1HQRB

Crystal structure of a superantigen bound to the high-affinity, zinc-dependent site on mhc class ii
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
189
structure length
180
Chain Sequence
DTRPRFLQQDKYECHFFNGTERVRFLHRDIYNQEEDLRFDSDVGEYRAVTELGRPDAEYWNSQKDFLEDRRAAVDTYCRHNYGVGESFTVQRRVEPKVTVYPAHNLLVCSVNGFYPGSIEVRWFRNSQEEKAGVVSTGLIQNGDWTFQTLVMLETVPREVYTCQVEHPSVTSPLTVEWRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA-DR ALPHA CHAIN
publication title Crystal structure of a superantigen bound to the high-affinity, zinc-dependent site on MHC class II.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 34
structure length 180
sequence length 189
ec nomenclature
pdb deposition date 2000-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1hqrB02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 1hqrB01
2Q8BH 5AZEH 2X4UB 1FNHA 4XPBH 1E6OL 4AEEA 2DMBA 4M6ML 1K5NA 5FOBA 4P9HH 4PJXE 3QEQD 4NRXB 1G7HB 3NH7L 4Z78B 2VO5A 4U7MA 5I8KL 1IQWH 1NUNB 1OAXH 1OT1A 4YDIH 2KQNA 4JFHE 3IFPA 5SWZE 4YHZL 4Z0BL 2VXSL 1LEGB 2NX5E 5EBMB 3SE9L 3UTZA 3WFEH 3X3GL 4NKIH 1C1EL 1UKSA 1NGYA 1TJHL 2EYTA 3IF1B 3OR7A 5FO7A 1FNGB 5TF1H 4OM1L 3O2DL 4MJID 1R3HB 1FQ9C 3F8UB 5T3XE 4H1LH 2D31A 4NN7C 3RVWD 1BLNB 5E8EB 2JLLA 1A6TA 3D25A 3BUYB 3MMEA 2X40A 4HWUA 2Q7YA 3HAEH 4WJ5B 3QXAA 1UVQA 3DVGB 5H35B 1A6VH 5IKCB 3C5ZB 2MCPH 3RIFK 1I8KA 1DQDL 4X6FB 5E00B 1S9XB 3V52H 1IQDA 2DI9A 1XGRA 4I3RH 4I2XE 3QUZD 4DZ8B 2P8PA 5D6CA 1Q38A 1I1YB 3EFFB 3KPRE 3W2DH 3CNKA 4JQIH 3U9UA 2AXHA 1F11B 3ARDC 3U2SB 4GQPH 4TVSa 1WVZA 1NMCB 4LASL 1PEZA 4G8GD 4A2MA 2VQUA 4NP4L 1SYVB 4Y1AD 3UBXA 3ROOA 4BQ8A 1G7QB 4P2OB 1CG9A 3O6ML 2CLRA 4Q2ZB 2UWEE 3V4VH 1UEMA 3MC0A 2F53B 1SJVA 4D2NA 3KPQB 4ALAH 4JANB 5IT2H 4WV1B 4LLMA 2VUOA 3GBLA 5JW5A 2QV2A 1NGWB 4Q6YA 5T3XL 1NDGA 4ONHA 3G6JE 4QRUB 1EFXA 1ZHLB 2BJML 3O41B 1TZGH 2VZTA 1KNOB 3UJJH 5E9DD 4FTVB 3J8F7 1HN1A 4RGNE 5T1KA 4U1GB 3MUGB 2SEBA 3MRKB 1JMZA 4H1LG 3V8OA 2CKBH 1LILA 4MD4A 5E6IC 1P53A 3G9AB 5AZ2H 4YHPA 3WSQH 4G8IB 3HAEG 3H3PH 4XVTH 3DXAB 2EDEA 3O11B 5IVNA 3PGDB 4X7FC 1BBJB 3WN5B 1MCFA 1ZE3C 2UZYB 4PRHB 4I3SH 1CXLA 4HUNB 1FDLL 3CX2A 4DTGH 2XN9B 3WLBA 1I85C 4ZSOE 3MREA 3Q2CA 1JYNA 2FH8A 3P9LA 3GSNB 3QEGL 4FFYL 2XKUA 4N5ED 5TPWH 4ZPTA 4A6YA 1BQHG 4M7ZC 3L3JA 3JTTB 2YK1H 3U83A 3P30L 1U8QA 3SKOA 5DHXB 4Y2DA 1N6UA 1T21B 2ZUSA 3DX8B 3FOMB 3KXFA 3RVTD 5F21B 4HKZA 2VLMD 4FS0A 3LN4A 1RIVH 1R0AH 2X7LB 1VENA 3EGSA 2G60H 5A16A 4LVHC 3B5TA 3P2TA 4S1SL 4LNVA 1IAKA 1J5OL 4Y0GA 4C56A 4OCWH 4KKLC 4P46A 4JDTL 3BIBX 1SY6A 4NNXA 4OJFL 4NDMB 1XH3B 3QO0B 5F6HI 3EDDA 5JHDA 1CLCA 3UTOA 2NY2B 2WNGA 3HUJB 5DVLA 1RZIB 4X80L 2ZUWA 4XWOD 4ONFH 5KN5B 3VWKC 3MJ9L 1KG0A 4O2EA 4ONOA 3QBTB 1MI5E 2D7NA 2QSVA 3AS3A 2FH6A 1DLHB 1FFOB 4YDJB 1ZLSL 1ND0A 5E8NA 3RAJL 1UB6A 3U7AA 6FABH 4UZGA 4X6DB 3P73B 2ICCA 5HD8D 1YEIH 4MHHI 5CEYA 3BHBA 3TV3H 5FYJD 3SJVE 4D3CH 3WFZA 1YUHB 3V4PH 3MGTA 4U1JA 3TA3B 4JFDE 3ILQD 4LHUG 5I8EB 5JR1H 3T0EA 1Q94B 4LSPL 2P49B 4G8EA 1T20B 4GW4A 5CGYD 3SY0B 1ZHNB 2HJFB 1HHIA 1DUZB 4OGXH 2PTVA 3CVHB 1BZ7B 3MCLH 5I66B 2J6EA 1TXKA 5EU6E 1A1NA 2AV1A 2DQUH 2KKQA 5C07E 2QQLL 1VADA 5BRZB 2NY4D 1HINL 3RPIA 2D7TL 1BFOA 4QYOB 4Q6IB 2ESVB 3D6GA 1PG7W 1BMGA 3TO2B 3KYKH 1I9IL 2YKLL 1MJ8L 3DTXA 3X3FH 5KVEH 5A3ID 1HI6A 1N3NB 5E24E 3Q5YA 4MNGA 2XZCL 1QP1A 1OAUH 2BC4A 5AEAA 3FQWA 5IMLB 3L3GB 3EUUA 4OF7A 2NY3B 3PHQB 4NJAH 5GGVY 3BQUD 3H9SD 4RFEA 4K55A 4X7DC 5CEXA 3FFCB 4HS3B 4QXTB 2D4DA 1HK6A 4P2RE 1FYTB 3VH8A 1NCWH 2R0KH 3MRGA 1HQ4B 4DWHA 4M7LL 1NLBH 5CEZE 4JM4L 4WO4C 4YR6A 2R2BB 4RGNC 3D2UD 1AQKH 1GL4B 1P4IL 4QRPB 3KG5A 1BIHA 5HHPB 5BO1H 2X1XR 3GHEH 2CRMA 3AGVA 1NEZA 3JUYA 3O4LB 4P5TC 1B3JA 1IGCH 3NCCB 1QBLL 3FQXB 4NFDA 3GSOB 1JFQL 5KSBE 5DJ6B 2WANA 2WK2A 2ICWI 4I5BB 5D5MA 2DQJL 4HK3N 4TNVK 1EZVY 4GXVL 2X89D 4YFEA 1G7LA 4PRBA 2R8SL 5HI3D 4G8FA 3H9YA 1A6AB 2VLRA 4LSQL 3WHE0 4NZTH 4ZUWB 1MWAL 1R3IH 4F57L 4JN2B 1RURH 3RZCD 5J13C 4NO3B 5E94B 4KVCH 1Q0XH 2F5BL 3M8OH 4WFFD 5EDXA 3PP3H 4OD2A 4XNXH 4Y5XA 4PJBA 2NTFB 1SBSL 1C12A 5ACMA 2XQYG 3LY6A 1EERB 4RA3A 5GXBB 4YX2L 4N8PA 2J8UE 2UVEA 4KC3B 5CEZL 2HKFH 4S1RL 2ZG3A 4XTRC 3BZDA 1BFVH 3SGDH 1N64L 4DUVA 3A6BL 3BP7A 5EO0A 1CD1A 2IAND 5JHLL 3P0VH 1TCRB 1MCWW 3H7BA 3DVFA 2BNUA 1AR2A 1BD2A 2EH8L 4CVZB 1GC1L 3OKOB 1CIUA 1GOGA 5C2BL 1MHEB 4WRLA 3CMOL 4QRRD 4LQFH 5IVXA 2IEPA 1E4WH 3EO9H 4ODWA 4LEXH 3ARWA 3H0TA 4ZNCD 5I19H 5HHOA 4HIJA 3RVXC 3CLFL 1II4E 4X6BA 1OTTD 5GGVH 1ZA3B 2GUOB 3RWCA 2ADFL 1FGVH 3MGOB 4LKCB 3IDYC 3SKJH 2Z9TA 4NPYB 1NBQA 5CJ8A 5F7NC 2G2RB 4E41E 3NBNA 3MA9H 2CR6A 4D0DA 5C0BB 5IESH 4IOFD 4KZDH 3VG0L 4HUWB 4JO2H 4N0CD 1BIIA 1YEJL 4DEPC 3QQ9C 1RK1B 4Y4FC 2P5ED 3CK0L 1P4BL 4M93B 2AEPH 1J0KA 4XHJC 1HYRC 5FKPB 4Y4KB 1ADQL 4TSCL 4PLKD 3K0WA 4UIKL 3DARA 2HMIC 3IXTB 3MV7E 4HFUH 5GJSL 2FWOB 5GS1A 4UV4L 4J4PC 3WMSA 4LGSB 3UTTB 1S9YA 4ZXBD 5JA9A 4J8RA 1IGFH 1ITCA 4EN3A 2D4FA 1ES0B 4PJ5D 4PUBH 5IB3A 4QHLB 5FCSH 3KR3L 3D3VE 1KTDB 3UJIH 5JA8B 2FO4A 4E5XA 1G9ML 3S5LB 3QDJA 1XGUA 3IVKA 1OP5K 3QP3A 4JLRA 3TBSB 1UKTA 3DSFL 4GRWE 5T1DH 2EKJA 3NPZB 3SBWA 1JV5B 2P1YA 5TH2B 2IH3A 4MA8H 4NIKB 2ZOKB 4D94A 4LDOB 4G9FD 2BZDA 2Z31B 4WI2A 1UQSB 4CAGA 4IJ3B 1YMMB 3H9ZA 4MLSA 5E2WL 4I48B 1AXSB 3QHZL 1MCEA 1I1AD 3VXOA 3QDGA 4F58H 5FO9A 1T83A 3LHPH 1NGZA 4NQCB 3TJEH 4EIGB 3IJSB 4JFXB 5IMKA 5JDSB 1OCWL 3R0NA 1OQOA 3MRPA 2BRQA 5IB4B 3W5MA 1BFSA 4I9WD 4O4YH 3IT8D 1KELL 1GC1C 1QFWL 2EDTA 4L29A 4G6FD 4GMTL 1WZ1L 2A6JA 5E6IB 5F96L 3DETC 4ZTPH 3U6RA 2W9DL 1QQDB 3MLVH 5HJ3B 1KACB 4X6EA 2WP3O 2ZPKH 1ZWIB 1UH4A 3GIZH 5L0QC 1QEWB 1I4FB 3HNSL 4QOKB 4Y7MA 1JYXA 1A6PA 2GFBB 3LEYL 3OV6A 3CFJB 1BX2B 3DUUB 3V5KA 5BZDB 1DDHB 1FFPB 5LWYH 3EFDH 4HIXH 3VXSD 1FO0H 3M17B 3HMXA 2P24A 1SJEA 3RUGE 1MAJA 4KQ4L 4XCNA 5D96B 5GSVA 3UMTA 3QNXB 1QSFA 4D9QD 3NPSB 3ES6B 5ERWA 1IGYB 4ZQKB 5T1LB 2FRGP 2FEEL 1VKXB 1U8NB 2V5RA 3UP1A 3SDXE 1BOGB 3KPOA 4XRCB 1F8TH 2CLVB 2AJYH 4C55A 3EOTH 1G9MC 1SY6H 5J9PB 3VA2C 2ZUYA 5DUMH 4GLRH 2E7MA 2GJ6A 4PRID 1XCQA 1BBDL 4X6CA 2Y07L 2FECI 1IAOA 3WS6C 1JTTA 2CIKA 5T5FH 1LK2A 1AO7A 4Y5VC 5SWZB 4LSUH 4F15C 3BH8A 4OV5B 2F74A 1RUMH 2NX5B 1IKNC 3L3OA 4PR5B 5I75B 3BGMA 1RUKL 1JHTA 3RY5A 5MEQA 3U30C 1XGPA 3UTSD 5CBAB 3GJFB 4KWUA 3TFKC 5TE7L 4JY6B 4NO0B 1YY8A 1QYGH 1KPRB 1H5BA 4YHKH 3SN6N 5BVJB 1UJ3C 1Z9LA 4HMEA 4X8JA 3NCBB 5KSUB 3UTPE 3MLSH 2BP3A 3CVIL 3F7QA 4IDLA 2CGRL 4DVBA 1IILE 4I0PC 1KEMH 3QNZA 5C86A 2VZ1A 1FG2B 2IPUK 4O51A 4OSUH 2Z92B 4L9LC 4JFFD 1FL5A 3I84A 3C08L 4OLYL 3WJJA 1M7DA 2DD8L 2J6EH 1INDL 5C9JB 3V6OE 5I1IL 5DJZA 5C0AE 3BVNA 3DMMD 2B7DT 1DBBH 3T08A 5F93C 1A3LL 4RMWA 4JRWA 3IFLH 3BX7C 2O5XL 1FZKB 1XGTB 1J8HA 1YQ2A 3C60A 5CKAA 5KVGH 4OZGB 3WKML 4YAQB 3NCYP 4Z7UE 4KRPC 4QXWA 1X5ZA 3B4NA 1MJUL 5FYJH 4F37K 4LSSH 2YZ8A 3MV8A 3IJYA 3LEXB 4ODUA 4JQXC 4FMKA 1HH9A 4HWZB 4K9EL 1T66D 3N1PC 5D2NE 4L3EA 1K4CA 5GZOD 3RDTA 3IFOB 4G43B 3BRFA 2CUHA 4XAKE 4JDVA 2PW1B 1AGBA 4WO4B 5IWLA 4OZIB 1A6ZA 1MFEH 1OGAB 2CQVA 4LLUB 4GXUM 2XI9A 3PDOB 5AYUL 3O81A 2ARJQ 4P5TB 3V0WL 3B2UC 5I8OH 3SOBL 3MRDA 1C8PA 3DGCR 4F7EB 1GIGL 3B3IB 2Z4QB 3PJSA 5GHWH 1T3FB 5F88A 5JXEC 1FORH 5EUKA 5HYSA 3QUYD 2Z91B 2LFGA 4YDKL 3RWFB 5DK3A 3NVQA 5D7IE 4YNYB 3PWJA 4HZLB 1U92B 1OAZH 3QI9C 2VXUL 4JRYA 2K7PA 1QLFB 2EXWD 1JPSL 3IB4A 1B4RA 3QXWA 1RIHL 1XR8B 2LVEA 3O4OC 1UYWH 1VHPA 2R39A 3F7VB 3RGVA 1N59B 4MNQE 5D5MF 3KJ4B 2DJ4A 2EO9A 4MAYC 4RX4A 3GI8L 2ITCA 3G5YB 4CNIA 3FQRB 3LZFH 3VFNA 3Q3GA 1ZT1A 5EPMB 1N0XL 1ZOXA 4DVRH 4NQDD 3K8MA 2VQ1B 2B8OT 2HFGH 5JO5B 3ZDXE 1KIRB 5I17B 5EFIB 4TTDD 3T3PE 1Q0YH 1S9VB 4H25A 3PDGA 1YEFH 5EU5B 2N56A 4XPHH 1BQSA 3N9GH 1M7XA 4XPFH 4QKXB 1LO4L 2CUIA 1NEZG 4BK4A 5BCAA 1AD0B 4NQVB 4XC1H 4OCSH 5IFAL 5TGBA 3IDYB 2ARJA 4MVBC 3QXDA 4P4KC 1W72H 1R3KA 5IQ9A 4M6OH 2ADIA 2VXTH 1QNZH 2IPKB 2QKIB 1NGPL 3MODH 4TULL 2APFA 1D9KB 3P4NA 4GW5B 1I9RH 4GXUN 3ULSA 4EUPB 1WEJL 1D6VL 1H3VA 3UPRA 3RTQA 3P4MB 2PXYD 3NABL 4L3AA 4KVNH 1GGBL 4OGZA 3V6OC 3DVNB 4N0UB 3SGJC 3TM6A 1ORSA 4W6YB 1TJIH 2IH1B 2EO1A 5FM5M 2H9GB 5J6GB 2P8MA 3C5JB 4LSRH 1X7QA 5D1QB 1KXVC 1PDKA 1KXQE 3DX9B 4UT7L 4RCAA 1RULL 1EEZB 3GUTA 5AZEL 2P46B 1S7XB 2X4OA 4XPBL 5CZXD 5FYJU 3VFGH 1DANU 2A6KB 1RHFA 4M4PA 4P9HL 1LP9E 3VXRE 4FNLH 1N4XH 4MJ4A 1IQWL 3C9NB 5ISZB 1U8PA 2A9NH 4LARL 4K2UH 4OI9A 3SE8L 5GRYA 3WNLA 4PJHB 3WFEL 5D2NC 3VJ6B 1QR1A 4PJ8B 4K3HA 4NKIL 1KIUA 4LSVH 4HHAA 1BWMA 2DLGA 4JN1H 3REWA 4RWYH 1HQRB 3WNKA 5TF1L 1I75A 3ZE2E 4HUKB 3F62A 3HNVH 4JG1H 1XFPA 2JJVA 2OTWB 2W91A 5I1LB 5JW3L 1DVFA 5DWUH 4UUJA 1G0XA 1A6VL 3EYUH 5BS0B 5A2LH 3V52L 3HNTH 5LG1A 4DZBA 2IQ9H 1QVOA 4D8PB 1BECA 3ZHDA 3V0VA 1UKQA 2NCMA 1N6VA 4L8SB 1MF2H 4IDJH 1YY9D 2XV6B 4JQIL 4LSTH 3EO1A 2GHWB 4B7LA 3BEWA 1CGUA 1R24B 2YRPA 4XI5D 3QPXH 4YZFF 3X12B 5F1IB 3RY4A 1WIPA 2HFTA 3HZKB 1CICB 1KCRL 2C3XA 4BZYA 3KNBB 1JK8A 3QO1A 4LF3A 3DUSB 4WEUD 5AYQA 4IOIA 1LO0H 3CU1A 1SJHA 2DBLH 2IAMB 4U05A 2BDNH 3V4VL 2O5ZL 4FQQA 1T89C 1ZHKA 4CL7A 3IDMA 3I2CH 4IMLA 3CAFA 5C6TH 3VGGA 2C1PB 4ALAL 2ADJB 4FABH 1U3HB 4EI5D 1DE4B 1MCPH 4M6NH 4JFYA 1KTLA 1TZGL 2F54B 1CD8A 1S8DA 2MSPA 1AGFA 3SDCB 3D85B 1ETZA 1O5DT 3C6SB 4Z8FH 1ZHBB 2Y1VA 1E6JH 1XGQB 4PD4K 3QFDB 4S0TD 1U6AH 1CD0A 5K9KA 2Y7QA 4PV8B 2CKBL 1QSED 4P9HC 1HIMH 5AZ2L 3NGBC 1YEKL 3WSQL 3KYOA 4ELKA 2YA2A 3H3PL 4JR9H 3MUY1 5DRXB 5L2JA 1BFTA 4PTUB 5J3HC 4NQEA 5IG7B 2HLFC 3WHE1 4OZ4B 3CZFA 5SWQA 3FO0H 4P5KB 4ORGB 4MMXC 5KSVB 2DWDA 1U8HB 5F7HA 4U49A 2KL6A 4WUUD 3RI5F 4XXCA 2ZUQB 1RJZA 3PL6A 1M7IB 2CXKA 2AJUH 4OZHE 4CDHA 4GW1A 5C09B 3OKNB 1KLUA 5SWSE 3HR5A 4UTAH 5FFLA 2APWA 1RIVL 1R0AL 4BFGA 4OBRA 3DJ9A 2G60L 5F72S 4KZEH 2VAAA 5IEHB 4GS7B 2XACC 2HT4C 3QDAA 4EDXB 3BPNB 4ISVA 4OCWL 1FVDA 1E4XH 1WK0A 3C09B 4HT1H 4PJFA 2VITB 5HHMB 3SDDD 4JRXA 1AKJB 3DO7A 4HWEH 4Y19E 1U36A 1FVCB 1N26A 3T4YB 2RR3A 3MR9A 2DQHH 4ONFL 3HPLB 5DD0H 2HH0H 5GPRA 4QF1B 1DSFH 4PJ9D 2HTLC 4KRPB 4Q9RH 3DPBA 4LLYA 5DMYA 2D9QB 3GBMH 1WF5A 2BNQE 2WBJC 4D0CB 4X0KA 4WW1B 3QIWC 2Z8WC 4KJPD 5K59E 1DN0B 4HUUB 4BUGA 2VISB 1JL8A 4X9BA 1NFIB 3TV3L 2DYPA 4OIIH 1MCSA 4RGMC 3SDYH 4D3CL 2X70A 3V4PL 1DBKH 4G5ZH 3A67H 3VFWA 5ICYB 3QNYB 5JR1L 4X4YA 3DBXB 3MOQA 3W0WB 4OGXL 1YC7A 1J18A 4U7KA 1H3UA 2NY1C 1MCOL 3HS0A 3MCLL 4RMVA 1YPZE 3F5WB 5IIEA 1WZMA 4WTXA 5K9OA 1UXWA 1EBAA 3T04D 5TDOB 4BSJA 4HW6A 5IP4A 4TUOB 4WCYH 4LEOA 4X98B 1I8MB 4LHQB 4H5SA 4UNUA 2JTDA 1F02I 3CSYA 3TYGH 3OGCB 1FAIH 1EVUA 2IWGA 4P2QA 5DHYA 4CGTA 3KYKL 4N1HB 3IU3A 3GSQA 4ODXA 5L8KB 1WITA 3K46A 5DK2A 5GGSB 3X3FL 5KVEL 4NN6C 5GIRA 1QZ1A 4X83A 1OAUL 4JFED 4RMQA 1YYML 4RAUA 4NJAL 1EPFA 1IGIH 3GKWH 5D7JB 4H20H 3PWPE 2C3VA 1GZPA 3QCUL 1UJTA 1OP9A 4DCQA 5LXGH 3GMQA 4OZIF 2CJUL 1W8OA 3VFVA 1F3DH 2AERT 4U1KB 1XIWA 5ETUB 1WCBA 4MAYB 2X9YA 1NLBL 4UBDD 1TPXB 2NXZC 3GBNH 5L2KE 1AQKL 4GG8B 5IW1B 3LH2H 2YC1A 5TF0A 3U48A 3BWAB 1XCTB 4N0FA 3CCHA 5BO1L 2JB6A 3TP4A 5F9WB 2N7AA 3PGFH 5DMGD 5DRZA 3MLPA 3BZEA 4X99B 1IGCL 4ZO7A 1Z3GH 1D6EA 5CIPB 2A9MH 2V7HB 3C5SB 3V5DA 4GBXA 1U58A 4Z7WA 4MA3A 1HXMA 1UCBL 3QEHB 3U0WH 5IM7A 5ESVB 4OCLC 1QLRA 2YEZB 3MCKA 4MA1C 1K3IA 1PKQB 1JN6B 5CSZA 5DVOA 2DWEA 4NZTL 3THMH 5C6PB 2GIYA 4YLQT 1NAMB 1R3IL 4HJJH 3QZWB 1AQDB 3JTSB 3PDDA 4WTWA 1HWGB 4DW2H 5KS9E 4GO6B 1LEGA 4P4KB 2H32H 4KVCL 1UA6H 1Q0XL 2CH8A 4NKDA 3RFZC 3M8OL 1DQJA 5EUOE 1WAAA 2Q87A 4YDVA 4XNXL 1EFXD 1CFNB 1CDYA 3O45A 5MENB 4L4TE 1X4ZA 3MRMA 5CJQH 2HKFL 2F53D 4FG6C 5T1KD 1ZGLB 5FF6A 3QEQE 4JCMA 1KLGB 3P0VL 5IBTH 5INCB 4XNZC 4AIZB 3HG1E 1YMHA 3DROA 3MLYH 3MRJB 3G6AA 3SCMC 4ORZC 2FJGB 4R90H 1QRNB 4PBWD 2GY5A 1A7NH 3T77A 4AENB 3QUXA 4LQFL 1WQVT 3KPPA 1E4WL 1HOCA 3BZFB 4FTVD 3EO9L 4KPHH 4MJIE 4PGBA 4LEXL 5DLMH 3P0YL 5I19L 4ZYKA 4OLEA 2YMXH 1M4KA 4NHCH 3T65B 5GGVL 1WWBX 2LTQC 1FGVL 3HFML 5GS3A 5T3ZD 3UDWA 2QQKH 2VLJB 2BVQB 4HJ0D 4XH2A 4F37F 5T1MA 2YD3A 3FN9A 4TRPH 3D0LA 1JGVH 4Y2DD 3DXAD 3MA9L 5IESL 4KZDL 2VIRA 4JO2L 4PRHD 3K1KC 4U1MB 3KXFD 2HFFB 2F58H 3MLTB 2C4FT 3O3DA 1T0MA 1DEEB 5CLWA 5EC1A 1JPFA 4OUOA 4PS4L 4U6VH 4K94H 5LAXB 1ZHLA 1FV1A 2W92A 5ENWA 4HFUL 4KV5E 3VFUA 5EBGA 3EDFA 5KVMC 2X1WL 3CUPB 4G8GE 2JELH 1F97A 4WWKC 1J88A 4RRPA 1J11A 3ECBB 1QFUH 2BOCB 1W8NA 4EOWL 1GJIA 3HC0B 1H8NA 1IGFL 2B4CH 3N50A 4H88H 1O7VA 1QA9A 4PUBL 1HNGA 2ZUUA 4OFVA 1IT9L 1I8LA 3UJIL 2LV4A 4E9LA 1MOEA 1MQKL 4MXVE 3O11A 3PGDA 2APVA 3J7HA 4QHKJ 1LHZA 4PJ7E 5DHVB 3WN5A 1HWHB 4C83B 1U8JB 5T1DL 2XN9A 5DFTA 3L3HA 4KK9C 1FZMA 4PGCB 1NFDA 2NY2D 1ZT4B 3QQ3A 1IL1B 5IJKA 1KCVH 4TUJA 1IC5H 1VEOA 2OCFD 3E2HB 5E9DE 3GMMB 5FYKH 5ADOH 3PWUB 3LKQA 1U93A 1W0YT 3AY4C 1VGKB 1S7QB 5F7MC 1F2QA 4F58L 3TJEL 3S35X 1Q9LB 4R3SA 1AY1H 1KOAA 3QEUB 4OIAA 4XNQB 3T8XA 4O4YL 4Y16B 5D70H 5LBSH 3DV4B 1LDPH 3O9WB 4IEFB 1RFDH 3BIKA 43C9B 1I1RA 1FL3B 1CD9B 1QD0A 3QQNA 3QUMB 4DGYL 3JVGC 4N8VG 4LPCA 4KU1A 2ZPKL 5DD5L 3GIZL 1A9EB 1RZIA 1BF8A 4QXGH 4PJAA 2IADB 4MHHG 3V6FA 2OTUA 2WP3T 1G1YA 2FIKA 2W38A 5BRZD 4A6YL 2BVEA 5D1ZB 5LWYL 3EFDL 4HIXL 1DLHA 1FFOA 1FIGH 4YDJA 2HT3C 4P23B 2XICA 3NOIA 1F3RB 2ESVD 3NZ8A 4P99A 5T33H 1JWSA 2XZAL 1H8OA 4ZFZB 3T0EE 1AXTL 3CDFA 4WY7H 4L4VA 4CVXA 1EK3A 4FFZH 3BEVA 2NY3D 1Q94A 4NNPH 4YGAB 4PJEE 3MV01 1NAKL 5FM4A 3FFCD 3LAFA 5HYJA 4PJCA 3GMLA 4HAGA 1UZ6F 1JZ6A 1F8TL 1FYTD 3HPJB 3WHXB 1S5IL 2AJYL 1BZ7A 3EOTL 2EYRB 3FKUS 1SY6L 5DUML 1X4YA 5DD3H 1PYWB 3QIUA 2EDYA 3PF2A 4JKLA 1HDMA 4KY1L 3RVWC 5T5FL 3BKMH 2Q86A 4XNYH 4LSUL 1INQA 4K3GA 1FH5H 1GOHA 1RUML 2BSTA 2XPGA 5FYJE 4OTXH 5GS2H 3ZYIA 3TO2A 4MQ7B 2R1YA 4PJIB 1QPXA 4PJFF 3QIWB 4Q9QH 5HY9B 1FFRA 3DYMA 3QUZC 4J7RA 1QYGL 3PHQA 2E7LC 3L95B 4PGDB 4QXTA 3MLSL 1X4XA 3B9AA 4IRSB 1UXSB 4R0LC 1N7MH 4P3WA 1QACA 5GISH 1OLLA 4MYWB 1KEML 4KHTH 3ULUF 1XZ0A 1L6XA 5J6HA 3HI1B 1KJMA 3QDMB 4OSUL 2OJZL 4QRPA 1AGDA 2J6EL 3IETA 3WNMA 4ODBD 1FVEA 3A6CH 1ED3A 5CP3A 1DBBL 3FB6A 5D9SA 1S7UA 3PIQA 2P5WB 3JWOH 1REIA 1OB1B 3DGGB 3HE6B 5F6IB 1KULA 1AHWB 3QULA 5HHOD 5DJ6A 4IHOB 5KVGL 1MJ7H 1KJ3H 2LVCA 4F7MB 2A83A 3FRUB 4WDIB 3HI6H 3M1BA 4LSSL 1T0NB 5FYKU 4YO0A 4P57B 1FNFA 4KHXH 3ZE1E 2YUZA 1Q1JH 4X9IA 5C0JA 1X5HA 3GSVB 5JNYA 5LCVH 3ZE0E 2Q76A 3QSKB 3ZYJA 4IBLT 4MAUH 3L9RA 5DTFB 4LCCA 1M6OB 4GKZB 4JM2A 1RZ8A 4KROB 1Q9WB 3Q6GL 1YEDB 4K7PX 4UILH 1MFEL 3BDYH 4NJ9H 4YK4B 5HI5D 4EBQH 3WDJA 5KOMC 4N5EC 3LRSB 4E0RB 5IF0A 4M43L 4KI5F 1NJ9B 1YNLH 3NIDE 2EDFA 4MA7L 5CUSL 3VFOA 4M61B 2JJTC 1E27B 2DKUA 2OI9C 3QDJD 4C54A 3WUWG 1G7IB 4PJDF 5IEKB 5GHWL 1MHEA 5F8QC 3H3BC 4ZS7H 5DD6B 5E8PA 3RVTC 5C9KA 1JWMB 4P3CL 1T80A 1CF8L 3OPZH 2OYPA 1TQCB 4UNVA 2PNDA 2BNRA 1BQLH 4N68A 5JIHA 5DMKB 5DO2D 1A1OA 3Q5TA 1CE6B 3U36B 1OAYL 1ZA3A 1I8IB 1OAZL 5TE6L 2BFVH 2OXHA 1D5BB 4DN3H 1CBVH 1WTLA 1UYWL 2O93L 1MHCB 2R0ZH 3CX5K 4ZODA 2A2QT 5C0BA 3TGXA 4UT9H 4OCMC 5DRWA 3IU4H 3S4SG 5DUPL 1EH9A 1MUJA 2R23B 4XWOC 5DA4A 3WCYA 2NR6C 4OCRH 5FKPA 1CXFA 4KTEL 4MX7B 3IXTA 5KTEH 3TF7C 1KJ2B 4DVRL 1TJGH 4KMLB 1NC2B 3I6KA 5JOPD 5CMAB 3DWTA 2HFGL 4M1GH 4XT1C 1F90H 3BPCB 4DGVH 2YS4A 3UTTA 3SCMB 4BA8A 4NQCD 2DTMH 5I9QC 3I75A 3FB8A 5HD8C 5GGRB 1Q0YL 5I1AA 3ARFC 1S7TB 4K71B 3X11A 3ARDA 4KXZI 2GSGB 5DGQA 1KPUB 4OQ1A 3RNQB 5D71H 4KGJA 1RHHB 4NQTA 2FBJL 4XPHL 1B0RB 4RBPH 3ILQC 3N9GL 5I1CH 5EOTB 4XVJH 5LGJB 3WFDH 3CC5A 2C1OB 1W2KT 3KPSE 4ZO9A 1S3KL 1ULVA 2PYEB 1A02N 4BZ2H 2WM0A 1W72L 2KZ1B 4M6OL 4OLXH 2VXTL 1UQSA 1QNZL 3OB8A 3FT3B 3MCG1 4QOKD 2IBGA 2NY4C 3E1F1 3ARBB 3L3KB 1WUNT 2FLBT 3MODL 2F8XC 3GHBL 3NFNA 1HKLH 5F1NB 3SDAB 1L4IA 5K9JH 4KKCD 3WFBH 2NZIA 5F89B 4JFXA 4KVNL 4UU9A 2AS5M 1WBXA 3SQOL 1F42A 5HPMA 1D5MB 2UY6A 4YQXL 4ZUVB 5A3IC 2XRAH 4LIQH 2XOTA 1B4JH 4QT5A 2OK0L 2MWCA 2AW2A 4LSRL 4F2MA 3BPOB 3BQUC 3SQBA 2V9RA 2EDWA 3HLAB 5T1LD 3Q6FB 3RWHB 3VFGL 4QNPF 4MJ6A 5DFWH 2CPCA 3VRLE 4FNLL 1N4XL 5JW4Q 2ITDA 2VTFA 4WNQA 2EDRA 2YBRA 4LPYA 1I85A 2A74B 4XPTH 4X4ME 4M5YH 3REVA 2DBJA 1S7VA 5KW9H 3GSNH 3DOSA 4JN1L 1BX2A 3EYFA 3EJZD 1DDHA 1FFPA 3IXAA 5DJYA 4I9WE 3HNVL 4E42B 1KEGH 4IS6A 5D7SH 4LLDB 5DWUL 2E7CA 1T5XB 5CZVL 2VDRL 1DUYB 2YPLD 4YBLC 3EYUL 5JQHC 1QSVA 4NO0D 1AFVH 1WT5C 1IGYA 2IQ9L 4PREB 3RVVD 4GFTB 4U1SB 1NFDF 2KZWA 2AJ3B 5E8OA 2CD0A 1MNUH 4AH2B 1T5WA 1MF2L 4IDJL 4O58H 4XZUA 1U41A 3X13B 2NLJA 3X17A 3RZCC 1JNLH 4N0YH 2X4SA 2P42B 1RMFH 3JXAA 1NSNL 2EIDA 4CDGC 3L6FB 3QPXL 4PJXA 3E6FB 2DQEH 2HAZA 3BE1L 2DQCH 1CFQB 4UQ2A 3BMWA 5B8CC 3AS0A 3UTQB 4O2FA 5SWZA 4YHLH 4MJ5B 1FBIH 3VWKA 1EAPB 1LO0L 2NX5A 2XWTA 1KB9J 1T1XA 4PR5A 4D9QE 5J56B 2DBLL 1EA9C 2BDNL 1JGUH 3CFBA 5CBAA 4F9PC 3BI9X 3I2CL 5C6TL 2JIXA 4HXAL 1I3UA 4L3ED 3ROLB 4EVNA 3HMXL 4JPKH 1CE1H 3MLUH 1NUGA 3KYMB 5EB9A 5IMOA 2WMPA 2EZ0C 3B9KB 2MQ0A 3MUZ1 4L4TB 3WEXB 1MCPL 1B9ZA 5DZNA 1HXYB 4GRLB 1KB5B 1BVKB 3B9DA 1BGXH 4Z8FL 3G5XA 1E6JL 4I2XA 3QG6B 1NC4B 1OTTC 1KENL 1U6AL 2Z93B 2EDBA 1V7ML 3KPRA 4MMZC 5ECJE 3CVHH 3HB3D 1HIML 2DLHA 3UTSE 5FUOL 3CSPA 1EBPA 4IOFC 3S88H 2KBGA 4N0CC 4JR9L 2KUTA 1GVIA 4Y88A 5FDWA 4I3GA 3ARSA 1U91A 4MQXD 3ZDZE 5JORB 1GGYA 3KLSA 3FO0L 2UWEA 3WIHH 5DI8A 3FMGL 2BMKA 5ID1A 5DJXB 1EMTH 3PWLA 5GGTH 4ZXBC 2DM7A 3FB5B 2AJUL 3W9DB 3G6JA 3LEVH 4ZOAA 1ZAGA 3EO0A 1MLBB 2IQAA 5EZIH 5D93C 1KCLA 4MXQD 4XP1H 4G7VH 3TBTA 1RJLB 4WO4A 3WDHA 2NW2B 4Y1AB 2YPKA 5CBEA 3SPVB 3S36L 1G9EA 1N5YL 4Y4HB 1C16A 2V6HA 1OGAA 3VI3E 1E4XL 4HT1L 3U1SH 2W60A 2DAVA 3QG7H 1UB5B 2V2TB 1IGTB 4HWEL 4M1DH 4P5TA 2IALB 1Z9MA 4HFWB 4HAFA 3MJ9A 2WUCH 2DQHL 1I1AC 5DD0L 4FQIH 4ZSOA 2HH0L 4PJIF 1DSFL 2GSIB 2W0FB 1A5FL 2FB4L 3LPWA 4Z77B 3FTGA 1Z6JT 5KG9B 2XXCB 3GBML 4EZMA 4AT6B 3DRTA 4FQXC 5EZJA 2Z91A 3VXNB 4HK0B 5KJRH 3CU7A 3OAZK 4PLJD 1ZLVK 4M62L 2QL1A 3MO1B 1EUUA 1H3PH 2IG2H 5TE4H 2UZIH 1TTFA 3OXRA 4NGHH 1WIUA 2VNCA 4OIIL 3RWGA 3SDYL 3NACH 1DBKL 2HFEB 2UV3A 4X5LA 3F7VA 3ME0A 1N59A 3RTQD 4LLVB 5TDPA 4LFHD 3V95A 3LKRB 3GMRA 5HHQA 4KQ3H 3FQTB 4TVPD 2Y72A 3CDGB 4HV8A 2BX5A 1JF1B 3IDJA 2YRZA 5I18H 1HH6A 4GKSB 4BSWB 3BN9D 5IW6A 2BVOA 4NQXB 3BISA 4WCYL 5JO5A 4EKXA 4LQ1A 1OPGL 1RZKC 3SO3C 3TYGL 3KYNA 4IRJB 1KIRA 1MRCH 3TT1H 4JM2F 4JZJB 1FAIL 3H6JA 2HN7A 1WGOA 1MI5A 35C8H 1H15B 4G9DB 1TNNA 5FGBC 2JJWA 4L8DB 3W11D 1X9QA 4G6AD 5CAYB 3JV4A 3VXTB 3U0PA 1JI1A 5JPMA 4QRSA 1NMAH 3UPCA 5DQDH 3RKPA 1FNSH 4KH2A 1AD0A 5CS7A 1IGIL 4H20L 2OXGA 2HRLA 4K3DH 1EUTA 1XT5A 1NBZA 4PRNA 3VE0A 1CT8B 5FDYA 3FO1A 4ETQA 5LXGL 3MBXH 3FAWA 3PGCA 1RU9H 1H3WM 4Y4FA 1L6ZA 3AAZA 4ZFFB 3FT2B 3GBNL 4PJ8D 5DK0A 2XA8H 4TUKH 4K8RD 4OCYL 3OXSB 5DVNA 5GZND 1SHMA 3P4MA 4WW2C 1BVLB 1JNNL 5AWNH 5EU6A 1TVHA 5ICXB 4QRQB 2Y36L 4QY8B 5C07A 4J4PA 2C4FU 1F6AB 1CXEA 1I3GH 3B8SA 5DC4B 2A9ML 2H9GA 4WU5A 1X6LA 2CLZA 1U8MA 3OR6A 5ANME 2R56H 5BS0D 5GS0H 1X5AA 2FL5A 2AI0L 1R5VB 2G9HB 3DECA 5D2LF 3U0WL 1H3XA 1Z9OA 4UOW0 5L8LB 2J88H 4Y5YB 1MWAA 3S35H 3P9MA 1DFBL 3EYSH 5I76A 5MEPB 3C9NA 1DBJH 3THML 1FJ1A 4HJJL 3FO9A 3WIFA 2XYCA 1HHKA 5C0EB 5IMMA 1UA6L 2EE9A 3B6SB 2CIIB 4FXGB 4AEFA 4BFBD 4P2RA 4JAMB 1P5VA 1CICD 3DMMC 5D8JL 4WEBL 2ZG2A 4JHBA 2DQDH 5F7EH 3V6ZB 4BKLA 2IAMD 3KWWA 5CJQL 2BOBB 1I7RA 5L9DH 2XKSA 4YPJA 4TPRL 2OZ4A 4L3CA 3O0RL 3HMWH 4PGEB 1U3HD 4I1NB 3WE6B 1T6WA 3BP6A 2Z8SA 4LGRB 1BJMA 5DDHA 3MLYL 3BT2H 2XZQH 2VN7A 3H9SB 4L1DA 5KSBA 4GG6E 1NQBA 1T66C 4I18B 1NUFA 4R90L 2GJZA 3MRNA 3GZKA 1RK0A 4YXLH 1A7NL 3FL7A 3L7FA 3QWRD 5GZOC 5BXFA 4NQED 3SDCD 3LKPB 5E99H 2LQRA 4HBCH 4KPHL 3VDBA 5M95B 2I9LB 1F4HA 2YMXL 3NFPA 5F1IA 4NHCL 1ZA6B 3F12A 1MJJB 5FAAA 2AQ2A 1EDQA 3D2UB 5C8JB 2QQKL 4NCC1 5HDBF 1VACB 3QWOA 1FZJA 4ZFOB 5FYKE 1OM3H 1WC7B 5SX4I 4K7PY 4AIOA 2OX5A 2C1PA 3MXVL 2F58L 5C0GB 5IHZB 5CD3B 3V5HA 5ESQB 3D48R 1GH7A 1IEAB 2H26B 3STZB 1WWCA 3S5LG 3PWNA 3FO2B 4FP8H 2J8UA 4K94L 1GRWA 4YBLB 4YXKL 3FCTA 3OKKA 2OM5A 4Y2OA 4KJWC 1CFSB 2JKXA 3D85A 3QUYC 5GGQH 2JELL 1J1PL 3OAYK 4JRXD 3PQYD 1QFUL 1B88A 4RMSA 5C09D 5MI0B 5C08B 4LDLB 1UACH 4H88L 2EXWC 3GSWB 5DQJB 4J1UA 2XKNB 1OF2B 4YFLF 5C71A 3PNWA 3WS6A 5B8CB 4Y5VA 3AB0C 4PTUA 3ULUD 3RVUD 4UDUA 3D39B 1IKNA 1AKJD 4YHIA 1HSAB 1T0PB 1XF4A 4KK8D 5DURB 5DJAA 4W4NA 4E41A 2AK4B 4ORGA 1J10A 4DOHE 1KCVL 2IANB 1IC5L 2FYYA 3GJFH 3MV9D 2GAZB 2OSLB 2YD4A 5C0FB 5DT1H 5FYKL 5ADOL 2FATH 4LAQH 4DGIH 4PJXF 3JUZA 1M7IA 4URTB 3OX8B 3VU2A 1UJ3A 4KI1A 2QSQA 4NM8H 3MV7A 4QRRB 4XGZB 3OKNA 1AY1L 4LP4A 3VMNA 2HLAB 5C0IB 3ILPA 3BP4A 2UY7A 5LBSL 4I0PA 2QHRH 2NY0B 1F4WL 5DJDB 2WZPD 4L9LA 4EDXA 5JQ6H 1JUFB 2HYMA 1T1ZB 2A6IB 4GH7B 4HMDA 1FZOA 3RHWF 4YFLI 2BCKB 2VSDA 4AIXA 1I7TA 3MLRL 3O6KH 2CDGA 2P5EB 4WUUE 5IFHL 1FNLA 3T4YA 5M7QA 4F33A 4QXGL 4U7SA 5HVHC 3N1FC 3TPKA 2EH7H 2WLZA 1S7WB 2PXYC 4K7PH 4OCXH 4YGVB 1FIGL 3KPNA 3BKYH 4JQXA 3T0WA 4KI5D 2ZCKH 5C0RL 3CIQA 5T33L 2O5YH 2EDDA 1DN0A 4JKPH 4C58B 2X4RB 1XIWD 4PJ5B 3IS1X 4HQQH 3P40A 4WY7L 5CZXC 4FFZL 1T2QH 5J1TC 4KRMB 3OHXA 3QNYA 4HH8A 1YN7B 2MNUA 4NNPL 4K3EL 1S9WA 2B4CC 5D7JD 2A1WL 2KQMA 1CDGA 1ZVSB 3D0VB 1A3QA 4HGWB 4P4RB 4BK5A 4V1DB 5DD3L 1L0YA 4G9FB 1KPVB 2X4NB 3GMNA 3G6JF 4KKBD 2E6QA 1PQZA 4EJ1C 4K23H 5HYIA 4J23A 4DKDC 3U0TA 3PUCA 3BKML 3MRIA 1CI5A 4KAQL 3OGCA 1FH5L 4HG4K 1NBYA 4R7DA 2VL5A 1VB9A 3NCEB 4H0HB 5JXEA 4JFOB 5AUMA 5GGSA 3MZGB 1SVCP 4Q9QL 4LKXB 1LD9B 4UIMA 5E4EC 5BZWA 5EU7E 4O9HH 2ZNXA 3QI9A 1T22A 3RUGA 1KBGH 1YY9C 1DCLA 3QAZC 1FFNB 1N7ML 3A6OA 4XI5C 1PG7H 1DP0A 1HSBB 5ETUA 4MAYA 2Q1EA 1A9BA 4QCIA 4KHTL 1K2DB 5I16B 4QWWD 2PYFA 3O2VH 3SDXA 5LGHL 4M8QB 4ACPA 5FCUH 3N1MC 3AREC 1T1WA 3BO8B 3QQ4B 2Q6WA 3VXSB 1HHJB 3A6CL 3OKMB 1QR4A 4YDLC 5FO8A 1LEIB 4JFEE 4ODSL 3SGEI 4RDQF 3QJFA 4QHMA 4EI5C 3FT4A 5C70A 5EOQH 3T4AA 4BQ9A 5B38B 1MJ7L 1C5BH 5C0CB 4F7CA 3PABB 5ESVA 4DN4L 5EU4B 3HI6L 3TPUB 4CUCA 2Y06H 4LVNB 2VUYA 2B5IB 5F7DB 2JF1A 4MD0A 4FQCH 4KHXL 1NAMA 1U8OA 3JTSA 3SE4C 1WAAE 3UEZA 4JVWA 1Q1JL 2VLLA 4Z7VB 3BP5A 4GAYA 1FC1A 2J8HA 3VXMB 5I30H 5ALCH 4MAUL 4M9PA 4PRIB 2CRIA 5GGUA 4ENED 2YN5A 2LAGB 3FOLA 2VLJD 1CFNA 1T6VN 4UILL 3TZVB 3BDYL 5EWIH 5C3LD 4EBQL 4EUPH 3V2AR 4ZUTA 1G7JB 4XCYB 1V8HA 5I74B 3DI2B 2VH5H 3V6OA 5C0AA 1F58H 1LDSA 3SGJA 5BQ7B 5D7LB 4FQHB 1KLGA 4MNHB 5HYFA 2CUMA 5IB2B 4O2CA 4AIZA 2QR0B 2X2YA 5DYOA 4NZUH 3OKDA 5JLZA 4G80B 4F8QA 1WFNA 2FJFB 2YA0A 1QRNA 3JV6A 5HGHA 5CCKL 4Z7UA 5MHSE 2ZJSL 5JIPA 3G5ZB 2CKNA 2Q3ZA 3BZFA 3OPZL 1RSFA 5IR1B 12E8H 1BQLL 1QO3A 3EJJX 3OJDB 3QXTA 2ATKB 2BFVL 2PO6A 1HHHB 4CMMB 4ZMAT 5D2NA 5A2IH 43CAA 4JFFB 5HHNB 4L1HA 2F53E 1R5WB 2NY5H 4NOFA 2YD9A 4K8RH 3SDDC 1OSZA 4W6WB 2R0ZL 4JZOB 2GITA 2DMCA 3P77A 4LCUB 4O00A 3TBVA 4UT9L 4RGOL 3RIAK 1KIQB 3ZTJH 1FFQA 5ICZB 5ID0A 2JCCB 2HFFA 5I1JL 1H0DB 3VFRA 5FB8A 4M7JH 1GZQB 4OCRL 3WIIH 2CK0H 3ZYZA 4PGJA 5LAXA 4LIQE 4U1LB 2GCYB 5KTEL 3GO1H 5IFJB 4HJGA 1SBBA 4PJ9C 1TJGL 4ZFGH 3UZQA 3JWOC 1TQBB 4FTVE 4MXWH 4YIQB 4AJ0A 4M1GL 1F90L 4JEGB 4DGVL 4NQSB 4CMHB 2DTML 3TYFB 1I7ZB 2YSSA 1X5JA 5I2IB 1G7PB 2MHAA 3WXWH 3DXAE 3PWVB 2GJJA 5D71L 5CJBA 4EUPG 4FQPA 4PRHE 2X42A 4AMKL 3O9WD 3MRBA 2N4IA 1AI1H 4XVJL 2BSSB 3T3MF 5D7IA 3SEPA 3BAEH 1WBZA 5EU7C 3TCLB 5HVFB 1U8IA 4HKBA 1A6WL 1LO3H 3G08A 3O6FC 2FECL 2VLKB 1S7SA 2RHEA 1T89A 5BMFH 2YRLA 1J1XH 2VKXA 4F3FB 2IPTH 4MNQA 3KLAA 4R4BA 3MRRB 3NIGE 4CN6A 2C7UA 4CU8A 3W9EA 4WTZG 1VGKA 4XNMA 5DMIH 4BH8B 3QR2A 2YXFA 3RKDD 1HKLL 5F9JB 1JE6A 5K9JL 1H3GA 1OSPH 1FL6B 1JZ5A 4P23D 5ACZB 1BZ9B 4QRTB 4UDTA 3MXWH 4QXUH 1OAKL 2XRAL 3BKCH 2PCPA 4LIQL 4R96A 1B4JL 3DV4A 1RJYB 3HZMA 1KCSH 5BW7C 1IARB 5E2TH 3P11H 2QEJA 4JO4H 3VRIB 4AEHH 1FL3A 3HUJE 1RZJL 5CINH 3QUMA 4YBQC 1OGTA 2DLEA 3L5WA 5E5RB 1NCAH 3VFTB 3JBG7 1EJOH 4XBGB 3TNNB 5IOPB 5CHNA 1XF3B 1JPGB 5DJ8B 4KJYA 3VWJB 1VSCA 2DIBA 4XPTL 4M5YL 1UM5H 3GSNL 1AP2B 2ZZUT 2MKLC 5K9QI 4HX1A 4H1LA 3RBGA 4NQDB 1RZGB 3CFDA 2HJLB 4X6DE 3O8XA 3HAEA 1NLDH 3DHJA 4APQA 1KEGL 1JP5A 2X9XA 5D7SL 2COQA 4U6HB 3BXNB 4OFYD 2VDQH 3C5ZC 3EOBA 5C3TA 3QXUA 4NBYB 4QHKI 4RSVA 4OZFB 5DS8A 3C8DA 4ZO8A 3WL9B 5B3JF 4IOSD 1DEDA 4U2YA 3W5NA 1XF2B 3CPLA 4ODTH 2MPAL 8FABB 3D87B 1BQHA 2F19L 5C0ND 4Z9KB 5J57B 5FKAB 2Q8AH 2OR9H 1VFAA 1MNUL 3ARGB 1IC7H 1PD6A 4O58L 2X4PB 3RY6C 3VMOA 5JPNA 1JNLL 4N0YL 5GJTH 1LO5B 1RMFL 2EYRA 4PRDA 5BRZE 3CFEB 2OTPA 1LP9A 2DQEL 3VXRA 4ELMB 1T04A 3GJEA 2DQCL 3EYQD 2ESVE 4P2OC 4X9HA 1CDHA 3LKSB 1WWWX 4QTHA 3RJDA 3EYVB 4GQ9H 4G7YH 3G04A 2Y5TB 3CXHJ 2W07A 2J2ZA 2PW2A 4L8CB 1EFQA 2P5WD 1JGUL 3F58H 2IFFL 3HE6D 4WV1C 2WBJA 5HGAB 4LHJB 3D9AH 1Z5LA 4JPKL 3QIWA 1CE1L 3MLUL 4Q9BA 1L9NA 1IEBB 3FFCE 4OLWH 2BRRL 4R7NB 1UWGH 2F5AL 1FYTE 2MOVA 4JM2D 2V7NA 2VDNH 4GRWF 3NN8A 3G9VA 1BGXL 4GOSA 4U1GC 3TIEB 3MYJB 4RZCA 4N9OB 4QRPE 4QHUA 2CKBA 1JWUA 4OQTH 2BSRA 4JO1H 3IDGB 3T0VA 4HJ0C 3CVHL 3O4LE 1OT2A 5DQ9B 4WU7B 4KROD 3F7YB 4GAFB 4LLAA 3S88L 3L5XH 4UOW1 5L88H 4LL9A 5JTWA 1RV6X 5EU3B 4LHUA 1CQKA 3BDBA 3PV6A 1L9MA 4L8BB 3SKMB 1KSRA 2RFXA 4IHOA 3HE7B 2XNAA 1XEDA 5BVPH 5INDB 1AIFB 5BV7B 1YJDL 4WDIA 1EO5A 4NM4H 4Z5RB 4P57A 4YHOH 4KXZH 4DAGH 1TTUA 3V79C 5F8RC 2QADB 5GGTL 1JPTH 2AJSH 1Q8MA 5ESAA 1AGCB 3RL2B 3LEVL 5JUEH 3T09A 1LE9A 4N9GB 1DQMH 4MDIB 1YNTA 5EZIL 5E4IA 3O3AB 4G7VL 3ZKQD 1KJVA 5F44A 1O7SA 2ED9A 2RQ8A 3PP3K 3RWJA 1GGCH 1RUPH 5KBNC 3VFPA 4PJGB 1J05A 1X5IA 3QG7L 2NY2C 2R1WB 4D9RD 3RWDB 4BYHA 1NEUA 4M1DL 3RUGF 2EYSA 4LCWB 3I3BA 3ARDD 3VXPB 5CIPH 1NJ9A 4CADA 2FEEI 2WUCL 4XCEB 3VRJB 4TSAH 3VGAB 4Z95H 1NC2D 1EAJA 2CDFA 1X5LA 2A6DB 5DD6A 3LQAH 3GEWB 4UQ3A 15C8H 4JPIA 4X5XA 4XBPA 3VI4F 5H2BB 4PV9B 3U36A 1H3PL 2IG2L 1EJ6A 4BZ1L 2FX7H 1NAMH 2UZIL 1KIPB 5C0BE 1MCLA 4UINH 5D1XB 4OZHA 1QSEB 5E2JA 1D5BA 3WBDA 1MIMH 3TA3C 1NGQH 3NACL 4MCYB 3LMJH 4XWGH 3UZVB 5SWSA 2X9WA 2NTSP 1LEKB 1YDPA 3RPKA 3I02A 1SVZA 4H8WL 2HJKB 4HPOH 2PYED 5ADPH 3R06A 4KQ3L 4P5MA 3ZL4H 1TIUA 1AGEB 3MZTA 3ZHKA 2FJHB 1IC4H 5I18L 4Y19A 2AK1H 4Q6IC 3SDAD 4G42B 3SCMA 3K80A 1MRCL 3TT1L 1P7KA 3ZYOA 3PHOA 1JZ4A 4HULB 35C8L 3V4UH 3TO4B 4LNRB 4OFIA 1RHHA 4RAVA 3WUZA 2BNQA 3B9VA 3CLEH 3CDYA 4YZFE 3MRHB 1XGYL 2NY3C 1OY3B 2VDKH 3OJMB 4NSKB 5DQDL 1FNSL 4BH7A 5KSAB 5LGJA 3V7MA 4Z7VF 1CL7I 2HG5A 2ICEB 1ZGLM 1I7UA 1IM9A 2OJEB 1CZ8H 4OKVB 1YMME 3MBXL 5JOPE 4NQUA 4TOYH 5F97E 4U3HA 3OKLA 5TDNA 4Z7UF 2RIKA 4PG9B 4NQCE 4TUKL 1F4AA 3C6LB 3K74B 2W0KA 5FGCB 4XP9H 2DQGH 5EO9B 4PJ9B 1YPZA 4X7TB 3ZSSA 1DLFL 5EN2B 2IFGA 3QZWG 1JRHI 1P1ZA 4Y89A 4HKXB 4ZUVA 5F9OH 1N5AB 1JGLH 4EDWH 4WWKA 4HH9B 2CDEA 4HS6B 4LU5H 4S2SB 4AZ8A 4NKOA 4XVUD 5GS0L 3O3EA 5EG6C 2AXFA 1OLZA 1U8KB 2J88L 1CXKA 4R6UA 2E9WA 1CGXA 4P59H 2R4RH 4PRPD 1LK3H 4QOKE 1HZHH 4PFEA 3X14A 5IB1A 1DBJL 2A77H 1M05B 2R2EB 5DHVH 1N2RA 1FG9C 3GGWB 3NCJH 3PWPA 5T3XD 2Y25A 4NRZA 3FONA 1OAQH 4JDZB 5L7XH 5IROC 4WHTA 2JCCF 3MFFA 3HZVB 4ZTOH 2AEIT 3AY4A 1A7QH 2DQDL 5F7EL 1K5NB 5FOBB 4MSWB 5L2KA 4JHWH 5L9DL 2YA1A 4HSQA 1YYLH 2VZ3A 2DLIA 2FNBA 3IFPB 4GKOA 3LPGA 4QGYA 1NCBH 3KLHD 3HMWL 2K1MA 3B9KD 4PREA 1JNHA 1KC5H 1NGYB 2EYTB 4U1IA 1HCVA 1VGEH 1EO8H 3OR7B 4R4NC 2WUBH 5FO7B 3BT2L 2XZQL 4AH2A 1HHGA 5SX5H 1LNUA 1ZEAH 2X5PA 3DRQA 5ITFA 4GRLD 4Q0XL 1S78D 2D31B 2LAAA 3KS0J 1SYSB 1JNJA 1P2CA 1P7QA 4LK4A 2W65A 1A6TB 3D25B 3MMEB 5E99L 5HGGS 3JVGA 3QUMH 3MLZH 1BZQK 1NC4D 3L6FA 3QXAB 5AG8A 3NAAL 2OP4H 1I8KB 3MNZA 1XGRB 5HI5C 1PKOA 1I3RA 4BM7A 4UMGA 4JO3H 3T2QA 5KS9A 3QDHA 4H26A 3TNMA 2P8PB 3CZJA 5D6CB 1L7IH 3I50L 1OM3L 5EUOA 3AM8C 3U9UB 3ROLA 4M93C 1JHKL 4OV6F 3IDUA 5E2VL 4FZ8L 4Y4KC 3D69A 1KCKA 2K7QA 4L4TA 1MFDH 4FP8L 4M7LT 2AXGA 3UBXB 1CG9B 3QEQA 2CLRB 1CTOA 5EA0H 3DV6A 3QWQB 2X6MA 2IF7A 1IJ9A 3C8HA 3HG1A 5DO2C 5GS0C 5JOFA 3MRFA 3FB7A 1CLOH 5T5NG 4LPVA 1UACL 3OB0H 4YE4H 2D7OA 4LLMB 5JW5B 1QBBA 3K4AA 4ESKA 5IBUB 4ONHB 2ADGA 4MJIA 3MX0A 1EFXB 2HKHH 3STLA 2VZSA 1Q9KB 1MFAH 4Y4HD 3U4BH 4HS8H 3M07A 4OZGE 5CJOH 2G75A 3KJ6H 2Z31C 5T1KB 1IKFH 4IJ3C 2SEBB 3FJTA 2P8LA 1UT9A 2ZOLA 3OBAA 4MD4B 2DDQH 5DT1L 3QUZA 2FATL 4YHPB 1DBMH 3WD5H 4OT1H 5ILTH 1LP9F 4ZUUB 1ZVYA 2E7LA 3W39A 3RIAF 3S96A 3WLBB 4UV7H 1ZT7A 4R0LA 4OZIE 1S7RA 2H3NA 3MREB 3P9LB 3FRPG 3HC4H 3JZ7A 4R97B 4G8GA 3GMOA 4XTRD 3C87A 1OGAE 3QFJD 2PUQT 4ZPTB 4A6YB 1XR9A 4XAWH 3WS3A 2QHRL 3L3JB 2MFNA 1U8QB 3SKOB 1NKRA 1SM3L 4MCZA 3ZE2F 3L5JA 5JQ6L 4Y2DB 3S98A 1MVFA 3VG9C 4ELMF 3H9HA 2PETA 2F8OA 2V2TA 2H6PA 2GTZA 3KXFB 3O6KL 3H42H 4HKZB 3LN4B 1QLEH 4LPUA 4PJ7A 4EI6A 2DQIH 4HIHA 4M1CD 3EGSB 5A16B 3G5VA 2X05A 1FO0A 2GSIA 5GGRY 1DQQA 4OCXL 3K8LA 1IAKB 2WV3A 4Z76A 1ONQA 5CKGA 5KG9A 4P46B 3BKYL 4AT6A 3SJVD 4IRJD 4NNXB 5E9DA 1Z2KA 3VXNA 2ZCKL 5D96C 5JHDB 5JXAH 3HKFA 4JFDD 2XWJA 1TETH 3NPSC 4JKPL 3AC0A 3QQ9D 4XCCH 3R8QA 4XHJD 3ORJA 5D6DC 1WLHA 4TQEH 4O2EB 4KK5D 1TVDA 4LLVA 4WI4A 1INEL 5EU6D 4L5FH 4EIZC 1ND0B 1J0HA 5C07D 5EBLA 1UB6B 2O61A 2ATPA 3CDGA 4GRMA 1PZUB 2EEAA 2I07A 3EJZC 5CEYB 3BHBB 2P45B 3GSUA 4GKSA 2DOCA 3KDMA 4NHUB 3MGTB 1AC6A 1FIEA 1TZIB 2JJTA 3CXDL 1U9KA 5I75C 5J1AB 4ZAKD 3MQIA 4G8EB 4GW4B 3E8UH 1HHIB 1OQXA 4HDIA 2GEEA 1MEXH 1A1NB 1KFAH 4P2RD 2AV1B 4O9HL 2QSCH 1KBGL 2E3VA 4XMLH 5CEZD 3RPIB 5IB5A 4XPGH 1VDGA 3IDNA 4BFIB 3OF6D 2XA3A 3MLWH 2ORBL 1PG7L 3L7EA 4JFZL 1MREH 2OMBA 4O02L 3VXUD 4PJEA 4B5EA 4PJGF 3OGOE 3ULVF 1HI6B 3B2VH 3O2VL 4MNGB 1P4LA 4OF6A 5EZLA 5E5MA 2XXMB 4N0UE 5FCUL 2BC4B 1KJ2H 2BVTA 4RFEB 2R2HA 3BIAX 5CEXB 1CFVH 2R0LH 2AGJL 3MRGB 2B1AL 1MHHA 2DS4A 3EKCA 1JTOA 4RQQA 5F3HA 3VH8B 4PY7A 5EOQL 3ARFA 2Q7NA 1R5VA 2ZCHH 4LVOB 3TH3T 2J4WL 4YR6B 4MD5A 5C2UB 3O2WH 3UC0H 3DIFA 5ISZE 2NXYD 5DFVC 3I9GH 4PJHE 1NEZB 1FLTX 3VW3H 4FQCL 4POZC 5DZOA 3HRPA 4LMQI 4NO5A 4XNUH 2CIIA 3KLDA 5HYQA 3L5IA 4JJ5A 5D5MB 2ILLA 4RFNC 4UT6H 3UAJD 4M6MH 3V6ZA 1PBYA 5EWIL 5BS0E 5IQ7H 1G7LB 4PRBB 4G8FB 5C92A 1ZLWK 5I8KH 1JZ2A 1BVZA 2VLRB 5K59F 1CLZL 1F58L 5AAWA 1XAUA 3X3GH 5GQBA 4M4RA 1C1EH 3OL2A 5CGTA 2OLDA 3ZT6A 2FZ3A 4NZDA 4NZUL 4J6RH 4OD2B 4Y5XB 3O2DH 4PJBB 3BQUA 1C12B 3H9SA 3GFUA 1SMAA 2EDJA 3EOAA 3S3SA 3M45A 4I0KA 12E8L 1JIBA 2YUWA 5DVMA 2ENYA 5C08D 4E41D 4X8XA 3W82A 1MJJA 3BP7B 5EO0B 4FFWD 1IGJB 1CD1B 3VFSA 1CVRA 4WI3A 5C8JA 1W0WB 2EKSA 3H7BB 5FV2A 4X7SH 4WUKH 3BW9B 2BNUB 5EIIA 5E1HB 1BD2B 1U3YA 4BQCA 1Q9OB 3KJ4C 1YZZA 2FX9H 3LRHA 5JZ7C 3I6GA 2FIRT 5IVXB 3D39D 5DUBA 4M7JL 5CD3A 4ODWB 5DURD 3H0TB 2X09A 2AK4D 2H26A 5HHOB 1YQVH 2F54E 4HIJB 4I0PD 4X6BB 3GO1L 2OZ4L 4NP4H 1I1FA 4ZFGL 2A73A 1WT5A 4GAGH 4TNWF 3U7YH 2X89A 3O6MH 5E1AB 4HWNA 4AYFA 4D0DB 3D3VD 4PLJC 4LBEA 2DL9A 1BIIB 4YC2B 1UZ6E 2ZKHH 1CGYA 3NFSH 3RZCA 2W0LA 3AU1A 5DQJA 4HIEA 4QGTA 1QSZA 4FXKA 1PZ5A 5CWSA 1FN4A 2NY0D 3P4OA 2BJMH 1AI1L 2X1QA 4CW1A 3SKNA 1AC0A 1TFHA 2UYLB 3PXHA 2L4OA 3BAEL 3QRGH 3VDAA 5GS1B 5F1KC 3CFCL 1W72A 3E0GA 1LO3L 5F7WC 2W59A 4LLWA 1MPAL 4MQTB 1S9YB 5BMFL 4F9PA 3QPQD 4J8RB 4EN3B 2IANA 2IPTL 4HEPG 5IB3B 3BN9C 5EIQA 2EE6A 1D9KC 1D5ZB 2FO4B 4E5XB 5I6XB 5C09E 3QDJB 1XGUB 5DD1H 4JLRB 5IV2A 1OSPL 3KPMA 5FK9A 1MRDH 2EICA 2HLAA 3MXWL 1KB5H 4YPGA 4OGYH 4QXUL 3W11C 5A40E 3BKCL 5KS9F 4G6AC 1P5UA 5D1QC 2IH3B 5IK3A 3MNWA 3ULUE 1X3DA 3RA7H 4W68A 5HHME 5E2TL 2I60H 4F7PA 1U8LA 3BH9A 3P11L 3P30H 4RAHA 2D2OA 4UOJA 4AEHL 1C5DA 3LB6D 1FPTL 3H2WA 5CINL 3QDGB 2J8OA 3MV9E 1NCAL 3JWNC 5FO9B 3LSOB 1NGZB 1EJOL 5IMKB 1IFHH 1OTUD 4QTIH 2E8ZA 3KPSA 3MRPB 4PJ8C 2NY5C 4LPWA 4V1DD 4K8RC 1A2YA 5DJ0A 3QIBD 3S6CA 5GZNC 1UM5L 4L29B 4Q97A 3SGEH 5FEBA 1EXUA 5CP7A 4EQ3A 2AEWA 2A6JB 1JCKA 4YGVA 1T4KB 1GHFH 1L7TH 3U6RB 4JDTH 3IDXL 3DX7A 1NLDL 4OJFH 2WWKT 2XG5A 4XXDA 4X6EB 4ZXBA 1PFCA 2VDQL 4HUXA 3VXQA 4FQLH 1FCGA 3HRZA 1ZVHA 3W0WE 4DQOH 2VDLL 3DURA 2W9LA 3GI9H 4ODTL 4L8SC 1HYSD 4V2CB 3V5KB 2OR9L 1IC7L 3UROR 1Y0LA 3N1QC 2P24B 2ZSWB 1SJEB 4NT6A 5I1KH 2H2PC 3VG9B 5GJTL 3MBED 4I77H 3MROB 4R8WH 1CICC 2X4NA 1QSFB 3N0PB 1ERNA 2DIJA 5ERWB 1I1AA 4G7YL 1IM3A 2IAMC 1E0OB 4OD3H 1QFHA 5E95B 4PJDE 4X4MA 3KPLA 1T1YA 3F58L 4HXBH 5FA4A 2GT9A 3KPOB 2EC9U 5I1DA 4WGWB 4FQXA 3D9AL 1U3HC 1LD9A 3GM8A 1IRAY 4OLWL 3UBXI 3OJ2C 3HI5H 5C0CD 1LVEA 1XCQB 1UWGL 4X6CB 4FQ2H 1BJ1J 1IAOB 2HT2D 3UPAA 3IAPA 2CIKB 4PJ7F 1LK2B 1AO7B 3SDCC 5LVEA 4NKMA 3BH8B 2F74B 3L3OB 4OD1L 3OG6B 2MMXA 5I1GH 5F1OB 3RP1A 1JHTB 4WI5A 2HVKA 4P3DA 4BSVA 1UH2A 1XGPB 2DQFA 1K2DA 1TCMA 3HCVA 5C0AD 5DSCB 3T1WA 4U0RC 4F7TA 4JO1L 2B39A 3VXMD 2XZCH 1YY8B 4B7IA 1PLGH 1R3LA 4KKAC 1H5BB 3RX8A 3CD4A 2P7TA 3VXSA 3L5XL 5HYEA 5L88L 3TZVD 2R0WH 4X8JB 2H1PH 2NY6B 4F9LC 3RGHA 1S5HA 1O0VA 2JB5H 2IMNA 4BJLA 5GRJH 4NUGH 4M7LH 4DVBB 3TN0A 2YPLB 3IKCA 1PKQE 5D7LD 3T2PA 3LS4L 3QNZB 5BVPL 2WLYA 1A1MA 5FGBA 2PO6D 4O51B 3WNOA 3BGFC 1FL5B 1AD9A 1FP5A 2ZUQC 2ICES 1M7DB 3CFKA 4YHOL 4DAGL 5CLTA 2EIZA 3L3IA 5DJZB 1HEZA 5EBWB 3BVNB 4XAKD 1JPTL 2AJSL 4R26H 3T1FA 1QBLH 5JUEL 3GIVA 5LGKA 1F3JA 1J8HB 3ARUA 1B6UA 3C60B 3RIFF 3EYOA 4GS7C 1QHOA 4HF5H 5MENE 1RZFH 1QBAA 3LQZB 3C8KB 3BPNC 3GMPA 3C09C 4GXVH 3ULUC 3MV8B 1EEQA 1FHGA 1GGCL 1RUPL 2V2XA 3IJYB 3RVUC 3MV11 4WW2A 5IVOA 1HH9B 1ZXQA 4XCYA 5EZOH 2WBKA 1SEQL 3UTSA 5FECB 1NL0H 4S1DC 4L3EB 1K4CB 1VFBA 4M5ZH 4FQHA 3TVMD 1QRNE 2QR0A 4JDVB 1EX0A 1AGBB 3O6LL 4G80A 1SBSH 3MNVA 4TSAL 4AM0A 1LE5A 4Z95L 3ZTNH 3SHSA 3LQAL 1A6ZB 3UXFA 2E9JA 3U4AA 5I8CA 4S1RH 2VLJE 4ZOEA 1HILB 4IIQA 1Y18A 2FX7L 1NAML 1U3JA 1IAII 3TIDA 1GAFH 4UINL 3MRDB 1MIML 1NGQL 1ORQA 2VSCA 4XWGL 2EH8H 5I73B 3DMMA 1EEYA 3LKNA 2NW3A 1TVBB 3PJSB 4LCUA 5F88B 4RFNB 4M02A 5EUKB 5E03A 2VLKD 5HYSB 4NO2A 4NWUH 3CLFH 3PWJB 1BM3L 5DMJB 5FYLD 2Y5EA 1YEHL 2EDLA 4PLNC 4JRYB 2L7JA 1A7OL 4POYA 1NBVL 3VMPA 4YHNA 3RGVB 5J0BA 4GKNA 5EOCL 3RJQB 1YEJH 3VCLB 1OOAA 1DQTA 3CK0H 3T2NL 3ZT7A 1V3LA 2ITCB 2A0LD 5F7FA 4CNIB 1ZLUH 1B0GA 1KF9B 5B3NA 4TSCH 3CLEL 4UIKH 1ZS8A 3Q3GB 1ZT1B 2VDKL 3ZSTA 5D7JC 1AR1C 5GJSH 2X4QA 2NNAB 3O8XD 3UYRL 5H8DA 2EXYD 5DJCA 4UV4H 4M7KH 1NMBH 4APQD 1CZ8L 1BAFH 1TPXC 4TOYL 3K4DA 4F3FA 3AVEA 4KKBC 4H25B 3EZ8A 3MRRA 3AXLA 3VWJD 4PG2C 3TBYA 5F9WC 4U6YA 4BH8A 1PJ9A 1NKOA 1NGXB 1YEGH 4NRYB 4XP9L 2DQGL 1WCQA 3LKOB 3MACH 5TGBB 1EGJH 2ARJB 4QRTA 4Q58C 3QXDB 3MRLA 3QUYA 5F9OL 1JGLL 4PJBF 4EDWL 2JK5A 3AMKA 1R3KB 5IQ9B 4LU5L 2ADIB 1RIUL 3O3BA 4FQJH 4HIIA 3LQAC 1KCUH 1QBMH 2I5YH 4BQ6A 4MS8C 5K9QG 1Z0NA 3P4NB 3ULSB 1EV2E 4P59L 2R4RL 3RTQB 5JMRA 3UPRB 3ARGD 4U6XA 4MWFB 1LK3L 1HZHL 1OCWH 1PX3A 2H32A 3AFLA 3LCYA 1ORSB 4QWWC 5DJ8A 3U79A 1A4JA 5GRVK 1OAQL 4YXHH 5L7XL 1AP2A 1X7QB 3IGAA 5F3BA 4GMTH 4NQDA 5IVXF 1WZ1H 1MFBH 4K3JL 2VL4A 4ZTOL 4U1HA 3OKEA 5F96H 4JZNA 2X4OB 2C3GA 3FHAA 4C4KO 3VD4A 4UAOB 2YPVH 4DK3A 3WO3B 3ETBF 1PSKH 3VD7A 5H94A 1U8PB 3GSRA 5J06A 1YYLL 3LVEA 2E7BA 5IJVA 4GSDH 2YXMA 1NCBL 4WI8A 1H8SA 4Z7OF 1QR1B 2XZZA 4YHYB 4HPYL 4HHAB 1JBJA 1KC5L 5FHAH 3REWB 3A0OA 3ZKMD 1VGEL 1EO8L 3QB7C 5ANMA 2Q8BL 2WUBL 4ZO6A 1QFWM 3BWUC 2FCBA 3EAKA 4RNRA 5HPOA 3QJHA 1HKFA 2D3VA 2HVJA 3QUML 3MLZL 1OAXL 4YDIL 4UUJB 4RMRA 3DX6A 5J4MA 4ENEC 1P69B 5IBLD 4DZBB 4NUJA 3U4EB 2WINA 3EYVA 1QVOB 4LCYA 3V0VB 2Y5TA 4JO3L 4PJIE 3BZ4A 1MH5A 3MRCA 1MQ8A 3L1OH 3TBWA 2PXYA 4L8CA 1L7IL 3HZYA 1ZLWH 3RNKA 1RUQH 2R1XA 1CFTA 3EO1B 1PGRB 4N8VA 3BEWB 2LU3A 1X5YA 3MJ8B 3MJ7A 3HE7D 2MCPL 1MFDL 2YUXA 2X4TB 5D7KE 3TH2T 4I3RL 2NXZD 3TJHD 1JK8B 3QO1B 1C08A 4LF3B 2QADD 5MEOA 1SJHB 3W2DL 3QDME 4FQQB 1ZHKB 1CLOL 2XFXB 4Y8AA 4GG6A 2VABA 4YE4L 2P5WE 1K8IA 3IJHA 3F7YA 2HKHL 3LS5H 4W4OC 2VOTA 4TNVF 4JFYB 1KTLB 3U4BL 4HS8L 2FSEA 1S8DB 3GB7A 2VRAA 1AGFB 3ULVD 3E6HA 1ETZB 2GK0A 2B0SH 5KANI 3SKMA 3KJ6L 4OUUA 3AS1A 4LCWD 1Q72H 1IKFL 3QHTC 5IT2L 5KVDH 5K9KB 3E2HC 2Y7QB 1UZ8A 4OLYH 3C08H 4QEGA 4UB0H 2AJXH 2DDQL 3U46A 2HTKD 4D0BA 1DBML 5I1IH 3WD5L 3KYOB 4ELKB 1JGDA 3VRLF 5L2JB 3RL2A 1W0VA 1YNKH 4NQEB 3MPCA 3QUKB 3UJJL 4Y16C 1CL7H 4OGAC 3MA7A 4YUEH 5F7UA 3I6LE 3RWIA 2O5XH 4OFKA 3CZFB 5SWQB 2JJSC 1YN6B 3HC4L 4FG6D 4NC0B 2AKRA 1T7ZA 3O9WC 4AY0A 3KHQA 5D1XD 4U0RB 3WFCH 5ABDE 2DWDB 4NCDA 1FCCA 3FZUD 1C7TA 3CX5J 3CSBA 1T7WA 3D1MC 4XVTL 3AREA 1RJZB 3PL6B 4LCIH 3RU8H 3RWDA 4R2GB 1GCFA 4GUPA 4I3SL 4DTGL 4GW1B 2OL3B 3H42L 4XPAH 1KLUB 3RL1A 3HR5B 1QLEL 1RZKH 4PP2A 4EI5A 1DQLH 1LQSR 1JRHH 1J0YA 2BNQD 2VAAB 5TPWL 1OVZA 1JYVA 5D1ZC 5D2LE 2D9CA 2YK1L 2ZSVA 5EO1A 4LLQA 3UCRA 2ICWA 2R9HD 4P23C 1V3JA 3BGFB 4XVSH 4XP5H 2UZXB 4ISVB 1FVDB 4PJFB 4U1NA 1IM9D 4X6CF 2IGFH 4JRXB 3DO7B 3PQYB 5AYUH 5H2BA 5IVZA 4PRAA 2WWMD 3SE4A 4GAJH 3TO4D 5KAQF 3RWEB 2VKWA 2EE2A 3MR9B 3ARPA 1OWWA 1UCTA 1CN4A 5KSAD 4TQEL 1LEKA 5I0DA 1EEUA 4L5FL 2AQ1A 4X0KB 3EZJB 4WWKD 3BDXA 4YDKH 2QJDA 1CCZA 3FHQA 3MV9B 2MKWA 2X70B 4PB9H 4WUUA 3C6LD 3VFWB 1R3JA 2OQJA 4X4XA 3TWCH 4IRZH 3BPLC 2H8PA 4X4YB 3D18B 1FNEA 5BJTB 3E8UL 1TMCB 3PG2A 4U31A 1JGEB 6FABL 1NDMA 3HS0B 1BQUA 1YEIL 2OR8A 5I71B 5IIEB 3B5HA 4NYLA 5C0NC 1MEXL 1N8ZA 1KFAL 2PYEE 5K9OB 1UXWB 4NNYA 2BVPB 4RBPK 4N0RA 4RIRA 4LEOB 4XMLL 2MQ3A 4H5SB 4IRSC 3QCVH 3CSYB 5CJXC 3LIZH 3SDDA 3WUWA 2G5BA 3MLWL 2X10A 5L2KD 3ZDZF 5B38G 5DHYB 1H9VA 4CKVX 3EYQC 3GSQB 4ODXB 2Y6SD 3KYAA 5DK2B 2BHZA 5EC2A 1GGUA 4MZ3A 3B2VL 2XTJB 3IDIA 5GIRB 4QHNA 4DJMA 2DQUL 1LO4H 3MRQA 1A7RH 4RAUB 5IFAH 4JREB 5EN2A 3HE6C 1CFVL 5F6IC 1GZPB 1AHWC 3MLXH 4OM0H 1P7QD 4DCQB 3F6IA 3GMQB 5B39B 4MJ2A 4HS6A 1Z9SA 1XIWB 1WCBB 3S4SA 3AS2A 4PJDB 2ZCHL 2FO1A 1NGPH 1SEBB 3V6BR 4D9LH 5IUSA 4XB7A 5FA3A 2YC1B 2V9QA 3BN3B 3VI3F 4N0FB 2G5RA 3CCHB 2JB6B 3FFDA 3I9GL 5DRZB 4GT7A 1GGBH 3BZEB 4JKMA 5HBBA 1D6EB 1CXHA 3O6FA 1NCWL 2R0KL 4XNUL 3V5DB 4HMCA 1U58B 4Z7WB 4PTTB 3F7RA 4MA3B 3LDBB 4JDZA 1G0YR 1OP3H 2YD2A 1HXMB 4LOUD 1IEHA 4KROC 2UVFA 2RCSH 5IM7B 5FYLH 1QLRB 3G6DH 4YK4C 3MCKB 4UT6L 4K7FA 3GHEL 5IQ7L 2PTTA 4MSWA 5CSZB 3HG1D 2DWEB 5DEFB 5J1SC 4LARH 3KPTA 3SE8H 5HDQH 3FQNA 1R5IB 4BUHA 5I1HH 4PRPE 4NKDB 1QKZH 4JFEA 1CGVA 1DQJB 4J6RL 4YDVB 5BW7A 2X4UA 5M94B 1SYSA 1G7HA 4NRXA 1TQCC 3O45B 1XMWA 5JW3H 4Z78A 5FIEA 2XT1B 3MRMB 3UO1H 3WNNA 1MCIA 1RURL 5J12B 5EBMA 1TZHB 2VJXA 5FF6B 4OKDA 1BP3B 3IF1A 5L6YH 4XBEH 1YMHB 5HHVH 3DROB 4WUKL 4X7SL 1FNGA 1NPUA 1WFTA 2VERN 1VPOH 1R3HA 4KGLA 4Q9CA 3G6AB 1RZ7H 2FX9L 2YD5A 1BLNA 4TYUA 5E8EA 3S7GA 3VA6A 1VFMA 3T77B 3QUXB 3BUYA 5C0DB 3MOAH 3KPPB 1HOCB 3K8KA 3MSPA 4WJ5A 3DVGA 4PGBB 5H35A 5IKCA 1BFVL 3C5ZA 1CS6A 1YQVL 4ZYKB 4X6FA 5E00A 1S9XA 1KCRH 5DZLA 4EEEA 4OZFH 4G6KH 4GAGL 4XH2B 5T1MB 3U7YL 4DZ8A 2V5TA 2Z8VC 3D0LB 2H2SD 1I1YA 3EFFA 5ACLA 4OF3A 1FC2D 2O5ZH 6CGTA 4XX1G 2VIRB 4K71C 1MCKA 4JG0H 1F11A 3RY6A 4JHZA 2ZKHL 3U2SA 1KYOK 3R8BB 3NFSL 3O3DB 4KK6D 5DC9B 1T0MB 5HHXH 5EC1B 1JPFB 3WYRA 1SYVA 2FLRT 1FV1B 5ENWB 1Q9KA 3VFUB 1G7QA 4P2OA 3SKJL 3QRGL 2LU4A 2BXYA 3QH3B 4Q2ZA 5E8DH 1DANT 2F53A 1K4DB 4CN1A 4GJTB 3KPQA 4JANA 4WV1A 1QA9B 3ARBC 1NGWA 1ODAA 2AEPL 3GRWA 1YEKH 4QRUA 4S1QH 3SDAC 3O41A 4ZUUA 5DD1L 4C56D 4UTBH 4P46D 4HGMA 1MRDL 1KNOA 3NCMA 4FTVA 1CFBA 1KB5L 4Y1AE 3L3HB 4OGYL 1FZMB 5JHDD 3MUGA 1NFDB 1J87A 3BPOC 2EIBA 3QQ3B 3MRKA 4QO1A 4LGPB 4TUJB 1MVUB 3RA7L 2I60L 1G9NH 3OZ9H 4G8IA 3LKQB 1U93B 3DXAA 3BYTA 3EIFA 1BBJA 2GK2A 4PRHA 2VDOH 1IFHL 4R3SB 4OZFG 4QTIL 3GSNA 3T8XB 1FYHB 4MA8L 1JI2A 3JTTA 1UWEH 2Y4SA 4Q7DA 4GG6F 1A47A 5BV7H 3BIKB 1GHFL 1RD6A 4JVUA 3WLWD 1E4JA 1L7TL 3R4DA 4ONGH 1T21A 3T0ED 1MCRA 3QFJE 2QLVB 3FOMA 3DX8A 3LHPL 3HA0A 2BSED 1JZ3A 1MLCB 4XVUC 3BKJH 2FR4B 2X7LA 4PJAB 1UWXH 4FQLL 3V6FB 2OTUB 2NR6D 2FIKB 3ARRA 4DQOL 3GI9L 5C7XH 4ZTPL 1KLFA 2GKIA 1QOKA 2H45A 4NDMA 1XH3A 3QO0A 3MLVL 5I1KL 4CRPA 3NZ8B 2VC2H 4LAJH 3L3DB 1JWSB 3ULVH 3HUJA 4I77L 3CGTA 1CDCA 4R8WL 3ARFD 4XP6H 1OTSC 2DLFH 4NHUA 4L4VB 5KN5A 4CVXB 1TZIA 2CRYA 2VLME 3BEVB 5J1AA 4OD3L 1S9KC 4CJ1A 3JWDH 2APBA 1FO0L 1QFPA 5HYJB 4PJCB 3GMLB 4HXBL 3KLHC 1BEYH 1URLA 5KZCD 1MCOH 4X6DA 3P73A 3B9KC 1EO7A 3HI5L 3QIUB 1YUHA 1HDMB 4FQ2L 4GRLC 3TA3A 1S78C 4XMKH 5HSFA 2Q86B 5I8EA 1BREA 4BFIA 1INQB 3UZEA 1T20A 3SY0A 4FFVD 1ZHNA 2BSTB 2HJFA 2XPGB 5I1GL 1DUZA 3TEUA 1MCNA 3CVHA 2R1YB 5I66A 2NYYD 3BRDA 2UUDH 3EW3B 4FQ1H 3QA3B 2K3TA 1PLGL 4OI8A 1YYMH 3LOWA 5BRZA 2R0WL 4QYOA 1BJ8A 4Q6IA 2H1PL 2OS7A 5CD5D 2ESVA 3QCUH 1OW0C 2JB5L 3BPLB 2CJUH 2VLRD 5GRJL 1Y6MR 3WIHA 4NUGL 1GXEA 4X4ZA 4WEMB 1N3NA 1XZ0B 5J6HB 1KJMB 4JGJA 4HBQA 5IMLA 3L3GA 5GGTA 4YHKL 1AGDB 1M71B 3VXUE 3IETB 3T3ME 2BVYA 1FVEB 4X9GA 3FFCA 1ED3B 3CXHK 2GYSA 4HS3A 3IRZA 3FB6B 5D9SB 1S7UB 3PIQB 2C5DC 1WFOA 4R26L 1FYTA 4JJHA 4NC2B 4NZRH 1B0WA 1HQ4A 1IGMH 2ERJB 4S10A 3QULB 5DC0A 1UCBH 2R2BA 2D0FA 4HF5L 4M9OA 1RZFL 2A83B 5ITBH 2XQBH 4Y4HC 2GI7A 1U2CA 5CSBA 5HHPA 3M1BB 1BD2D 1JJUA 3S36X 4YO0B 4P0DA 3O4LA 5EZOL 3WV0A 3FQXA 1NL0L 4FXLA 5K93A 3GSOA 5C0JB 4M5ZL 3IFLL 5JNYB 3H9SE 4CU6A 1MCDA 3VGBA 2Q76B 1JHLH 3L9RB 4I5BA 4LCCB 4JM2B 1RZ8B 2L0DA 5FYJL 3INUH 3ZTNL 3ESUF 4TTGA 2C3WA 5A2FA 1A6AA 3H7LA 4ZUWA 4KTDH 4JN2A 1P84K 2IC2A 4NO3A 5E94A 1IGJA 25C8H 5IF0B 1GAFL 1W0WA 2EZ0D 3BW9A 3VFOB 5IROA 2NTFA 2R69H 1Q9OA 2AXJA 3K4ZA 5F70A 5E8PB 1UM6H 3IFNH 4M1CC 3P0YH 2FGWH 2BNRB 4NWUL 1A1OB 1V7NH 4WENB 4EN3D 1E4KA 1T03H 5I8OL 3TT3H 1TCRA 3HFMH 5B3JE 3RI5K 2X41A 4CVZA 5E1AA 4XP4H 4IRJC 5C08E 3OKOA 2BK8A 1NCCH 4JZJC 1RQ5A 4DKEH 4WFFE 4NN7B 5DRWB 1FORL 3ABZA 5D2LB 5F1SA 4JCLA 3KPSD 1MUJB 2ZCLH 3BFOA 2GUOA 4PS4H 4BQBA 3OTTA 3MGOA 4KK5C 4LKCA 3D39E 4NPYA 2UYLA 3I6KB 4Z7WF 2G2RA 4DFIA 2AK4E 1U95B 3CSGA 4M7KL 3QDGD 3GK8H 1NMBL 2IANE 4NCC2 4HUWA 5DRNB 3ARXA 3AM8A 4EOWH 1RK1A 3FB8B 3I75B 4ZFOL 1BAFL 5I1AB 4I13B 3X11B 3ARDB 4Y4KA 3EJYD 3LZFL 1IT9H 1D5ZA 4QRRE 1I1CA 3GJFK 1DBAH 1MQKH 1YEGL 4ZAKC 2J5LC 2FWOA 4B53A 3CC5B 1J12A 3MACL 4KRNA 3ARTA 4M48H 1EGJL 5EOCJ 1WAAF 3NTCH 1VFOA 1ES0A 1YEFL 4QHLA 4ZUSB 3BJ91 4FQJL 1KTDA 1KCUL 1QBML 2I5YL 4Y5YC 3S5LA 3GNMH 4XPFL 5BOPA 2P5EE 1G0DA 2DI7A 1IBGH 5CJ5A 3NFNB 5CGYC 3TBSA 4RISH 2WSKA 4XC1L 1G6RB 4OCSL 3LSOA 4AG4H 4UU9B 2WBWB 1JV5A 1WBXB 5HPMB 4NBZB 1VA9A 5TH2A 3NIFF 4FQXD 5JW4R 2ZOKA 32C2B 4QT5B 2Z31A 4YXHL 2B20A 1QSFD