4MXQC 1XF5B 2A6DB 4JFPA 1WBXA 4X0KA 5DC4B 5FKPB 3WFCH 1XF5A 2A6DA 5ISZB 1CD9B 3QHFL 5CP3H 5H37H 5EOCH 4N0CC 4TUKL 5FKPA 5LGKA 5ISZA 4LQ1A 4K7PY 3IAPA 1A6UH 2X4QA 4R7DB 5I1DA 5MEQB 3NMEA 3MA9H 1U42A 3B9KB 1EPFA 4R7DA 5MEQA 3DRQB 3ZKND 1E6JH 1YYLH 5DYOB 4JPWH 3B9KA 4XP9L 5F7LB 3DRQA 2ZNXA 1RUAH 1NCUA 1P6AB 1JWUB 5BXFB 2RGSA 3BPLC 1SJEB 5JXAH 5BXFA 1SJEA 3FCTB 4Z7WB 1V7ML 4L4VE 3O6LL 4X80L 1NJ9B 3FCTA 5CIPH 4Z7WA 4UV7L 1MAJA 4Y5VC 3LRSB 3E0GA 2BNQA 5IFJB 1NJ9A 1MAML 4JANB 2P1YA 2R15A 5IFJA 4M93C 4JANA 3TA3C 3NZHL 2NZ9C 3QQ9C 4EDXB 2V2XB 1NAML 1CR9L 4G6KH 4EDXA 2R2BB 2V2XA 4YDKH 4UNUA 3TWCH 4D8PB 1AQKL 1RMFL 2GJ6E 2R2BA 3MLWL 3NCBB 3RPKA 1BBDH 3NCYS 4D8PA 4JFZL 2ATPB 1S9XB 1FYHB 4RCAA 4RRPA 4P49A 4BSVB 4U1KB 4OF6A 2ATPA 1S9XA 3C6SB 4BSVA 1T04A 4U1KA 3SE9L 3C6SA 1FQ9C 3TVMD 4C58B 2CGRH 1S7UB 2YZ1A 4G42B 2EH7H 4LARH 4LHUD 4M5ZH 1OCWL 3RU8H 2E7HA 1DJSA 2IAMB 3GKZA 3UTOA 1S7UA 4M62H 4G42A 3RNKB 3G5YB 2IAMA 4Q9RH 4FFWD 3RNKA 3G5YA 5LWYL 1MELA 1VB9A 2BVEA 4KK8D 4OLEA 1D5IL 5ERWB 5B4MC 5JHDD 1NMAH 5ERWA 1HNFA 1KB5H 5KS9F 4GG8A 4GAGL 3VCLB 5LKNA 2EE3A 2R2CA 3VCLA 3WIIH 4Z6AT 1RJLB 1UM4H 1NLBL 4G5ZH 5E6ID 1NBYA 3UTSE 1RV6X 1FFRA 4L4TB 4NRYB 25C8L 2BCKB 1WAAA 2YOCA 3RZCD 4L4TA 4NRYA 5ENWB 2BCKA 4RMRA 3E3QE 2MNUA 1QRNB 5ENWA 5KTEL 1VENA 5E2UH 3EDFA 3BPLB 2BERA 5ANME 1QRNA 3BJLA 4K07A 5FECB 4OM0H 5FECA 3EDDA 3WLWD 3S34L 1ZHKA 4Y5VB 3JWDC 1N64H 1N7ML 3TCXA 3W9DB 3VXQB 4WENB 4Y5VA 2JELH 4M48L 3W9DA 1BVZA 4XVTL 4M93B 1PKQB 2X1QA 5DJZA 3TA3B 3U1SL 3VFRB 4D94A 1PKQA 3S8WA 1VFAB 1MF2L 4MCYB 3P9MB 3TA3A 4HCRA 3VW3H 4WI5A 4JDVB 1IZJA 2VXTL 4MD0B 1KIRB 3VFRA 3LIZL 4MCYA 3P9MA 1KEGL 1WZMA 1C5BH 1KIRA 2DD8L 3VXRE 3FO9B 1KENL 4GW1B 4HXBH 5BCAA 1YEGL 3U0WH 3QNXB 4OFYA 1BD2B 3FO9A 4GW1A 1F6FB 3CFKB 3QNXA 1BD2A 3MV8E 3NIGF 1KBGH 1Y18B 4QNPF 3O4LE 2VYRE 3TV3L 1UM6H 2X9WA 2UZIL 1U91B 4WW1B 4Y4HC 4LHJB 5IMOB 2Y5TB 1U91A 5DSCB 1OT2A 4WW1A 4Q6YA 5CJ8A 3QEQE 4L8SC 1CS6A 3W2DH 3CH8A 5IMOA 2Y5TA 5DSCA 3ZHDA 3MA7B 5K9QG 5L88H 1K5NB 3CPLB 3EIFA 5GXBB 1A0QL 3MA7A 3QXDB 2BFVL 5CEZE 1K5NA 3CPLA 1AC0A 2VIRB 3QXDA 5ISZD 5KAQF 3ZYIA 2XKNB 2VIRA 1U2HA 5C08E 1WITA 3JWOL 5GSRB 5ACLA 3ZL4L 2XKNA 3B9KD 1HH6B 2FNBA 4LU5H 1ADQL 1HH6A 4TQEL 1OB1B 4NQEB 2OZ4L 3PXHA 1NAKH 1MPAL 1OB1A 4NQEA 2GJZA 1JMZA 3DGGB 5INDB 5A2FA 4HSQA 5FV2A 4J12A 3V6FB 5FOJA 2G9HB 2C3VB 1L0QA 1SM3L 3DGGA 4MNQB 1AFVH 5INDA 5KN5B 3V6FA 1GC1H 1FE8L 2C3VA 5IJVB 4MNQA 1FL6B 3MRLB 1TJIH 5IJVA 1TTGA 2P5EE 4UUJB 2Q20A 1FL6A 2AEIT 3MRLA 3T77B 3NCFB 4UUJA 4G9FE 1J8HB 4K94C 3LRHA 3T77A 5KVEL 2E9JA 4Z7UF 5HYJB 1GJIA 2ORBH 1J8HA 4GXVH 2HJLB 5GS0C 2X89D 3T3PE 5HYJA 3CX2A 4K71C 3BDXA 1WVZA 5FYKD 3MLRL 2HJLA 1FP5A 3HFMH 5T5FL 3L7EB 4S1DD 5A40E 4LMQI 5AZEL 1C16B 3L7EA 5KBNC 1XIWD 3H3PH 4HD9A 4MJIE 4HIEB 1WSST 3ESVF 3MRMB 3O8XC 4U1HB 1JYXA 4HIEA 3MRMA 7CGTA 4U1HA 1AQDB 4NP4L 3AS1A 4Y2OA 5DT1H 1CGUA 3P11L 1NCWH 1AQDA 1OQXA 2IAMD 4KTDH 4X6DE 4IHOB 1UWGH 3SKUD 1HI6B 4MYWB 2FJHB 1J7VR 1LP9F 1MWAH 1REIA 4IHOA 1W72B 1HI6A 2HH0H 4Y4HB 2FJHA 4IRSA 3HNSL 5BVPH 5E2WL 1W72A 4Y4HA 4ZPVB 4L8SB 3R8QA 1HILB 4ZPVA 3N85L 4L8SA 1NGQH 1S5HB 5CGYC 1HILA 4MXQD 1A3LL 4GKSB 4ZTOH 1E4WH 1EO5A 1S5HA 1UB5B 1FG2A 1FGVL 3EOBB 4GKSA 1MJUH 4N0CD 2EXWC 1UB5A 3MLUL 1SQ2N 4EI5C 3MYZA 5FK9B 3UEZA 3MLXL 4FP8L 5HDQL 5FK9A 3BH9B 1J1XL 5IB1B 3DROB 3VA2C 4XMLL 5DURB 4UDUB 5J7CC 4L4TD 3EYOA 2MQ3A 3BH9A 5IB1A 1CDBA 3HI5H 3DROA 2EECA 4UDUA 1QP1A 3ZKXC 3PQYE 4I77L 1QRND 2WLZA 1IJ9A 4JZNB 1K8DB 3JV5A 5CMAB 2NR6C 2DTSA 2H2SC 3ZT6A 5DMJB 4JZNA 1K8DA 2X44D 3NA4A 2AEWA 4J3VA 5CMAA 1UFUA 3A6OA 5J11C 1J10A 1YNKL 1UJTA 1EDQA 3VFSB 1A21A 3V7AG 2APTA 3KPRE 5FGCB 2PR4H 1H3VA 3VFSA 5KJRH 4POYA 2WMPA 4JVWA 1I8IB 3MOAL 3ZDXE 3TA3D 1NANI 1EVUA 2NZ9D 3QQ9D 1I8IA 2VDLL 3L6FB 2Y1VA 3OAZK 5E6YA 3SKMB 3HRZB 3L6FA 4K71B 2Q8BL 3DSFL 5FUOH 2O5YH 5HVFB 3SKMA 4MSWB 3HRZA 4OFYD 4RQQB 4KI1A 4MSWA 4OLWH 4ZG1A 3QDHA 4RQQA 4TPRL 1MIMH 4JKPL 4KHTL 1FORL 4MDIB 3O8XB 3WYRA 1LE9B 3NACH 4MDIA 5I15H 1LE9A 4S10A 1X6NA 4XXDB 1MCPH 3U46B 4G7VH 1ZLVK 3PL6C 1HHKA 2DRUA 4XXDA 1V5JA 4KPHL 3U46A 3FFCD 3KPQB 1UH3A 2J6EL 3RWFB 4KKCC 1SEQH 4UIKH 1FIGL 3NGBB 3N1PC 3KPQA 4GW5B 3RWFA 4BA8A 4MMZC 4OD3L 1HSBB 4GW5A 3ALPA 2EC8A 5CJQH 1HSBA 5B4MD 4D3CH 2VDML 3FO0L 1KJ3L 3U6RB 1F8TL 2FRGP 2IBGA 4YUEL 3QIWC 5EBMB 3K46A 3KYOB 4L3AA 3U6RA 2NY5L 4L9DA 2DYPB 4JFFE 4O4YL 5EBMA 4E0RB 3GRWL 3KYOA 4K7FB 4XPBH 4EI5B 2DYPA 5C0BB 3U0TB 4E0RA 2I5YH 3KR3H 2EDFA 4K7FA 2DL9A 4EI5A 5C0BA 2YPLE 4NQED 1CXIA 3C5JB 5DFTA 4LVOB 2D31B 2J88H 1IQWH 4QHUB 3WFHB 3C5JA 3S3PA 3ZKXB 4MX7B 4MNQD 2VZ1A 2D31A 3WFHA 5DD6B 1KELH 4QHUA 3QCVH 1NGWA 4MX7A 1CXKA 5DD6A 4KY1H 1T1WB 4HBCH 4NQCA 5JA8B 2Y07H 5D5ME 1V05A 1T1WA 5J11B 2VRAA 2L4OA 1J8HD 4UOW0 3T3MF 5LG1A 3BI9X 4D9QD 2IBZY 5HYJD 2PW2B 1A1MB 2RAMA 2GKIA 4X8XA 2RIKA 3HE6C 2PW2A 1A1MA 5EO0B 2R0KH 3S36X 4JDTL 5EO0A 5E70A 3CJJA 1CU4L 1FO0B 2O5XH 1J88A 1Q0XL 2F9BT 1EA9C 1FO0A 1WK0A 4LIQL 4Y88A 4JVPA 4F58L 3BWAB 3BHBB 2EXYC 2VLMD 4NDMA 3ARBC 5CJBA 1JGUL 3BWAA 3BHBA 3QCTL 3M8OL 1P7KB 4Y19D 1NFIB 2MQ0A 5IBUB 1P7KA 1BHGA 2DQHH 2X5PA 4P48A 1NFIA 4WU5B 2ZPKL 4Y4KC 1P84J 1EEUA 3PL6B 4WU5A 2C3XA 4Y4HD 2HMIC 1NKOA 3VH8G 3PL6A 3WCYA 4GSDH 4RISH 4LLDA 5DQ9B 4WJ5B 1J1PH 4EN3C 5JTWA 4ZS7H 2BMKB 2A9NH 3DJ9A 3FQTB 5DQ9A 4WJ5A 2FHCA 2BMKA 2IC2A 4OLYL 9CGTA 3FQTA 4CJ0A 5E8EB 4G7YH 3ARFC 1P2CB 4NGHH 4Z7VF 4MB4A 2OL3L 5EA0H 3O3DB 1MCKA 4RIRB 4S0TD 3GSVB 3PHSA 1QA9A 1P2CA 1FZMB 4I3RL 3U4AA 3O3DA 1Z9OA 4RIRA 2BSTB 3E8UL 3GSVA 3OJDB 1FZMA 2EIEA 5GGVY 5LAXB 3H6JA 1G0YR 3OJDA 4XP5H 5DURD 3U9PL 5LAXA 3U7WH 3H7LA 1MQ8A 4XPGH 3MRKB 4JRYB 2WWMC 3NIDE 4LCWE 4WI8A 4YBLC 5HYQA 3MRKA 4JRYA 1R0AL 1JV5B 3C8HA 1LO3L 3NABL 1FCCA 5FO9B 5FGBC 2Q3AA 4DW2H 1JV5A 4AL8L 3IXAB 5FO9A 3Q0HA 5GRWA 5C2BL 4XWGH 2H9GB 2C7UA 3IXAA 2GT9B 2H9GA 2X4TB 2DI9A 1MEXH 2GT9A 3U7YL 2VSDA 4JM4L 3NFSH 4XVUC 1T1ZB 2BXZA 3BE1L 4DTGL 2X4TA 3QCUH 4GRLB 1T1ZA 1N4XL 1B2WL 2F58L 4GRLA 4YHZH 3Q5OA 2BX5A 2P5WB 5GS0D 2FBJL 4M6NH 1KT2B 1QPPA 3MRFB 4FQ1L 3VXOB 3CDFA 3SE4A 2P5WA 1KT2A 3MRFA 2VWEE 3VXOA 2PUQT 1GGTA 4HWEH 2DQFB 1N26A 5DEFB 4FXGB 4YLQT 3C2AL 2DQFA 5DEFA 5L6YH 1VGEH 3G6DH 1KG0B 3O8XD 4FXGA 3HC4H 4FQIH 2AK4B 4JO1L 1KG0A 1MRDH 2UWEB 1BVLB 3ARBB 4C59B 3L9RB 2AK4A 1K9TA 4XPFL 2UWEA 3ARBA 1BVLA 1DEEB 4YHPB 3L9RA 3RIAK 2ICWB 5IFHH 1F58H 4IDJH 4YHPA 2ICWA 3W39B 1KYOJ 1B88A 3UC0L 4XNMB 4GW4B 5C3TA 3W39A 4Z7NF 3BDYH 4XNMA 3SDXB 3BEWB 4LASL 2VDRH 1K6QL 1KCVL 4WI2A 3SDXA 4DEPC 2YD8A 1NCAH 3QWRD 3ALXA 5CGYD 2GIYA 2NX5E 1UZ6F 4GMTH 4PJHB 3ARFB 4OLUL 4XT1C 4DGYL 4LCYB 2DYPD 2I60H 2QKIB 4PJHA 4F9PC 3ARFA 3BISA 4LCYA 2EXWD 4EI5D 1Z3GL 5C0BD 3WV0A 2QKIA 4ODHH 1V7NH 4MDJB 5MEND 3VFVB 3UBXB 1HZHL 3CXDL 5IVOA 4PJ7F 5M7QA 1NBVH 3UBXA 5E5UB 3KPSE 1LNUB 2YS4A 3ARYA 4G43B 3ABZA 4UT7H 4YBLB 3T4YA 6CGTA 2CUIA 1Z2KA 4N0UB 1LNUA 5GHWL 1F90L 3PABA 4G43A 1H0DB 2NR6D 2YPKB 4N0UA 1MJ8L 5FGBA 4O58L 4N90E 3L5WB 4X83A 1H0DA 2YPKA 4R26H 2HKFH 1CD0A 3L5WA 3GNML 4EDWH 3SEPA 1P69B 1GHFH 2EYRB 5HHVL 4FQ2H 2FATH 2L0DA 5T1KB 2EYRA 2MPAH 3Q3GB 4TTGA 3EUUA 5T1KA 1YEFH 3X11B 4N8CH 4ZSOB 2FR4B 3ULVH 3X11A 4KGJA 2FR4A 1L7TL 5F7WC 2KZ1B 2X05A 4HXAL 3RIFK 4ERSL 4BH7B 1MREH 5C0JB 1QUNA 2ZCLL 1RFDH 2DDQH 4ZOBA 4BH7A 3IDXH 4XRCB 5C0JA 1MFEH 1CLCA 1RZFH 2ED7A 4XRCA 1KB9J 2RHEA 3KWWB 3ZSTA 3PP3H 5DUPL 3RTQC 3DUHA 1OD7A 4JG1L 5D2LB 1BJ8A 5E2TH 1A6TB 5B3NA 1U95B 2HTLC 3KWWA 3PL6D 5T3ZD 4WGVB 3OXSB 5GIRB 4ODUB 5D2LA 1WIOA 4JKMA 1U95A 2CO7B 3S97C 4KKCD 3OXSA 1JGLH 5GIRA 4ODUA 3NAAL 4PJEF 1L9MA 2IQ9L 1IC4L 4OGZA 1IAOA 5C7XL 5CP3A 1Q1JL 4DEPB 2HN7B 4YZFE 2VL4A 3HUJE 5GS2D 2HN7A 2IFFL 5EO9B 3QIWD 4HZLB 5TPWL 4X7SL 3QAZC 5HDOA 5EO9A 4HZLA 2GUOB 4Q0XH 5JMOC 2ZOKB 3D6GA 3U0PB 2GUOA 2FLRT 2CRYA 5C0IB 2ZOKA 5CSGA 3U0PA 1FNEB 1RURH 3NCCB 1IT9L 5C0IA 1BAFH 5AYQA 5CIPB 1FNEA 2F5BH 3MRJB 1XGRB 4QXUH 2DM4A 5CIPA 3I02B 4UV4L 5CCKL 1ZLSL 1XGRA 3QQ4B 3I02A 3L3IB 1H8OA 3BPCA 1CXEA 1FN4B 3V4VH 3L3IA 4KAQH 3EFDL 1FN4A 3DETC 4P2OC 3A6BL 3FRPA 4F57L 3IFNL 1CIDA 2W65B 3F7QA 2P5WD 3HE6D 2W65A 5C0DB 3EKCA 2EDLA 1NL0L 5C0DA 3NBNA 1Y6KR 4YXKL 2ZWLT 4JFYB 3TNNB 4WO4C 4JFYA 3TNNA 4F37K 5MHSD 2EXYD 3ARBD 1MFCH 1CGSH 3WFDL 3QRGH 3FQUA 3I2CL 2DQGH 5TE6H 1FH5H 3WDIA 3SDDC 4OBSA 4KTYA 3RTQB 3GO1H 5KANI 4Y4KD 4OI9A 2OCFD 2Y36H 3RTQA 3S5LG 1X5LA 2CRIA 3KJ4C 4YHKL 2HMID 5DWUH 1KB5B 4K23L 1C7SA 1BZ9B 2QADC 5CILL 3K8LA 1DBKL 1QSEE 5J12B 1KB5A 4EN3D 1BZ9A 4OT1H 2VZTA 3VG9C 3QUXC 4LCIH 3ZYOA 3ARQA 1X6LA 4ODXB 1ZLUK 3ARFD 4FHBD 3MNWB 1YEJH 4TNWK 4ODXA 3V5DB 2ZCKH 1KFAL 3MNWA 4PUBL 5HHQB 3V5DA 2VL5B 2RQ8A 2DM3A 3QUYC 4GAYB 4ZNCD 3X12B 5FYKU 1M7DB 3QAZB 4MXWH 3RX5A 5HHQA 1FSKB 1EJ6A 2VL5A 1AGDB 3DI3B 4OBRA 3X12A 4YFEA 1M7DA 5D7SL 1AGDA 5HDLA 1A4KA 2W60B 4LRNH 1OAXL 3JBG7 5FYJL 1K2DB 1LO0H 1R3HB 4RMUA 4N5UA 2W60A 3FAWA 3IVKB 1K2DA 3FMGL 1DANT 1R3HA 5C09B 3IVKA 5I18H 3SE8L 2QHRH 4RFOL 3SOBL 4FZ8L 1CK0L 5C09A 4PGZA 1J1OL 5I8OL 3RWHB 4HS3B 5EU6E 1KOAA 2EDBA 4UT6L 4D9RE 2VKXA 1T22B 4XVUD 3RWHA 1INEH 4HS3A 4WHDA 4JM2F 5EULV 1ZEAH 5T1KD 4NQXB 1F00I 3H8NA 4P2OB 2VLJE 4NO2B 1UWEL 2ATKB 4NQXA 1D7FA 3BRDA 2NXZB 4P2OA 4FMKA 1AP2B 2BHUA 5E03A 4NO2A 3R8BB 4PGCB 1QYGH 1AP2A 2LAAA 2DQEL 4KZDL 3RPIB 2YEZB 4PGCA 3WXVL 1M71A 5HHPB 3RPIA 5DC9B 2YEZA 3KPMB 3PIQB 4LCCB 3CLEL 3BH8B 4NBYB 3KPMA 4WO4B 3PIQA 4LCCA 2GQHA 3M07A 3U7AA 1BIHA 5LCVH 3ULUE 4JN2B 3BH8A 4WO4A 1IGFL 4HV8B 4JN2A 1BJ1H 3IDUA 3EDKA 4BZYA 5E9DE 4HV8A 4PJXB 1HNGA 2JCCB 2M26A 5AG9A 2VDNH 3SDDB 5CD5C 5IQ9B 3IJSB 4PJXA 5D2NC 2J8HA 4GQ9H 2JCCA 5MP6H 1A1OB 1OQOA 1ZT1A 3JTSB 3SDDA 1GZPB 3WJLC 3GMNA 5IQ9A 3IJSA 3QT2A 3KJ4B 1A1OA 2VDKH 3JTSA 1GZPA 1KCKA 4WRLA 1TJGL 2A73B 5EOQH 3DBXB 2C4FU 4APQC 4P3CL 2WBJC 2A73A 3DBXA 3KHOA 5TF1H 3DHJA 2O26U 1KPRB 1F3DJ 1YJDL 1KIPB 1TNMA 3QUXB 5LBSL 5A43C 5J8OA 4MNHB 2XY1A 5IMMB 4LQFH 1KPRA 1KIPA 3H9YA 3QUXA 3FZUC 3BKCH 4MNHA 3DNKA 4KROC 5IMMA 1XH3B 4FTVE 2G75B 6FABH 2AJUH 4BZ1L 3QUYB 4QCIB 5IVNA 5ID1B 1AO7E 3QUYA 3SGJC 4QCIA 1HHGB 1RUML 5ID1A 4FXKB 3UZVB 1OGAE 1YC8A 1QFUL 4NNPH 3VJ6B 5K9JL 4FXKA 2Q6WB 5IVXF 3IFLL 3F7PC 3GB7B 3VJ6A 4KH2A 4M5YL 4WEBH 4QF1B 3GB7A 3WIFB 1ZANL 1T7YA 3FT2B 1LHZA 4MMXC 3MRHB 5KOVC 1IAIM 1UKTA 4QF1A 3OZ9L 3WIFA 5D7LB 1R3LB 1SJHB 3FT2A 5AZ2H 3MRHA 4NO3B 1B4JL 1J0YA 5D7LA 1R3LA 3CFEB 1SJHA 4TVPD 4K7PX 2XWBA 2P8LB 4NO3A 2OLDA 5AYUH 4L29A 4RGNC 3CFEA 1QHOA 3V8OA 1YNTB 1JCKA 1QLFB 2LQRA 2P8LA 4JKWA 2QV2A 1YNTA 1QLFA 1MRFL 1IAMA 4GRWB 3QUZC 5GGQH 4NFBA 4OFDA 3HAEH 3P40A 1I85C 2DBLH 3HMXL 1I8LC 4IJ3B 1A5FL 2X7LB 1MWAB 5FUZH 2X7LA 1INQB 3REWB 1MWAA 2A9ML 3RTQD 2Z92B 3K4DA 3REWA 3BQUC 3G9VA 2HTLD 3VDBA 2Z92A 3BGFB 4YWGL 5D2NB 1SYVB 3HAEG 2QQLL 4LP5A 2EDKA 1WICA 5D2NA 1SYVA 1B6DA 3WJLA 3JXAA 1CLOL 1MFBL 4S0SD 1KJVA 4APQB 1HQ4B 3MXWH 2WBJB 4JPKL 3WKNA 3KPOB 3RFZC 2F15A 4APQA 1HQ4A 4HJJH 2WBJA 4W68A 2VSCA 3QIUC 4YEFA 1BGXH 5IROA 1EBPA 4Y4FC 2QQQA 2CR6A 4KROB 4M1DL 1NBQA 1QBAA 2KPNA 2AXFA 4UINH 4PJGB 1H3PL 4NQSB 4PFEA 1UM5H 4XPHL 4HZAA 3D0LB 2DTML 2EDJA 2Y23A 4NQSA 5DMGC 1SBSH 4F7PB 3D0LA 3ARWA 2QQNH 3MOQA 3SGJA 4O2FB 5ELIA 4AM0B 4F7PA 3HHRB 4Q2ZB 1UVQB 1KCUH 4K9EL 4O2FA 3OAYH 1HH9B 2MHAB 4QOKB 4AM0A 4Q2ZA 3CX5J 2I26N 2MHAA 4QOKA 4XCCH 3S36L 3ZO0A 3G5VB 2YKLL 5TGBB 2XWJB 2V9QA 4AMKL 4XVJL 3SKOB 5CEZH 4ZFFA 1IGIH 3G5VA 4LF3B 2XWJA 2CKBL 3DETD 2D0GA 4P2OD 4X7TB 3SKOA 4AG4H 3BIAX 4QEGA 4LF3A 1TENA 4X7TA 1IFHH 2YA2A 4RGNB 3EDJA 1DQDL 4PG2C 5B8CC 3MV7B 3FFDA 1XGTB 3G6JB 1UG9A 4LSVL 1FGNH 3F7YB 2ZUQC 3DXAE 3MV7A 2C9AA 1QNZL 1XGTA 3G6JA 1HSAB 2N4IA 3F7YA 4HWZB 5C07B 2BNUB 2BNQE 1DVFA 2IANE 1HSAA 3LS4H 4A2MA 4HWZA 4WO4D 5C07A 2BNUA 3KPPB 4PRHB 4FA8A 1IBGH 1QFOA 1OM3L 4XAKE 1DQML 3KPPA 4PLJC 1G7HB 3ZE0E 1EO8H 3MJ6A 4X6CE 1G7HA 1I8LA 2CUHA 3SDDD 3OHXB 5IIEB 5CEYB 2CRZA 4K3JL 3OHXA 5IIEA 3BQUB 2FWOB 5CEYA 1D5MB 1YEHL 1Q38A 2CMRL 4OD1L 3BQUA 3IFOB 2FWOA 1D5MA 3ILPA 4M6ML 2QADD 3A67H 4DVBB 3IFOA 4Z0BH 2BVPB 4JB9L 4D0DB 4DVBA 3QUXD 4JAMB 2VXQL 1W0YT 4NWUL 4D0DA 5J1AB 1RVFH 4JAMA 2BVYA 4J3OC 1WZKA 5KANG 5J1AA 1UCTA 3QIUB 4IRZH 2NW3B 3D0VB 3LEYL 4JDZB 3RHWF 1NC2D 4Y4FB 3QUYD 3QIUA 3D0VA 2NW3A 4JDZA 4Y4FA 3V52L 3O4OC 1OSZB 3GSUB 4OCWL 4ISVA 5K59E 1A7NL 1ACYH 5IBTL 4HFUH 1OSZA 3GSUA 2KUTA 2PF6A 5KOMC 1UH4A 1H8NA 4LOUC 2E9WA 4O9HL 4OM1L 4OCMC 4ETQB 4XCFH 3X3FH 3U82B 4JKLA 4ETQA 3T0VA 4MZ3A 5K9OB 1DANU 1DLFL 4NM8L 1A3RL 3KLHC 5K9OA 5D7LD 3CLFH 4Q7DA 1SY6H 1KEMH 2DF3A 4TNVF 1BEYL 2VJXA 3MJ9H 3SKNB 4UILH 5JUEL 2YHGA 3SN6N 4LSSH 1M6OB 3NIFF 3SKNA 4Q9BA 4PJAB 5F7DB 1VEPA 1M6OA 4I0CC 4PJAA 5B8CB 5F7DA 2ICWJ 5HI5C 3BP4A 5B8CA 2ZUQB 4G6FB 2ESVE 4LPUA 4G8IA 1TETH 4DZ8B 4FNLL 4RGOL 1DBAL 1ZAGA 1U3JA 3DUSB 4DZ8A 1EAPB 2QSQA 4OIAA 2VLRB 1JI1A 3LY6A 3SKJL 3DUSA 1ZTXL 2VLRA 3EZJB 4PYHA 1T6WA 5CD5D 5HYSG 1S3KH 2AJSL 3N1QC 3FT4B 1LVEA 1N5AB 3DO7B 1JGVL 1M7IB 3FT4A 4K3GA 4R90L 4TOYL 1N5AA 3DO7A 1A7QH 3EO9H 1BD2E 2EDRA 3O6KH 4APQD 5F9JA 2WBJD 1X7QB 3ME0A 1GOGA 4XMPL 1X7QA 3QIBC 2DAVA 1AH1A 5ALCH 4ZAKC 4KUZH 3FZUD 3RKPA 4J1UB 1YPZF 4KROD 1RMFH 3H42L 3ZLQC 4J1UA 3RY6A 1LGVA 5TQ0H 4YHLL 4FFYL 2Y7QA 1BZQK 3O4OB 4MJ6B 4DGIH 3ZT7A 2YRLA 4LKXB 4PRNB 4MJ6A 2AJVH 4MHHG 2P46B 1A1NB 1RSFA 5KAQG 4QTIL 4JFHE 4PRNA 2R29L 4P3DB 1A1NA 1JZ6A 4X4ZA 4P3DA 4R97C 3ULVC 5JW4Q 4UNVA 4R4FL 1QLRB 3ARDC 4MLSA 5K93A 4RGND 5EZOL 4HPYL 5B3JE 4TN9A 3MV7D 1QLRA 1R6VA 2DLIA 3HI1B 3FONB 4E41B 2Y06L 1J0HA 3N06B 3QUZD 3HI1A 3CFDB 3FONA 4XNUH 5F9WC 5I76B 5C07D 4YDJB 3ZTNH 1NLBH 3CFDA 5I76A 1U41A 2GAZB 3R1GH 4PRHD 1KUMA 4PGEB 2Y6SC 2ZUXA 4R8WH 4YDJA 5D70H 4EKXA 4HS6B 4WTXA 2B1AL 2GAZA 1A64A 4NHCL 2X2YA 3I6KB 4PGEA 5EOCJ 4DFHA 4HS6A 2OTWB 3C6LC 4MQTB 3I6KA 3V5KB 5I73B 4JRXE 5D7IE 2OTWA 3OPZL 1WZ1L 3V5KA 4FABH 1EGJL 5LXGH 4ZODA 1WZLA 2UUDH 3BQUD 1Y0LB 3G08B 3BO8B 2UZXB 5I1EH 3RJDA 4JO2H 1Y0LA 3G08A 3BO8A 1I3GL 2Z0BA 5DGRA 2N7BA 1N0XL 4NZUH 3SCMC 5GQBA 4KI5E 1Q9OB 2YD7A 3LHPL 1Q9OA 4PPTA 5JNYB 1MQKL 1MF2H 3QIBB 1HEZB 3O3EB 3QIUD 1OW0C 3JZ7A 5JNYA 3KS0H 4Y4FD 4ZAKB 3QIBA 1HEZA 3O3EA 5AWNL 4ZAKA 4LPCA 2XWTB 2PW1B 2LV4A 1T89C 2BVQB 4TSCL 3WUWB 1R3IL 2XWTA 2QBWA 2A0LC 2YC1B 3CDYA 2PW1A 1F13A 2BVQA 5GRJH 2CK0H 3RVTC 5JR1H 5DMGD 3WUWA 4OD2B 4PJDF 4URTB 4ZO6A 4MQXC 4OD2A 1OOAA 3QYCA 2PCPB 2FX9L 5L2KE 2UZIH 7FABL 4KU1A 3ZDYF 3F5WB 2PCPA 5DHYB 1JPSL 5F1SA 4QHMB 1ZT7B 4Q74A 3F5WA 3D9AH 5JOFB 5DHYA 4QHMA 3CU7A 4M9OA 1ZT7A 4WVRA 5IHZB 5BV7C 5JOFA 1N5YL 2YD2A 3ZE1F 1EEZA 4U0RC 5IHZA 1A0QH 4PB9L 5E99H 3ARDB 3HC0B 2HAZA 4PJBF 3TC9A 2KH2B 5L8KB 3ARDA 3O2DL 3OXRB 3HC0A 5SWZE 4OZIF 4OQTL 5MERB 3NCYP 1XGYL 3OXRA 4UQ2B 5BZDB 5F9WB 3CVHL 5MERA 1LEGB 5E5MB 4J7RA 4IDLA 4BJLA 4UQ2A 1CT8B 2Z35A 3NA9L 1LEGA 5E5MA 4GG6B 1CT8A 4TQEH 3MO1B 2VLRD 4PLJD 1KTKE 2YPVH 1KGCE 3MO1A 1XF1A 3C6LB 2DLGA 2IBZX 3TIDB 2FJGB 1RUQH 1F4AA 3U4EB 4XAWL 1M7XA 1MI5D 2FJGA 4KVNL 4UAOC 3U4EA 2QL1A 2OS7A 3MCLL 5IESL 5DS8B 5IGXH 3OG6B 5DS8A 4XH2B 1BQHG 3SCMB 1CTNA 3KPLB 4XH2A 4XMKL 1XCTB 3SCMA 3MLRH 2A6JB 2EE2A 3VU2A 1E4KA 3KPLA 1CDJA 1PD6A 1XCTA 2A6JA 3WO4C 3MRDB 4IOSD 2BVOB 1GAFL 3IDNB 3OGCB 1RZJH 3N1FC 3MRDA 5CHNB 3L5IA 1SJVA 2BVOA 3OGCA 3IDNA 1JUFB 3BD3A 2APVA 2ITCB 1OWWA 5CHNA 4E5XB 1KNOB 4H25B 1JUFA 4NP4H 2ITCA 1RUKL 4LOUD 1KNOA 4H25A 1RY7B 1T89A 1OF2B 1FG9C 2PXYB 4MS8C 3MGTB 1TZGH 3ZDZF 1IMHC 4NJ9L 4U7SA 4LFHD 4O2EB 1OF2A 1UA6L 2PXYA 5HGAB 1MCRA 3MGTA 5ITBH 3QDJA 4H0IA 3KLHD 3NH7H 4O2EA 1K85A 4I2XE 4HAFA 4EI6B 3B83A 3S5LA 1AXTH 2ZUYA 5J9PB 4ZFOL 5BV7B 5J9PA 3N85H 4JG0H 4U0RB 3GMRB 4JFDD 5JW4M 4E41D 5CEXB 3K0WA 3GMRA 1JZ8A 1U3ZA 5CEXA 4JO4L 3MLUH 4NQCE 2H32H 3V8CA 2CDFB 2XOTA 1ZVYA 5ITFB 5I1KH 1J1XH 4KMLB 4LLVB 4XXCC 5BJTB 2JF1A 5ITFA 1D5ZB 1GXEA 5GJSL 4EEEA 4MQSB 1F45A 1OP5K 3O6FB 5BJTA 1D5ZA 1O7VA 2DQCL 3OJ2C 2IPTH 2EZ0C 3TH3T 3O6FA 1CYGA 1TJHL 3LEVH 2VO5A 4P0DA 1KJMB 2X1XR 3DMMC 3HG1B 3D39E 1U8HB 3PDDA 3RGHA 1KJMA 1U8LB 3HG1A 1X5IA 5FYLL 2MSPA 2GK2A 1U8HA 5D1XC 5GGUB 1QR4A 4UAOB 4JJ5B 5EC2B 1LQSR 4DN4H 5GGUA 4JJ5A 2QR0B 3RVXC 5EC2A 2WINA 2QSTA 4NIKB 4PRPB 2XZQL 3MOAH 5I30H 1XGPB 1H5BB 1X4YA 2QR0A 4LNRB 4N8VB 4ELMB 3G5XB 4PRPA 4PD4J 3RUGE 1XGPA 1H5BA 3QIBD 4LNRA 4N8VA 3RY5A 4ELMA 5C2UB 3G5XA 1VEOA 1BX2B 4ZAKD 4OLZH 1BX2A 1GZQB 3WO4B 5C0CB 4P2QB 1GZQA 3ARUA 3VFTB 4K3DL 3MV9B 5C0CA 3CK0L 4P2QA 4JQXC 1ERNA 3VFTA 1GGCL 3MV9A 3QUML 3ZYJA 4M1GH 1KC5L 5CFHA 3EBAA 1G9ML 5FF6B 4K7PL 3LRGA 4HUXB 1OAUL 5FF6A 4HUXA 4N8PA 2MCPL 4YHML 1MLBB 4MZ2A 1ED3B 3KXFB 1FIGH 5DGQA 1MLBA 2V6HA 3EO1B 2B5IB 1ED3A 3ULVD 1GGBH 3KXFA 4ALAL 4OD3H 1NGXB 5F9DC 3EO1A 3W5NA 1NGXA 3QA3B 1G9NL 2OP4L 3ARDD 3FO0H 3E3QC 3QA3A 4TRPH 4WTZA 4C56E 3KYNB 1IAKB 2DJUA 2HKHL 3KYNA 1IAKA 5I19L 4Z8FL 4L4VB 3P0YH 5DQDL 3DECA 3BN9C 3TT3H 1CCZA 4BQBA 2Y6SD 4L4VA 2GITB 1BQUA 4BELD 2GEEA 4GUPB 2J8UF 2GITA 3GI9H 2VN4A 4P2YA 3C6LD 4GUPA 2A74B 2L7UA 1NSNH 3OKOB 2DQUH 4X6FB 3HMWL 2A74A 3QXTA 3UTTE 3HN3A 3OKOA 5JOPD 5JW5B 4JQIH 5DRZB 1CVSC 1DQQB 3DMMB 5TFSL 4OCYH 2GJ6B 5JW5A 1FFQA 5DRZA 1DQQA 3CFJB 3DMMA 2GJ6A 4GS7C 5D1XB 3CFJA 1T21A 2WLYA 4OIIL 5CGMA 5EU5B 1IKFL 5D1XA 3SCMD 2AK4E 1CE1L 5EU5A 5JQ6L 4O5LL 3BUYB 4MAUL 4LKCB 15C8H 5D9SA 1BM3L 3BUYA 3MRGB 4OV6F 3PGFL 4RA0C 4LKCA 1CU4H 3LMJH 3MRGA 5E2VL 5TE7H 3EZ8A 1ZLWK 3U79A 1P5VA 5F72S 3OKLB 4LIQH 3V79C 5CLTA 4F58H 3LS5H 1N8ZB 3OKLA 3ARGC 4NQDA 3PP4L 2A0LD 3CMOL 3DPBA 1N8ZA 2DLFH 2VQ1B 2H8PB 3QISA 3RVTD 4BKLB 4KQ3H 1IEBB 4XB8A 3PHOB 3DTXB 2VQ1A 2H8PA 4MQXD 4BKLA 1IEBA 4HF5L 3PHOA 3DTXA 2H1PH 2HLAB 5I1GH 2BRRL 3EYUL 4Z8FH 2HLAA 1NC4B 4I4WB 1DBBL 3UTSB 1NC4A 4QRRE 3TN0A 4I4WA 4RWYL 4G6JH 3TH4T 3C8KB 3UTSA 1UYWL 1KJ2L 1C5CH 5HHOB 2OL3H 3KHQA 3Q5YA 3C8KA 4I18C 4I3RH 5HHOA 5ANMB 2BOBB 4Z7QE 1YUHB 4AEFA 2EYSA 5ANMA 1JZ7A 2BOBA 1YUHA 5SX5H 1VDGA 4L5FH 4OZGE 1LEKB 4YH6A 1ZT4B 3DLQR 4WCYL 1LEKA 3NABH 1LO3H 2VDPL 3AREA 1ZT4A 1HWGB 4NBXB 4HULB 3C2SA 1A14L 1I9RL 1CFQB 1FFNA 1KN2H 2AJYL 4N1HB 1TMCB 4U3XA 4ZPTB 2C26A 1CFQA 3MLVH 3GMLB 4JFXB 4ZPTA 4ODWB 3VXRB 3BE1H 4R2GC 5HYIA 3GMLA 3JVGC 4PRPD 4JFXA 1G84A 4GS7B 4ODWA 3VXRA 3MRNB 4K8RH 3E6FB 3T4AB 3QFJD 1B2WH 4KKNA 3MV8B 5IW1B 3L1OL 4X5XB 4GBXA 3MRNA 3E6FA 3T4AA 1F4XH 3MV8A 5IW1A 1N3NB 4X5XA 3O4LB 4OB5H 1FNGB 3S37X 5BQ7B 1F4YL 1N3NA 1UXSB 2G60L 4JPVL 1FNGA 3V0AC 1GOHA 2N1KA 5BQ7A 1UXSA 5C0CD 4P2QD 3V6ZB 3MV9D 5CUSH 1LDPL 3QEQB 1IEHA 3CDGB 4XI5C 3V6ZA 5GRUH 1CLYL 1FRGH 3QEQA 1SMAA 4JO1H 5JW4N 3LN4B 4XVSL 3B9EA 4EQ2A 2VDOL 1N2RB 1FHGA 3LN4A 5IWLC 3D25B 4ORZC 5HI3C 4MS8D 1N2RA 3DX9B 3S4SB 3D25A 5C08B 3DX9A 3S4SA 4LSPL 1QBML 3FAXA 5C08A 1MCFA 2R39A 4HGWB 3CAFA 5D1ZC 4LASH 5GPRA 1J5OL 2FX8L 2VN7A 5F9OL 4KV5F 4JY5L 4AIZB 1IAIL 3VE0B 4NQUA 4AIZA 1G7PB 2O5ZH 4OZHF 2AEQL 3VE0A 4K9EC 2DBJA 1JZ4A 5F1KC 2CKNA 3T65B 1Z3GH 1G7PA 5IB4B 3T65A 2EE6A 5IB4A 2P5EB 3FB7B 3IXTB 3MBXH 5E6ZA 3V6BR 3CXDH 2P5EA 1JGDB 3C60C 3FB7A 4G9FB 3IKCB 1X5KA 2EZ0D 5FB8B 2X1WL 2X42A 4Y8AA 4G9FA 1ZWIB 5FB8A 2F19L 1ZWIA 5FYKL 5DD0L 3DMMD 2J5LC 2GJ6D 4H1LB 3SHSA 3IF1B 2ENYA 3A6CH 2Z9TA 3SGDI 3IF1A 5D1XD 2IWGA 2FO4A 2Q8AL 4MJIB 3DVNB 4LPVA 5JW3H 3RVXD 1T0PB 3OKMB 4DUXA 4HQQH 3DVNA 3OKMA 3JVGA 2W9DH 4JPIB 3I84A 3O6MH 4PRAB 3G6AB 4JPIA 4OLVH 4PRAA 3VD4A 3AGVA 4X6DB 3G6AA 1YQVL 3KPTA 2OJZH 4FFZH 1L0YA 5LGHH 4WHCA 3DVFA 4I3SL 2YD6A 4F33B 5FHAL 5KSBF 4MVBC 3WNLA 3R06B 1SVCP 1WQVT 2PTVA 4F33A 2KQMA 4NZDA 1SY6A 1MHHB 3R06A 5HTSA 1FV1B 1MFDH 1RZIB 1FLRL 4I3GA 4ZXBC 1MCBA 1MHHA 3MJ9A