1HQRB

Crystal structure of a superantigen bound to the high-affinity, zinc-dependent site on mhc class ii
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
189
structure length
180
Chain Sequence
DTRPRFLQQDKYECHFFNGTERVRFLHRDIYNQEEDLRFDSDVGEYRAVTELGRPDAEYWNSQKDFLEDRRAAVDTYCRHNYGVGESFTVQRRVEPKVTVYPAHNLLVCSVNGFYPGSIEVRWFRNSQEEKAGVVSTGLIQNGDWTFQTLVMLETVPREVYTCQVEHPSVTSPLTVEWRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a superantigen bound to the high-affinity, zinc-dependent site on MHC class II.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords HLA-DR ALPHA CHAIN
total genus 34
structure length 180
sequence length 189
ec nomenclature
pdb deposition date 2000-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1hqrB02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 1hqrB01
4HMCA 4NZUL 4MA7H 1FL6B 2BRQA 4RISL 3VXRA 1P7QB 1WBXA 3VJ6B 3PWUA 5J12B 3T0AA 2BVQB 3IU3A 4Z7VE 1PDKA 3AS2A 3S96B 1UWXK 1OF2B 4G5ZH 1PG7X 5E00A 1I8LC 4PRHB 4JHWL 5F6HI 3IDNB 4J23A 5A16A 2FIKA 5LKNA 4MD0A 4G80B 3JWNC 3DARA 1X7QA 4HPYH 2A9NL 3RVVD 5E08L 4OQ1A 4ZTPH 2FWOB 1ZVHA 3IDUA 3C2AL 1FZOB 3TZVC 3V8CA 1MCHA 1HNFA 5GPRA 4XWGL 3SGKC 1S9VB 2CSPA 5EC1B 3OAZH 3TM6A 4PJ5E 5FUOL 5D70H 3UMTA 3BDXA 3ES6B 2UVFA 3P73B 2E7BA 1F11A 4LVEA 1FIEA 3LRSA 1INQB 4HIHB 4QXUH 1ZSDA 5AYQA 4X98B 5I2IB 3U30C 1UCBL 4RAVB 2ZP0T 1YY8B 5A2IH 1A14H 1Q9KB 3RWJB 3DGGA 1SJEB 4S1QL 4OGYH 1N5AB 3PL6A 4LIQH 1CD8A 4TTDD 4N8VA 2WNGA 1H3VA 2AXHA 5GHWH 4G6AD 4G6FD 1QSEB 3Q5YA 4OF6A 1MCFA 3DO3A 1CE6B 1LNUB 2W0LA 4ODHH 1C5CL 5ICXB 1A6PA 1QFOA 1T1ZB 2EDJA 4AK1A 3LEYH 1G7PA 3LV3A 3O3DA 2X4SA 4HT1L 3KLHC 2HTKC 4MNHB 4OGZA 2AK4B 3R8BB 4KDWA 3QWRD 4KPHL 4DZ8A 3VXUD 4A6YH 4L4VA 4WHYG 1EV2E 2KZWA 4D9LL 4M6OH 1RULL 3OB0K 1SQ2N 1E6OH 1S5HA 2J8HA 2NW3B 2YWYA 5SWZE 2YRZA 1HEZA 2ESVE 4NYLA 4V1DE 1IRAY 3C5SB 1JN6B 5JO5A 4XNMB 4J4PA 3RVUC 1HYSD 3GZKA 5DUBB 4WI6A 1RURL 5FB8A 5CD3A 4LP4A 5GGUB 2AV1B 4HBCH 4OGXL 2X4OA 2R1YB 5CJXC 4MXWH 2FEDD 5ISZD 4KZEH 5CJOH 5IW6A 4J3VA 1ZK9A 4JFDE 5GIRB 4XP1L 5K33A 3N1GC 3S6CA 1T04A 1FFRA 3M45A 3PQYD 3EYSL 3TH2T 3EDEA 1GGYA 3U1SL 1RVFH 1BF2A 2AK1L 1CIUA 3ULUH 5EDXA 4GQ9L 1BREA 4KKAD 5EN2A 4F37F 3TO4B 2DKMA 3VWKC 3C08H 4ZAKB 3IDMB 1S5IL 3QXAA 5FYLD 5C09D 4YHLH 4U6VH 2VUOA 5KSVB 5IP4A 4RCAA 5GHWL 3BN3B 1KIPA 4HIJB 4X6DB 3RX5A 2BSED 1A3RL 3MRRA 3BD4A 4XH2B 4L3EB 3CLEL 2VL5B 4P9HC 3SJVD 5F44A 3S88L 2Z0BA 2EYTB 4MVBD 1CLYH 3B4NA 3IXTA 5FA4B 5KN5B 5HTSA 2V6HA 3BGMB 5E6IA 5GGTA 5IB4A 5ACMA 5DQDL 3V4UH 4QRQB 2NY5C 5BMFH 2Y5TB 4WEBL 1LP9B 2Z35A 1QD0A 5IJKA 3T0ED 1LE9A 3HZYB 4M43H 3VI4F 3NABH 3U7YH 5ESAA 3BEVB 3CFBB 1T7WA 3O3BB 2VXVL 2OI9C 5CEYB 2FATH 2E6QA 4XTRC 4Z7OE 1KCRL 5IVXE 1KC5H 1DQQB 3FHAA 4XP4H 1X7QB 4M8VA 3VFOB 5KSBB 4S10A 4L9DA 4PP2B 5I1GH 1HKFA 1QUNA 2MWCA 1P2CA 2LU4A 2IANB 4K3DH 3EGSB 2CQVA 3IFLL 4UOW0 2YD4A 4FQXD 4NPYA 2CKBA 3I6GB 5I75B 5EULV 3G04B 4Y2DD 5E8NB 4LSQL 3O2DA 4H8WL 2Y7QB 3MRCA 4G8EA 5DRNA 1I1AA 3P30H 3MUZ1 1BIIB 1M7IA 5IOPA 4K94C 3ZE0E 2GJ6B 5BS0D 1M7DB 4DEPB 4NNXB 1F2QA 2H9GB 1MPAL 1JPST 3NFNA 1FL3A 5DHVH 2O5ZL 3LKPB 3B43A 3V5HA 1CS6A 2ZUYA 5JPMB 1JF5A 1G9MH 4JFFD 1NFIB 2Q76B 3MRMB 2X1XR 1ED3A 2EDBA 2FX8H 4XVUC 4ZO9A 3JTSA 1IKFH 5I30L 4U0RB 4HLZH 3VFPA 5CGYC 4ZUUB 5C08E 4JN1L 2V7HA 4ZUTA 4UQ3A 4ELME 4EI5B 3CVIH 3IDXL 3MV8A 5DD6A 2ZZUT 2OJZL 1EZVX 3K4ZA 4JCMA 4NKIL 1PFCA 1DQJB 3BZ4A 1CN4A 3SDCD 5J13B 1CL7L 3ESUF 3REWB 4YIQA 3UPRA 3G6JE 5ECJE 1F58L 1G9EA 4RNRA 4NJ9H 4MQTB 3CPLB 2X1OA 1VEPA 4LL9A 3REVA 1F02I 1IFHL 4GW4B 3PABB 1FNAA 2VE6B 5CZVH 4Z0BH 4R97B 1MWAA 4NBZB 2BSTB 1K4DA 5C0NC 3UYOD 4NOBA 4F57L 3IAPA 3HFMH 3NCCB 5BMFL 3BPCB 4PTTA 4LLAA 2P48B 2BXZA 3GJFA 3BHBA 4HUKB 4WI3A 5D2NA 5GGSB 2GTZB 4R90H 3LB6D 2BY3A 2DQEH 4ODSL 4XCEA 4HKBA 3IFPA 2EC9T 1YJDC 2QLVB 2J4WH 2B1HL 4NHUA 4N0UE 2R1XA 4PJHB 5FOBA 1QNZH 5GJTH 1H3PH 1WBZA 2Z91B 5DR5L 1PLGL 1F3JB 1T20B 2VDPL 1KNOA 3KPRA 2R9HD 3DI2B 1T03H 1VACB 4MAYC 4HX1B 2GTWB 2P47B 4GRLA 1JWUA 2XZCL 1JPTL 2JIXD 1OSPH 4HKZA 4MXVF 4XC1L 1TQCB 2P42B 1CICC 1LQSR 1MCRA 1UWEL 5ERWB 5D1XA 4P3DB 3UTQB 1AKJD 4M3KB 2EDFA 1MFNA 2APXA 1P7QD 5J1AB 2VDMH 3BH9A 3MXVL 1YN6B 3ARFD 5DDHA 5LXGL 1U8HA 4LCYA 1U0QA 1WFNA 2XZQH 3EJZD 1RD6A 2VABB 5DYOA 5TGBB 1FN4A 2AQ3A 4I2XB 1I3GH 4OF0A 4PJAA 4YBHA 3ELAT 4O02H 4TSCH 1FVDA 1AO7B 5E5MA 4PJ7F 5F3HA 5F7NC 5T1LB 3GMLA 4U3CA 1KLUB 3G5ZA 4G6KH 4PYGA 1QO3B 2P8LB 3H0TB 1KOAA 5CIPB 3ZSSA 4OCWL 1DEDA 3IGAB 4XCFH 1OGTA 5ENWA 5T3XD 3WS3A 2A6DA 4XPBL 1BQHA 2W91A 3C8DA 5HYFA 4YHML 1BVLB 4MQXD 4KUCD 2F9BT 1XF2A 1JPSL 4UNTA 5IMKA 5HYJE 1NCUA 1QPXA 5C0RL 1IMHC 5E4EC 2XTJC 4YX2H 4HPOL 4ZTPL 5TJWK 3DO7B 4OKVB 3VDCA 5JMOC 4Y5VA 5H35A 1Z9MA 3VFRA 4AEEA 4XXDA 3ARSA 4I4WB 1VERA 2O61A 1MFBL 4NUGH 1DLFH 4GAJH 4M7ZB 1J8KA 1Q9WB 5E24E 4G80A 4O4YH 1MLBB 3VXSB 1DJSA 3HZKB 4FXLA 3FN0L 1TJHH 4ISVA 4N8CH 5LBSH 3HMWH 4YDKH 2Z92A 4N5EC 4KVNL 1QFWI 2V7NB 1XGUA 1HIMH 1TZHA 1K5NB 3KDMA 4YDVA 3IETA 2BVQA 3IU3B 5JUEH 1HHJB 1S7UA 3EFDH 1F2XK 1SJHB 5AUMA 5TPWH 5IHZA 5TDNB 2H9GA 3ZDXE 4PJEE 4LDLB 1DN0A 4PPTA 4HJGB 2DM2A 3P73A 3DRQA 2D7OA 3Q0HA 5DRXA 2F5BH 4KTDL 3RI5K 5I76B 3ZTJG 2F54B 1PGRB 1MHHB 1CFVL 4MXQC 1HKLL 4OCYH 4KAQH 5FM5O 5IMLB 3UYRH 1YMME 3NZHL 1DQDH 1FZMA 2D7TL 4ODVL 3BGMA 3VCLB 4JDZB 3RBSA 2HYMA 3IKCB 4FQJL 3PDGA 5CWSB 4MQSB 2IPTH 2GFBA 5C6PB 4MS8C 4NN6B 4YHKL 2A77H 4JANA 5E2WH 4LFHG 3UAJD 2HFEA 3UPCA 4J6RH 4U1GC 1Z9SA 4BZ2L 3K2UH 5K59F 3WLBB 3QHZH 3MNZB 3VJ6A 1VCAA 3PHOB 5DR5H 3REVB 1RULH 3RA7L 3EO0B 1E6OL 5HHNA 3L7FB 3QNXA 2R4SL 3QUYB 3T3PE 1HN1A 4OCWH 1KACB 1RUKL 4U2ZA 3VGAC 4LP5A 5F7FA 3R0MA 3AB0C 5ICYA 3T8XB 2DQUH 2B1AH 5LWYL 1Q0YH 1S9YA 2VXSL 2H32A 4NQCD 4EQ3A 3CFKA 3C6LC 5E4IA 4PV9A 1R3HB 2NNAB 4BSJA 2BJML 3VGBA 4DQOH 1RZJL 3BDBA 3E6FA 4W6YB 1CDYA 4KGLA 2R1XB 4PJHA 1AC6A 3ES6A 5AZEH 3SCMC 5BOPA 2FJHB 4HIEA 5KSBE 1BM3H 1U8QA 5D96B 1GZPA 3HZMB 1BGXL 2GITA 1F4XL 4PP1C 2ZUQC 3BMVA 3L3KB 4J8RA 5BS0E 5TE6L 3P9WB 4R97C 1T66D 2BOCB 2BC4A 3QIUB 3HC0B 4I0PC 1YY8A 5DFTA 15C8H 3RNKA 2ESVA 4V1DA 4ZFGH 1P4BH 1RZJC 3U4BH 1HEZB 4CDGC 1FRGL 2NZIA 4XRCB 3S9DB 2FJFA 1SMAA 4HUVA 1MCQA 5ETUA 4OKDA 1U3HB 3DX9B 4EVNA 5I0ZA 2X1PA 5J1AA 4U6HB 4YHLL 3BAEL 5D1QA 1B4RA 4MXVE 4NQCA 2H45A 3A6CL 2A83B 1A6WH 2Z93B 1GVIA 1EERB 4TYUA 3WLWD 5DJXA 4KUZL 2NY2C 5AD0A 2E9JA 3N9GH 4YX2L 4JZNA 3GSUB 5KVMC 4HPYL 1Z3GH 3FB6B 2X4SB 4UNVA 1RMFL 5I1HL 3DYMA 3KPRE 3VGGA 3EO1B 4DWHA 2IAND 5FYJD 1OHQA 1ZHLA 4AENA 3FCTA 2A6DB 5KSUA 3O6KH 2X4UA 2W38A 4XP9H 5F89B 3CH1B 4PG2A 5D7LB 3ARBC 4YHNA 4LCWE 1D6EA 3U0PB 1MFCL 1HYSC 4BZ2H 4S0SD 4IOSD 3S36H 1WEJH 4IRSB 4WW1B 5E6IB 5L8LB 3MRBA 5IJVA 2YKLL 1AI1H 1OAYL 5E4EB 3HE6C 5ELIA 4PG2C 3LKPA 1AIFA 1RIVL 2DWDB 5LGJB 5B4MC 2H6PA 2AJYH 3OKLA 1DE4A 2AEPH 2OK0H 5KG9A 4HXBL 3MJGX 1NGYA 1SY6H 5JW5A 3K81A 2N4IA 1B2WL 4KTYA 4E41A 1UH2A 3PDDA 3OAYK 3BIAX 3QRFM 5FF6A 1GXEA 4QY8B 3QQ3B 1P7KA 4M1DH 1TZGL 1UJ3C 3VXSA 4OZGE 3D3VA 5CAYB 4C55A 1CLOH 1HCVA 5DFWH 5D7LD 4HV8B 3KLHD 3PIQB 2IANA 2HKFL 4LSVL 3LEVH 5GISH 5J6GA 3EFFB 1YEIH 2YC1B 4M8QB 1MHPH 5SWQB 5IT2H 1T1ZA 4Y88A 1MNUH 5EBMA 5F9WB 4WO4A 3GEWB 1EEZB 4HBCL 5KS9A 4LARL 3S96A 5JNYB 1HWGB 4XWOD 5IV2A 3BXNA 1LVEA 5FHBH 4O2FB 1CVRA 4R7NB 1FV1B 1DVFD 3SDAB 2CRMA 3WDIA 2ITCA 4L9LA 3V5HB 4FQPA 4OD2B 3EUUA 1BJMA 2NZ9D 5JXAH 5FA3B 2OTPA 2UYLB 5DQJB 3RWFB 4AEIH 3TA3B 5IVXB 3QI9C 2IAMC 3VRIB 5I75C 3EJJX 3ULUE 4UU9B 4NKOA 4D94A 1AFVH 5D72H 2F5AH 6CGTA 5IB3A 5T1KB 4HCRA 1U42A 1KYOK 4JE4B 1E27B 2AJSH 1WITA 4NZRL 1JN6A 4TRPH 3U4AA 3ZO0A 5KVDH 3O3EB 4U7MA 4P2RD 3LKQB 4PRHD 3GHBL 4G3YL 1HZHL 4XP5H 1U8KB 3QA3A 4IS6A 1DVFC 2BY0A 3DVGA 2DBJA 4OUUA 5E8PB 4UT6L 2I60H 2YK1H 4WUKH 3RVVC 2VDRH 5KAQG 3QHTC 5L2KB 3ZYJA 3NOIA 2BMKA 3ZDYE 4F15B 1WEJL 3ZTNH 4OQTA 5MP6H 4NWUL 3HA0A 1A6ZB 4E41D 3QDJA 5ESQB 3MA7B 3QPXH 4Z7WA 1BZ7B 1UJTA 3NN8A 4DN3L 5B39A 2MKWA 5D2LB 3D48R 1J87A 5H37H 5HI5D 3TFKC 1UACL 2Q86B 8FABB 4YWGH 1XF1A 4ODWA 4X6EA 1R3IH 5F1IA 3ALXA 1KFAL 1D5IL 3MV7E 1U8PA 3OKNB 5C0BB 3TO4C 3WFZA 1QSED 3BPNC 3X3FL 3BSZL 3U83A 4PJXF 3O2WH 4IM8A 4NQTA 5J4MA 5CWSA 3D39D 3IFLH 5HSFA 2DYPB 1SJVA 5T3XL 1DTUA 1NMCB 1XEDA 4IDLA 4XX1G 1MAJA 1I8MA 4WIQA 3LN5A 2AS5M 4P3CL 4AEHH 4TUKH 5C1MB 1BJ1H 4AQ1B 1IAIH 5BS0A 2NXZD 2R69L 1B0GA 1F13A 4QHMA 1N59B 2G9HB 2XKNB 3FHQA 1CF8L 1FN4B 1JGLH 1IGTB 2HFTA 3CSBA 1FH5H 3VH8B 2WQRA 35C8H 4RBPK 1XGTB 5CMAB 3OF6A 3QUMB 5CIPA 4NZRH 1A3LL 2QEJA 3B5HA 4I48A 4XVJL 4ODUA 1EMTH 2OL3A 1Y0LA 3B9KA 1AE6L 2NY4C 3SOBH 1FNGB 3DIFB 1BEYL 1X5HA 3OR6A 3U4EA 4P48A 1YNTB 2GITB 4PBVC 3TIEB 3LKNB 4XPGL 3WYRA 5I76A 3GI8L 5CZXC 3VXMB 2HFGL 2QSCL 1OCWL 5KSVA 3MRQB 1P7HL 3EW3B 5HVHC 4S1DD 2R23A 5KTEH 1KCVL 4L8DB 4AQOA 4IHOA 1INDL 5J12C 2BNRD 5GRJH 3RX7A 4Y7MA 1JTTA 5J6GB 4HW6A 4F33B 3HTLX 4M8QA 5DSCA 3B6SB 4M00A 4KUCF 1QFPA 4YWGL 3EO0A 4N0UB 4XPTH 2CIKA 1H0DB 2V2XB 3PGCA 5F1NA 4YPGB 1U93B 4MLIA 4Q6YA 3E3QC 1NCDH 5CUSH 2OTWA 5TF0A 5CBAA 4GKSB 5E7FA 3SPVA 1UWEH 3MLTB 3ZTNL 1N5YH 5BW7A 5D1XD 1JGVL 4GRMA 1ZAGA 4OUOA 1XZ0A 2VDQH 3T0EB 4ONGL 4HC1H 4OV5B 4H1LH 1XCTB 5DUMH 3C60D 3OF6D 3PWJA 3J7HA 1GZPB 2GJJA 4GRWF 4YLQT 4JRXE 1UVQB 2HWZL 3RWDB 5IQ7L 1CYGA 1JRHH 1GHFH 2EDHA 4YFDB 1FZJB 1FL3B 1ADQL 1J1OH 3MMEA 3KYKH 4P5TB 5INDA 1V5JA 2RJMA 1BMGA 3RWHA 3QG6A 2OS7A 3FFCB 4X4MA 5IMMB 1CG9B 4EOWL 1IM9D 3TGXA 2X05A 1U2CA 5I1CL 2AI0H 4GMSH 2UZYB 1P9MA 4JFYA 2Y36H 1U92A 3EZJB 4Z78B 4YGAB 3TBYB 4J3UA 3TJEL 5D7IB 4UNUA 1P84J 3GFUA 2ITDA 2F53B 3MXWL 1UKSA 1PX4A 1WGOA 1JI2A 1X9QA 3EZ8A 3MUJA 4P23B 5D7IE 5H2BB 3KHQA 5C0RH 4RFOH 3IF1B 5D7JA 1A14L 15C8L 2G60L 3BZEB 4XVTL 3IDIB 1CE1L 4J12A 2FGWL 3JSSA 2KPNA 5CS7A 4HLJA 1OW0A 4DN4L 3D2UD 3ETBF 4MA8L 3FFCD 5I71C 4UIMB 4OZIF 1F45A 3ULVD 5EWIL 4JFED 4JFZL 3AS0A 5E6YA 2Q8AL 3EO9H 3L5JA 2AABH 3S97C 3BHBB 1A1NB 3HS0B 4X4YA 3MX0A 4RGND 3BT2H 2J88L 3BKJH 2H3NA 3BPOC 4YAQB 3DUUB 1E4KC 4BZ1L 1GAFL 1JGEB 3SE9H 1Q9LA 1S3KL 1XCQA 4DEPC 4GW5A 3WLBA 3AMLA 2BSRA 3OKMA 5A2FA 4K3JL 2F54E 3FN0H 4N8CL 3F65A 4FA8A 1MFCH 3HZVA 4YBQC 1NBZB 2ORBL 5J89A 4LSTH 1IT9H 3D2UB 1UXSB 4WNQB 3VDAA 3RJQB 1G7LB 1FSKB 1LDPL 2IPUG 4XNUL 4RWHA 5TPWL 2P7TB 4KRNA 2K1MA 3CNKA 1Y18A 3DWTA 5HHMB 4HSQA 5K9KA 2WV3A 5HHME 4BFIA 1B88A 3BRFA 1UKQA 1KG0B 1ZHKB 3O4LD 4PR5B 3W39B 3MNVB 4KAQL 1FLTX 1DN0B 1VHPA 4KPHH 4QRRD 1FL5A 4I0KA 1DE4B 2ED8A 3ARTA 3OKLB 4JQVC 3VFSA 3JTTA 5DD3L 4Q6IC 2BC4B 4HDIB 2QKIB 4FQCL 4G9FA 1C16A 4AMKL 2UY6A 3O8XB 4P5MA 4ZUSB 3WUWA 1A47A 1S7RB 4BQ9A 3W11D 2Y6SD 3SDDA 4F7EA 4BH7B 4KH2A 1HH9B 4LLWA 5HY9A 3RTQB 2KKQA 1IM3A 5LVEA 2YPLA 4UV4H 3WCYA 4ZSOB 1CE1H 5D1ZD 1JI1A 1FC2D 4R4FH 5E8OA 2V2XA 3PGCB 2E5EA 4OIBA 5IHLB 4F7TA 1KCUH 2UZIH 5E8PA 5F9OH 2BXYA 1Z2KA 3DETD 3OAZK 1PKQE 1QACA 5H35B 5L9DH 1NUGA 4X9IA 3VXUA 5DEZA 5L2KD 5EUKB 3C8KA 1RJYB 1D5MB 1NFDE 3F58L 3EFFA 5GGRY 1R5IB 3ULVF 5TE7L 4OI8A 1CIDA 3M17B 3N85H 2YN3A 5MEND 4ETYA 3NABL 1OOAA 3MRIB 3ROOB 5AZEL 2AK4D 1XCTA 4WI8A 4N9OB 5I8EA 4XBEL 3TIEA 3MZTA 2IEPA 2OQJA 4LOUC 2IMNA 4JY4A 1OM3L 1NDMB 1D9KA 1JVKA 1V7ML 3C6SA 5EZLA 1P69B 5FA3A 4LRNH 4F9PC 5EOTA 7FABL 3A6OA 1A3RH 5D71H 2OTUA 1NFDA 4ONHA 1HSBB 3DVFA 1X5GA 1N3NA 1KELL 4LU5L 1PX3A 3STZA 5JIHA 2X40A 4QXGH 2APBA 4XGZB 4I8DA 4A6YL 4HF5H 3N1PC 4RWYL 4XAWL 4ZS6C 4NQEE 5JW4Q 3SBWA 4FQXA 4P57B 4NSKB 4OIAA 5HYEA 4L8CB 3NIDF 4FQLH 2UZXB 5EB9A 1SYSA 4PRHA 1AR2A 2NY0C 3P4MA 4OD3H 1CFNB 1NUFA 2ZKHH 1NC2D 1N6UA 2SEBB 4WFHD 4NM4L 4OAWB 3ULSB 2WZPD 5D7IF 3TZVB 1BQLL 4OCRL 4U1JA 4Q9BA 4RDQF 5B8CB 5J6HB 4KJYA 1XGYH 4HH8A 1WT5C 4DVBA 3QXUA 4KK9D 3RPIA 3UJIH 5ITBH 2AJ3A 4UT7L 3QXWA 4QHUA 4IRSA 5DFVC 3RDTD 3UEZA 4HUWB 2YR3A 3OTTA 3EOTL 3LAFA 2H32H 2Y72A 3SGDH 5I66B 4L1DA 3RZCD 3OX8A 3ULUL 4PJXE 4GH7B 2G9HA 2XKNA 1QA9A 3MBXL 1IE5A 2A9MH 3IJHB 1IEBB 3V6ZB 1IGTA 1PVHA 4K2UL 2BVPA 4LSVH 5E2VL 1IGML 2AJXH 2R0LL 3G6AA 3CDCA 3TBTA 1I8MB 1LP9F 1T1XA 2DQIH 5AZ2L 4EVNB 1UCBH 2R2HB 1QEWA 4HFWA 3ZKMD 1T7YA 2A83A 2DRUA 1HH6A 5CBEA 2N1KA 4HKXA 4IDJL 4NUGL 3CZFA 4JG0H 3BPLB 2AP2A 5IEHB 2EH8L 3GSNL 1ZT4A 4PJ9B 2LU7A 3LKNA 5ISZE 5FO8B 5E9DE 1ZLWH 4XH2A 3QAZC 1KJVB 3MLRH 1FAIL 5KANG 2OCFD 4OT1H 3QDGA 5DJ8B 3LS4H 3L1OH 4G9FB 1F97A 5AAMA 3T2NL 2A6IB 1LE5A 1I8LA 4ZAKC 6FABL 3N85L 3ET9F 3GHEL 1KB9J 4U31A 5D7LA 4ALAL 4BFEA 3QXVA 3QDME 1VGEH 1NAMH 3AREB 1JIBA 3LEXA 3QDMB 2JJWA 1S9KC 4PY8J 3LDBC 3UYPA 5C9KA 3UJJL 3FT3A 2R2EB 1BJ1J 1G9MC 4K7FB 4ONOA 5C3TA 4LBEA 1OM3H 2A6JA 5EU5A 4MQ7A 4XNZC 4XCNA 3MV7B 2VQTA 1JJUA 5HGGS 3QUMH 5ADOL 1CLZH 1F8TH 3DVGB 3MV01 1FP5A 1UXSA 5EBLA 4XNQB 4ZO6A 4WHTA 3B2UC 4UZGA 2X89D 4PGCB 4KHTH 4LF3B 4CL7A 4WHDA 1V3JA 4PJ8C 3FQUB 2P43B 1YQVL 1JRHI 5E2UH 4LKCA 4IIQB 2PCPA 2HRPH 1A4KB 4KHXL 1LWRA 3ZYIA 3LRSB 2J7LA 3DUSA 4XPFL 4H26B 2FYYB 3ZE2F 1IC5L 4Y4HC 3H7LA 4YFLI 4O9HH 3FB5A 2IBGA 5I74B 4GRMB 3CSPA 3W0WE 4XMKH 3CDGA 2NY5H 1DEEB 2XQYK 2B4CL 5FCUL 4PJHF 3V6FA 4OV5A 1J0ZA 2Z4QB 1B4JL 5L88L 3MJ7A 2HH0H 2HMID 2QV2A 4LHUG 1NDGA 2G60H 4G42A 5HHXH 3PDOB 5ALCH 2NY3B 3SO3B 5HHOE 5EO1B 2G75B 4KXZH 4QNPF 3THMH 3VMNA 4GLRH 3OKMB 5DHVA 4JRYD 2F19L 1U95B 2VE6A 1KBGL 4QGYA 1RVFL 2EZ0C 2YUWA 4N8VB 1XIWD 4LIQE 5EUOA 1AY1L 3GHEH 4BH8B 2JE8A 4Y16A 3E2HB 3X14A 4MD5B 4MNQB 5GRJL 4DKFH 5L8KB 5IG7A 3QWQB 1R5WB 3PXHA 5I6XB 5EU7C 1RZKC 4F7PB 2A0LC 4RWYH 5HJ3A 2D4FA 5E95B 4NQEA 4HJ0D 5B39B 1AO7D 1QOKA 4M61A 1BBDH 1CDIA 4E0RB 3W2DL 2AK4E 2VKXA 4DTGH 1EFXD 4BYHA 2R0WH 2QQLL 4BUHA 3OKDA 3STLA 2ZCLH 5E99L 4F2MA 4OT1L 2UWEA 2FO4A 3FQXA 1NEZA 1WSST 3QO0A 4TULH 4L8SC 3F5WA 3D5OF 4ODHL 3PHSA 1UB5A 5JIKA 3VFPB 1XAUA 4FQJH 2R15A 4CN1A 2OLDA 4LNRB 4NO0B 1P6AB 1MFEL 1R5VB 4WNQA 1JE6A 2YPLB 3ZDYF 4X6CE 3X13B 1B0WA 4X80H 4XPTL 3WN5C 4FABH 3UO1H 3HR5B 3UJJH 3TNNA 5D7JC 3TIDB 2FRGP 4NC0B 4NQDD 2QBWA 3RGVD 3SE3C 4Y2DA 3O2DH 3MUGA 4H0HB 2X7LB 4WY7L 3HG1A 3RWIA 4PJEB 4GW4A 3VFOA 3WN5A 4HWEL 5I8OH 1OB1B 1I1AC 3LQZB 2GYSA 4RGMC 5DJ0A 4QHNA 5E9DB 5IFAL 1JPGA 4ONGH 3LKSA 3F6IA 3GI9H 3QUZA 2G5BA 4HS6A 2EYSA 4DZBB 4KKBC 1G9NL 2NR6D 4GBXC 4K3EL 5CLTA 4WW2F 3CXHJ 4PRIE 3B9KB 4ONFH 4Y1AA 5E08H 1RZJH 3WJJA 3EOAA 4HZAA 2DQCL 5J56B 1VFMA 4X7DC 5CEXA 1C7SA 1A8JH 1HHHB 2FL5B 2RFXA 4QOKD 5JXAL 5GS1A 3FO0H 5ESAB 4A2LA 3V8OA 1P6FA 1ZHBB 4S0TD 3WFBH 4P5TC 5EBLB 3FKUS 4YGVB 1CQYA 2MQ3A 1YNKL 5FUZL 4Q74A 4OLVL 1FGVH 4O51A 4OI9A 3MLSH 4JRYA 1O7VA 1U8IA 3AAZB 4NZDA 4XZUA 3HB3D 5GRYA 2R4RH 5KW9H 2V2WA 5IEKA 1HILB 1FHGA 3KR3L 3TBWB 2AV7A 1F4YH 5T5NG 4POZD 3QDHA 1H15A 1EAPB 4U1MB 2E9BA 1T5XA 4K23H 2C5DC 1AP2B 3KPQA 1ZEAH 2HAZA 4OTXH 3MA9L 5TF1H 1M6OA 3MRNB 1YEDB 3QDGB 3EYUL 3RVWD 3MLUL 3UX9B 3C8KB 4OB5L 5DJCB 3C6SB 2A6IA 2ZUVA 4Y19D 1BLNB 4P2OB 1JYWA 1YPZF 2P45B 2VXQL 1EUTA 1J5OH 1EAJA 3ARVA 4XBGB 3K2MC 3SE8H 5KN5A 4R2GD 2GJ6A 4KJPD 3C09B 1YYLL 1LO2H 1A5FL 3GSXB 3SKOA 4CVXB 4L3ED 4HKJA 1FSKC 1TNNA 1QRND 4D3CH 3DVIA 4JM2C 5T3ZD 12E8L 5TDOB 4KI5E 4QHLB 2B4CC 5FB8B 5I1IH 3A6BL 3QSKB 1SEQH 5F7EL 4K3DL 2NY6B 2WP3T 5D1XB 2FD6L 2OZ4A 2DL9A 5JTWA 2WW8A 2IQ9L 3RWHB 4KRPD 3HMXA 3BKMH 4K8RD 3QBTB 2JF1A 3KYMB 1EGJH 3PJSA 1QSFA 3MACL 3PHQA 4P57A 4CGTA 5K9JL 1ORSB 3JV6A 3GHBH 4G3YH 4XP5L 3WS6C 2ZCKH 4M61B 4NZTH 2O5ZH 5T1MA 3O3AB 1MJ8H 4HHAA 3LD8C 5I8OL 5DC4B 2VZVA 2HN7B 4JVPA 5EIIB 3VXME 4YK4C 4G9FD 1AH1A 2GIYA 1ORQB 2GSGA 3HI1B 2L7JA 1G7HB 3GI9L 4WWKD 3RPKA 1WQVT 5JIPA 5C71A 4UIMA 3QXDB 4ZO8A 3TP4A 3FO2A 3L7EA 1BVZA 3GJEB 4PY7B 1CD1B 3QXTA 3RIAF 4MB5A 4R4FL 2PTTB 4X5WB 1FNSH 4D9QD 1UEYA 4RGOL 1VENA 4KKLD 4XBPA 3F7YB 1ZVSA 5F9OL 4P49A 4U1NA 3RJDA 5E03A 3L5HA 3ZSTA 3TO2B 4ZYKA 1AXIB 3JWOC 3BZ4B 3WN5B 4GRLB 3SDXE 4PJGE 4L8CA 1QBMH 3O0RH 2IADA 2VN4A 4JO4L 2A1WH 5AYUL 3QIWB 2YK1L 1QVOA 4M7ZC 4WUKL 2C7UB 3T2OA 1KV3A 1N4XL 1WT5A 1YN7A 3NIFF 3WXVL 1NEUA 3HR6A 1QYGL 2DLFL 3MLXH 4PJXB 4TULL 1CGXA 2DQEL 2HFFA 1M71A 4NWUH 1Z6JT 3E0GA 3L9RB 1RUPH 2BVTA 4EI6B 3LS5H 3QH3A 1U8OB 1JK8B 5IHBA 5J6HA 4YFEA 1J11A 1YC8A 3KPSE 5HXMA 2FO1A 2PCPB 3CZFB 4X5XA 2OYPA 1U8QB 4UMGA 4KC3B 5FGBA 2ZG1A 1QSFE 2VLRB 2WBWB 4WI4A 4I2XE 5DK2B 3RHWF 2HT2D 3I50H 5C0FA 1LD9B 2HT3C 1X5KA 2W9EH 1HINH 5F7DA 3DX7A 4LVNB 1MOEA 4I0PB 3EDFA 4X4ME 2QADC 3NGBB 5IGXH 3STBA 3WS3B 4Z18A 4AYFA 4HCRL 3G9AB 3X12A 1DBAL 1FIGL 1OARL 4HFUH 4OCXL 3J8F7 3GMRB 1FYTB 4JFDD 4Y1AE 4KVCH 1U8JA 2XQBH 4IRSD 1NCWL 5IBLC 2GCYB 2GQHA 1UEMA 4XGZA 4TUOA 4Y8DC 1CGSH 1BD2E 4PRPD 3GDBA 2CGRH 3QUYA 1DL7L 3QFJE 5JHDD 1YPZA 1G6RA 4Z7NE 2O61B 4XC3L 4HIXL 4N0YH 3WEXA 3C5ZB 4L3CB 4PTUA 3KPMA 1TQCC 4HXAH 4OZHB 1FLRH 4QXTA 1NH6A 4PV8A 1J10A 2YPKB 5GGQL 5GJSL 4JRWA 5T1LA 3W9EB 5GSVA 5FECA 1OQXA 3D3VD 4X8XA 5ADPH 4BUGA 5CD5C 3BKCH 1GJIA 4XBGA 2E7MA 4C54A 2X89A 4MCZB 3V4VH 4HAGA 3VCLA 4P9ML 1DBKL 3EOAB 3G04A 4LLMA 3FRUA 4IOFC 4JKKA 1F00I 4J3XA 4QLRA 2R56L 3ROOA 4NZTL 2V5SA 4RFEB 4HIEB 3DRQB 3V5KA 1OGAB 1IGYB 4M6NL 1OWRM 1OTUC 1BAFL 2F54A 5IF0A 5FM5M 2CUIA 3IDJB 3GNMH 5BZWA 4XB8A 2OP4H 5EU5B 3HI6H 3IS1X 2B7DT 2YD3A 3MLRL 5KSAC 1MHCB 4JZJC 4U7SA 3FB8A 3UZEA 1U8NA 4XZUB 4FZEL 4U6HA 4C59B 1VADA 4ALAH 4WHTB 1I7ZA 4UT9H 5DO2D 3HZKA 2HFEB 1BVKB 3T4AA 3QFDA 1CDCA 2DLGA 1TVBB 4NCC2 3QO1A 4MZ3A 1UENA 5B38A 4JPVL 1FFPA 1RZFL 4LHUD 3NPSB 2IH1A 3NA9H 4IIQA 5EUOE 1R3JA 2HLFD 1MIMH 4ODWB 4X6EB 4MB4A 4JM2A 5CJBA 1H3WM 4L9LB 4AZ8A 4JFXA 4P2RA 4PRPA 5IVXA 5LAXA 4NJAL 1TTUA 1K4DB 4WCYL 4YHNB 3RUGB 4OFYA 2FR4B 5JHLH 5IMLA 1R3HA 1OP5H 2X4PA 1T2QL 3GK8L 5HJ3B 1T5WB 4PRID 3T3MF 3ABZA 5JPNA 2HJFB 4TSAH 2B5IC 4I3SL 4P4KA 1QLRA 4GS7C 2YXMA 2EYRB 3P77B 3RKDD 4HIXH 1SVCP 4QYOB 3NTCL 3MOBL 1JGDA 4C4KT 1ZS8B 3AMKA 5DD3H 2IG2H 5CEZL 3RTQC 1VPOL 2AGJH 2APFA 1PKQA 4KKCD 4GOSA 4EXPX 2P4AB 4M93C 5IK3B 5MEQB 3QO0B 5SWZD 2E27L 3QNXB 1TDQA 4JQIL 5F7KC 4EOWH 1OAZH 3DVNB 4KVCL 3VXOA 5ERWA 4YXHL 4KRMB 3GSVB 4YXKL 3NFSH 5DJ6B 5IHUL 1FGNL 3S3PA 1KF9B 2WUBH 3I75B 1MHEB 1KPUB 3SJVB 1PQZB 1I8KB 1A6UH 3NIFE 4EIZC 5JMRA 3QRGL 1IKFL 3H7BA 1HXMB 4MAUL 1UKTA 3QCUH 2ENSA 2PO6C 3EO1A 3WMSA 2A1WL 1F90H 1JYXA 1ZHLB 1FRGH 2GSGB 2OX5A 3EFDL 3VFUB 2R2BA 5F93C 4H26A 1KJVA 2VLKB 5HGDB 1FC1A 2HA1A 1KLUA 2FH8A 2RIKA 3G5ZB 3VE0B 5ADPL 4G8GD 1IC7L 4JO1H 2JB6A 3QG7L 2D7NA 4X7SH 1J86A 1RJLB 3PWVA 3HC4H 3UJTL 5JQ6L 4LK4A 3A6CH 1CFQB 1W0WB 4DKAA 3CFEA 1RZIA 1IM9A 5ETUB 1KXQE 4PBWD 2YHGA 1SBSL 4LAQL 5EO0B 5I18H 3RGVA 4F57H 4N0UA 2CDFB 4ZXBD 2ICWJ 3MYZA 4JHBA 1I7RB 1C5CH 3IJYA 3MRGA 3ZKQD 3FMGL 1EO7A 5FYKE 2P5EA 5EBMB 5FEBA 3Q6GL 4DGIH 5TE4H 3PHOA 3UTSE 4GT7A 1D3CA 4EUPB 1JZ2A 4HWZA 3DX6B 4L29A 4PG9B 4OZHE 2DQGH 4NGHH 3MCLL 3UP1A 1QR1A 4PGEA 3KNBA 1A02N 2E9IA 4AEHL 1ZV5A 3MRJB 1SYVB 1N6QL 3VI3F 3D87B 3VU2A 1X5IA 5EC1A 4WI5A 1T03L 1OTTD 3ULUF 1G7MA 5C07A 1AQKL 1R5WA 1N64L 3DBXA 1XGRB 1UZ8A 5A2JH 3AFLA 4HK0A 3JV0A 4H25B 5C0BA 1P5VA 4MSWB 3LHPH 2GT9B 4FFVD 2C4XA 2YD2A 3O6FC 1BLNA 4NN7C 4U1SA 3WKMH 1I7UB 3A0OA 4YXHH 4YXKH 4ACPA 2VDNH 1ZHBA 2P24B 2GJ6D 1JHKL 2NMSA 4APQC 3S5LG 4MA3B 4N1CA 5D9SB 4FQ1H 1NPUA 2BNQE 1YEJH 1D5ZA 4ZFGL 3TO2A 5JDJA 3S98A 1W2KT 3EYSH 1WWBX 5F7LB 2V5YA 3F7QA 5I17B 4ZUVA 5C07D 4RGMB 3GMQA 3JBG7 5IVNA 2A6KB 3OKEA 4R96B 5C0IA 1LILA 1NBQA 4M6AA 2E7LA 3WFCH 4BZYA 2F5AL 5DJ0B 5E9DA 1Q94A 5D96C 1YMMD 4PS4H 1BFOB 1HWHB 3RIFF 1WV7T 3NIGE 5B3JF 5IHUH 1CFBA 2X5PA 3JWOH 1LO3L 4R8WH 4NKOB 5T1MB 4X9GA 1ZT7B 1NANH 2V17H 4RAUA 4CN4A 1IZJA 1RZFH 1CWVA 3ARDD 3UYRL 4LEXL 1KPRA 5INDB 4UV7L 1GGBH 3RUGF 4NKMA 3ARRA 3UTZA 5JUEL 5I1EH 5JORB 4JDTL 4KK6C 1ITCA 3RNKB 5J3HC 5A1AA 1DDHA 1NEZB 1D9KD 5L2KA 3BE1L 5T33L 4U1GB 1MCNA 5E5RB 4XBPB 3SE3A 4U6YA 3TPUA 2VZSA 3ZHKA 1CFVH 1AD0A 3AY4C 5FAAA 4H88L 2CDEA 4DK3A 3RVXD 1U91B 4LASL 1D5IH 5JHDB 4WUUD 4CKVX 7CGTA 2CO7B 1B9ZA 4QRUA 3AU1B 4BFBD 2VDNL 5LAXB 4PV8B 3ZKXB 2XI9A 5JR1H 8FABA 1IGMH 2Q7YB 1J5OL 1G7JB 2EYTA 4XX1E 5HDLA 3FAXA 3T0XA 1A7NH 1HDMB 2MOVA 4JO2H 4NP4H 2ADFL 4ZDHA 1GHFL 2UV3A 2EXWD 4JGJA 3KJ4C 5EU6E 5C2BL 5DMIH 2ARJB 3T77B 2OZ4H 5IQ9A 1TTGA 3RGVB 2CPCA 2H2PC 3HI5H 1A4JB 5IFJB 5M94B 2DBLL 3G6JF 5I16A 4ZTOH 2J8UA 1UWGL 4JJ5B 3F7YA 5HHOB 1NSNL 2X4RB 5GRUH 3MV9B 5DJ2B 2CRZA 3VFGL 3DNKA 1BOGA 2GEEA 4WRLA 1IEHA 5JZ7D 3UCRA 5GZND 4E41E 3HZVB 5IB5A 4K94H 1F90L 3MOQA 3QDAA 4E41B 2X1QA 3ZDZE 1I4FA 1P7KB 5EU6A 1FPTH 3WNMA 1LNUA 3WUWG 1NAKL 1F4XH 2OBGA 2W0PA 4K71B 5HGHA 3VFNB 1B6DA 1IGFH 1PQZA 2ZUXA 5DVMA 4PB0H 1WWAX 1JPTH 5C09E 1OY3B 4MDJA 3V0AC 2QQNL 4KFZC 3JV5A 3ZZ1A 2J8OA 3IDNA 4JG0L 1BFVH 5AWNH 3Q5OA 1PG7W 5I8CA 3MV9D 4LKXA 1VB9A 2N56A 2R0KH 4RAVA 5FHAH 1M6OB 1MJJA 4X4ZA 1S5HB 4JO3L 2NW3A 3WNNA 1MFDH 4U3HA 4JZJA 4MNGB 3MCKB 2DI9A 2M8XA 3B5TA 4S1SH 3N1FC 4XAKE 3TT3L 3LD8B 4ZPTA 4AEFA 5ITFA 5F6HJ 1OQOA 4EI5A 3GMRA 1LO3H 4R8WL 3H3BC 5BQ7B 1OGAA 3FTGA 4L8SB 1XGQB 2BVOA 3TBVA 3OG4B 3FONB 1T89C 3Q1SL 5IMOA 3SKOB 3O3EA 1E4XI 2W65B 2XZAL 4L4VD 5CILH 4NUJB 5L8JB 3IRPX 1S7QA 1U8NB 4Z7UF 3P3YA 1T89A 1NC2A 3QUXC 2YKLH 2KQMA 3ULUC 1AI1L 3MREB 3Q6FB 1QHOA 3O45A 4WO4D 1T0MB 4H1LA 5FUCE 4G6JL 4GQPH 3OPZL 4R2GB 4WUUA 4JFPB 1D5XA 4FQHA 5C9JB 1CD9B 2AEPL 4D0DB 1JWMA 1FJ1A 3NTCH 1ONQA 3QUYD 4FP8H 1MRCL 3I6LD 5HHQA 4NYLB 1JK8A 3DBXB 5DC0A 5FK9A 3H7BB 4Q9RH 5KVEL 4JN2A 1AGDA 4HS3A 32C2A 3NIGF 4YHMH 5K59E 1AD9A 1N2RB 1KJ2H 1D9KC 4JKWA 3KPPA 2VSDA 5CINL 3DECA 5J3HD 3RX8A 4F8QA 5IFAH 4KK6D 1RZ8B 1AJ7L 1QQDA 4P2OC 3F58H 3QNYB 5EZOH 1AQDB 4LHJB 43C9B 4UINH 5DMGD 2HTLD 3U7WL 5T5FH 4NCDA 1WIOA 4EDWH 3V0VB 4XBEH 4UQ3B 3GSNH 1NJ9A 1KCUL 2UZIL 1WWWX 1IM3B 3P0YH 3HZYA 3FO2B 4GS7B 1Q72L 2CDFA 5EOQL 1RIHL 4HGWA 4ZOEA 2D03H 5CJ8A 4OGYL 2P46B 3G5XB 4LCIL 1V7MH 3SO5A 5CIPH 2GHWB 1NSNH 4EI5D 5D5MF 2C1OA 2HRLA 2YEZB 4R3SB 5I1LA 1NAMA 4WU7B 4C83B 4R90L 2V9RA 3NAAH 1KCRH 3WSQL 2F53D 2Q8BL 4HUNB 4ZOBA 1DQTA 2R2BB 3V0WH 1FNEB 3RA7H 1H3PL 1X4XA 1I8IB 5T33H 4RRPA 4YPJA 1GAFH 3UTTB 2ZWLT 2K7QA 4K23L 3SDDC 1AXSB 1BAFH 2ZOKA 4UDUA 1RSFA 1RY7B 1JNLL 1A6VH 4G9DB 2NY1D 4XP6H 4G8FB 3ME0A 4XNXH 4PRAB 2WM0A 3GBMH 4JFEB 4QTHA 2R0WL 2XN9B 1QA9B 1E0OB 4JQVA 4QRTA 1R3KB 5F3BB 2ZSVB 4RGNB 1SBBA 3QQ9C 5E6ID 2EICA 1P5UA 2QHRL 2CK0H 5GS1C 4UT7H 4LNVA 1GH7A 3K8KA 3SY0B 3P4OB 2V5MA 4PD4J 1EJOH 4M48L 3ZKND 1DQJA 5I1AB 1DSFH 4I3SH 5B21A 4CW1A 1T1WB 2F8OA 3G08B 1RK1B 3SCMB 2B0SL 3DX8A 1AKJB 2LV4A 2NY5L 5C07B 5HDQH 4Z7VA 3RL2A 5KSBF 4OCRH 5FCUH 4CU8A 3QWOB 1JZ8A 2F8VA 4QRUB 2RR3A 1FVCA 1JZ7A 1QFHA 4PJ9C 5I1CH 1I9IL 5T1KD 2P5ED 1VFAB 5FXCH 1V05A 3AVEA 2P8LA 3H0TA 4MNQD 4ZNEA 2PXYC 4GJTB 4JFXB 4P2RB 3VDBA 4OGXH 5C0JB 1NGWB 3HG1D 1A9EB 3OPZH 4WI2A 3U7AA 4MNGE 3NVQA 2JLLA 3SDAC 3PF2A 3RY6A 2EDXA 5C0AD 3UPAA 4ELMB 3C60A 3LMJL 3OXRA 3DMMA 4ORGB 5EPMB 3MBXH 5I16B 4JPIA 4ZUWB 1LEIB 4OZ4B 2KDGA 2VSCA 4CVUA 5DHVB 1RUAH 4KI5C 3GKWH 3VFWB 2XWBB 2GJZB 1TJHL 3DXAB 3IVKB 4U0QB 3HMWL 4G8GA 1S7SB 5IB5B 3IDJA 4P5TA 3WNKA 1GC1L 4DCQB 5GSRB 5JW4R 1FCCA 1N5AA 5F6IB 4UILH 3EYVB 2WLZA 4TVPH 4JO1L 5HHMD 1CR9H 1K2DB 1PG7H 3MSPA 3U0TA 1OSPL 4XC1H 5HPOA 1XF4B 4Y16D 2BHZA 4PJBF 2V9TA 1RIHH 4GAYB 2UUDK 3BO8B 5C0AB 4NQEB 3R1GL 2XQYG 5EOCJ 1GC1C 2QQQA 1G7MB 3QEUB 4FTVB 4BK4A 1F4WL 4RAUB 5I15L 3CC5B 4KROC 2VLRE 4RMQA 1YMMA 1OT2A 4LLVB 1IC7H 4NN6C 3PXJA 2EE2A 2I9LB 2JCCE 1LK2A 4XPAL 2H2SC 3BYTA 1F4AA 3GJFB 3NFPA 5HI4D 4J1UA 1DQLL 1KLGA 3ZHLA 5HVGB 4HH9A 5HYQB 1IQDB 1FYTE 3FOMB 3S36X 4HGWB 1WIPA 4U6XB 2ICWB 4YHYB 5DMKB 4NQED 3GMMA 1ZOXA 1CXIA 2H2SD 2W9DL 1J88A 2A6JB 1CU4L 4YAQA 1YEIL 5BOZG 1DCLA 1R3LB 2DQUL 2DIBA 3NACH 3CH8A 3FQNB 1PBYA 3IJHA 3QFJB 5I1KH 2G2RA 5I8KH 3KJ4B 1DQQA 2Y9RT 5HHPA 3MOAL 1ZTXL 2A74A 3B5GA 3EHBD 1EHLH 5BRZB 1XIWA 3HAEA 5D5ME 1D5XB 5C9JA 2NY7H 4U6YB 4X4XB 1NANI 4PD4K 3HAEH 2QL1A 4LKCB 4GUPA 5F9DC 2K9UA 2X4NB 3MV8D 2GTZA 3EYQD 3BP4A 5DO2C 3OKOA 1FE8L 2DMCA 5SV3A 1TNMA 3WHXB 4MCYA 2B4CH 4QRSA 2P1YA 2EC9U 1W72L 3OZ9H 4DK6A 3VWJB 3HC3H 1T4KA 5D2NC 4OCLC 4PJ7A 2VIRA 3P0VL 1A2YA 5MENA 3LPGA 3MV7A 1QFUL 3GMNB 5SWSD 1S78C 2EIZB 4CVZA 4HDIA 1RIUL 3MBEC 3PIQA 1KIRA 3O9WC 5IEKB 4LRNL 3TEUA 4ZXBA 4ZUUA 2XZCH 2HLAB 5JOFB 1F4WH 5AAWA 1GOGA 3MV8B 3OB0H 4Y2DB 2X4RA 2HVKA 3PQYB 2W9EL 2R0KL 3LSOB 2PXYD 4FNLH 4LPUA 3H6JA 4QOKE 5HHNB 8CGTA 4ELKA 1H3XA 1NFDF 4RIRA 4WFEE 4JRXA 2J8UF 4C83A 4XPAH 1S7XA 4QRRE 4JO4H 5EZJA 3ZDZF 1MI5D 3VA2C 4M5YL 3E6HB 3VG0H 5HI3C 5DQJA 1FNHA 5F3HB 5F88B 4C56E 5EU3B 1EVUA 2R69H 4P46C 4P2RE 5AEAA 1Q94B 5E5UB 1CDJA 2DQJL 2EO9A 2VLJB 2ZJSH 3O2VL 1OAXL 5B8CA 1IKNA 4CADA 1TCRB 3DRTB 2AEQH 2Y7QA 1YC7A 3MRCB 1HNGA 1UB6A 4J3SA 3L3JB 3SGJC 3JUYA 1LO5B 4HGMA 2HT4D 5C8JB 2BJMH 4TQEL 4DQOL 5FO9B 3U2SA 3S37H 3HNSL 2FX9H 1U3HD 3MJ9A 4ZFZB 5KANI 4N8PA 3MV9A 3UXFA 3QB7C 1BOGB 4U0RC 4APQB 4PRNB 5F8RC 5F9WC 3VGEA 4JHWH 4WY7H 2VLLA 1PZ5A 3GI8H 5KVEH 1QBLH 4LARH 4GAYA 4U1HA 2XXCB 3U4BL 2OL3H 1U2HA 2Z93A 4FQHB 1H3TA 3ARWA 5JW4N 5C70A 4FXKB 4Z7VB 3VXTA 3KPSB 3LPFA 3P0GB 1AE6H 3CC5A 3O4OB 1KCSH 4PRHE 1VEMA 1CFTB 1U3YA 4WU7A 3VFGH 4Z7UE 2HN7A 4PJ8A 4N0YL 5JOPE 1U8PB 2FJHA 4YUEH 1LO0H 3PABA 1FLRL 3QUZB 4J8RB 5INCA 2BHUA 3AGVA 1T22A 3CVHL 4UT9L 1F6AA 2PN5A 2AJVH 4S11A 3FB7B 1OCWH 4GRWH 2DS4A 3HRZA 4AIZB 4MNQE 3VGFA 2W9LA 3OXRB 1S8DA 2E8YA 4RA0C 5GS0L 3E6FB 3V0VA 2ZCHH 4XXCA 2Z8WC 3LN9A 1ZVSB 3RY5A 1K8IB 2O5YL 1TVDA 2AK1H 1YNKH 3FO1A 5FUZH 2DKSA 4ODVH 3ARFB 2VXVH 3C6LB 3VFVA 3ZT7A 1OWWA 2ADGA 1X5ZA 4YJZL 3Q2CA 1CXFA 4EJ1C 3P2TA 3KPRB 3ZDXF 5KJRH 3L7FA 2AJYL 1CZ8L 3HKFA 1IEAB 5EZIL 4L4TB 3O4LB 4I77H 1EO8L 1MCOH 5EU4B 1RI8A 5IW3A 3UROR 3B9EA 3MLVH 4RDQG 1EO5A 1YY9C 2XPGB 3MLUH 4NQCE 3U46B 2YUZA 4JPVH 2FX9L 5D1QD 3U0PA 5TH2A 1UADC 1VPOH 5M7QA 3ULUD 4MDJB 1FFOB 1C5DB 1TQBC 2KL6A 3E2HC 4U2YA 1AGDB 4HS3B 1MFAH 3MRNA 4KK5C 3GO1H 1JV5A 2P5WD 5BV7H 4OM0L 2ICWI 4QTHB 2AEWA 2DD8L 2ICEB 3X12B 3MXWH 3MOAH 2LVCA 3S34L 4KJWC 2ADJB 3K1KC 1UWXH 2DL2A 1RAMA 4D8PA 2NY3D 4YGVA 3IKKA 4X5WA 3D39A 4O02L 4ZPTB 5ITFB 3GMMB 1E4XL 2F58L 4NO0A 4HKJB 4HV8A 2NY6C 3P9MA 3H8NA 2FL5A 1WLHA 5D1QB 3QA3B 2GJZA 3DXAA 4KDTC 2NXYD 1X4ZA 1RZKH 4BSVA 4OZFA 5IMOB 4CNIA 4Y4FD 2FHBA 2HKHL 1XH3B 1NGZA 4PFEA 4I0CC 1PAMA 4OKVA 1BM3L 4UTAL 1J1PL 2OR9L 5IW1A 4OZIE 5GZOD 3TWCH 1DR9A 1A6TA 2UWEF 2FX8L 1NGWA 3ZE1F 1QSVA 2W0FA 3OR7B 3CH1A 3BJLA 2EYSB 4DZBA 3H9ZA 5IB2A 5IG7B 1D6EB 5MP6L 5F72S 1P4IH 1WJ3A 3LCYA 5FKAA 3T0DA 1W0YT 5DK2A 4M03A 4H8WC 4ETQB 3O6LL 1H3GA 4HJGA 3ARBA 3DI3B 3GSNA 4O2CB 5FYLL 2CDGA 5JZ7C 2Z31C 2ATPA 5MENB 1GOFA 1G7HA 4OQTH 1NGYB 1NKRA 3ILQC 1R3KA 5F3BA 3RU8L 3ZYZA 1CD1A 3FQXB 4QNPE 3U79A 4IDJH 4F9PA 2P5WA 1KTKE 5KSAB 1QSZA 5EPMA 1HHKB 3WDHA 5I1GL 5C0CE 1OAXH 4EN3C 4LNRA 2GK0B 1EHXA 2H41A 2GFBB 4G42B 1FAIH 4GBXD 2KH2B 4LRIA 4NZUH 3EYFA 4XP6L 1IGCH 2FJGA 4DFIA 3WEXB 3CCHA 5F97E 3Q6GH 4DGIL 4LHUA 1BZ9B 3PV7A 2B1HH 4DKEH 3O11B 4EDXA 2VNCA 4PJAF 2FLRT 3N06B 4OV6F 3UTSD 3KPQB 4O2FA 2Q3ZA 1NCWH 1YEDA 2FR4A 4HZLA 4LDEB 3K2UL 3VGHA 1ZLVK 5GGVY 1AGEB 4MJ5A 1NCAH 1UYWH 9CGTA 5HPMB 3HPLA 2X6MA 1J0IA 3HE7A 5F9JB 1CXHA 1IC1A 2MCPL 1DSFL 2B2XH 4PJ5D 4PJCE 3NACL 3QDGD 3FOMA 1XR8A 2WANA 4XVJH 1EIBA 4XC3H 5FO9A 5I1IL 3WJJC 2C3WA 3GSXA 4C58B 1XF3B 2OJZH 3HNVH 5F7DB 3FO9B 3V52H 2NX5E 2BSRB 4ZODA 2VIRB 4D2NA 1HHHA 1U8MB 2RFXB 3LHPL 1ZLUK 4TNWK 1N59A 4NP4L 2XRAH 4PRNA 4ZD3H 4F7MB 3UTSB 5IMMA 1IAMA 4A6YB 2BRRL 3QIBD 1KPVA 4QWWC 1JTOA 2DIAA 4L4TE 3RDTB 3S5LA 5FYKH 3SO3C 4PJFB 3GBLA 3SKJH 2R1WA 2HFFB 1HIML 3HFML 5GRUL 3KXFE 3VXRE 2IAMB 1GCFA 1IC5H 5D70L 1G7QB 3KYOA 4G43B 4DN4H 2AV7B 5IESH 3PGFL 1PY9A 4OQTL 1YNTA 3BQUD 1QKZL 4U1MA 4W81A 1KTRL 5EIQA 4JFHE 4IMKC 5E8EA 2HG5A 5MHSE 5FECB 5CEZD 1WC7A 4X6BA 4Q0XL 4OD2A 4TVPL 1EUUA 1RJZA 3T0BA 3VRJA 3M8OH 2EECA 1D6VH 1TXKA 1Y0LB 2WWMD 1MAMH 5GS2D 1QSEE 5D71L 5DWUL 5ID0B 4IOIB 5GGTH 5HGBA 1RZIB 2KBGA 3QXDA 5L7XH 1BBDL 4PJBA 2J12B 3CFIC 3HN3A 1E4KA 3KXFA 2BNRA 3BIKB 4J6RL 1TETH 3NIDE 4QTIL 3UC0H 4P4KD 3C6LA 5BO1L 4TUOB 4GW5B 1P7QA 1WBXB 2ADGB 1SEBB 4MD4B 4WWKB 5E99H 3SDXA 4CN6A 5BS0B 4PGDA 2FB4H 1A7PL 2DMKA 4HG4K 2X42A 2HWZH 1IL1B 5DHYA 5IKCA 4Y4HD 4NNPH 5IW6B 4N0CC 4I5BB 5A3ID 4G8GE 1I3GL 1OD9A 4NKDA 4FFWD 3A67L 5DMIL 3ZMRA 2NX5A 1W8OA 3BUTA 3R1GH 2BVYA 1J0HA 5BRZA 1RK0A 2W0FB 4GRLD 5C6TH 3CUPA 3I75A 1GL4B 2IGFH 4KWUA 5IB2B 3KYMA 3NCYS 2BVUA 3QIWC 5TH2B 3QIWD 1B3JA 4D0CA 3K7UA 5HYSB 1UT9A 3HAEG 4RMSA 1CFTA 4EN3D 5FYLE 2L4OA 3IDIA 1AKJA 4GRLC 4GQ9H 4X5XB 3ROLA 4L3CA 4PTUB 2GAZA 1YPZE 4AG4L 3ALWA 2V5TA 2VDKH 4HIJA 2MPAL 1EMTL 1J0YA 4R4ND 2D0FA 1ZLWK 3MFFA 3FL7A 4IIQC 1OP3K 2XTJB 3SDAA 1UH3A 4CMMB 3EOTH 4YZFF 3LRGA 4ZXBC 4QRRB 3OXSB 5TDPA 1EXUA 3MOBH 1S9VA 2LAAA 5I9QB 5J1SC 1C08A 1KB5A 2L7UA 5ACLA 1CG9A 2A9NH 2MCPH 4K2UH 2W9DH 3S88H 1U8JB 2H3NB 1DBJH 2A2QT 4KQ3H 4QCIB 3JWDC 2GCYA 4OLWL 4PLKD 2VLJE 3O8XD 4B7IA 4GG6E 1J1XL 4NRZA 4X98A 2AABL 5ICXA 2IPKA 2EDTA 1PKOA 4U1NB 2WWMC 4MX7B 2GKIA 5T5NF 2DF3A 3OZ9L 1W72H 3OKEB 4IS6B 3SKNA 4F15C 2X9YA 5JXED 5IW1B 1AGCB 4OZGA 4JPWH 2XA3A 2J6EA 4Z77A 4PRPB 1U8LA 4OZHA 3ZE1E 2JK5A 3EYVA 4PB9L 3I85A 4KJYB 5F88A 3W9EA 3U9PH 1YMHA 3CDYA 4X4XA 4PREB 1T21B 3KPSA 5GXBB 3NBNA 1L0YA 5DC9B 1CGVA 4M9PA 4Y5XC 1ZEAL 3UTTE 3H9SD 1MCDA 3GSNB 3IDGB 3P30L 1LEGB 2PR4H 2NY3C 4F3FA 3ZTJH 3FO1B 2YPLD 2OK0L 2NXZB 4TNVF 1Q9LB 5C0GA 4MB3A 3RTQD 2RHEA 4WFHE 4JY6B 1YMMB 5JORA 4ESKA 1RMFH 1T3FB 4P3DA 4UAOB 3QT2A 4DGYH 1KN4L 3ILPA 4KY1L 5GRZA 1RV6X 4IHOB 4CMHC 4P5KA 2CR3A 5TE4L 5L7XL 1L9MA 5DFVD 5E9DD 5B3NA 4FTVD 2VITA 1CE6A 5DUBA 1CXLA 4POYA 5CINH 2AV1A 2AAVA 3RVTD 3BZFB 5E7BA 2DQGL 2VUYA 4NGHL 4X6DE 3HPJB 4Y4FB 5K9OB 1FG2B 1I85A 4PJ9A 2FD6H 1KN2L 3INUL 1BFSA 3BGFC 3RQ3A 4L4TA 1VGKB 1G6RB 4PJ8B 1WZLA 1MIEL 3H42H 1BFOA 1PJ9A 4ELMF 1PZUB 1KIPB 1ADQH 3WHE1 4AEIL 2CGRL 5SX4H 2NY0D 4R4BB 1I1AB 5HDQL 4Y8AA 2CKNA 2XA8H 2CUHA 1QLFA 2B20A 3GRWA 1A7RH 2YSSB 1ZHKA 3D39B 4K7FA 4BK5A 3CMOH 1CGTA 4BQCA 5HBBA 3V4PH 4WUUE 2P49B 5L88H 4KDTA 1QFWM 4MQ7B 2VR4A 3OX8B 1OAKH 4GKZB 4G7VL 4Y5YC 5E8OB 4KZDL 5BXFA 4BSVB 3B9KC 1HXYA 5EBWA 2J88H 4F7TB 4ONHB 5GJTL 1PLGH 2VLKE 4LVHC 1S7RA 4K3GA 1XR9B 2VOTA 3FFCA 5AWNL 4ODTH 3WFEL 4IOFD 4PJCB 1D6VL 3I84A 3GIZL 2X09A 1EK3A 3BWAA 2ARWA 5HYSA 1A7OH 4JFZH 5CD5D 4XNXL 5JHDA 1NEZG 1NBVL 1YEGH 3IS0X 2A6KA 1FYHB 2SEBA 1QSFD 3QDJD 2CIKB 4B53A 4ELKB 4PR5A 1CGYA 1X44A 1YPZB 2FYYA 4MJ6B 1TENA 4YDJB 3CK0L 4M1CD 1Y6NR 2Z8SA 3DETC 4PGEB 1D5MA 5DD1L 2XTJE 1QRNB 1EPFA 1MJUL 3PNWB 4X7CC 4XP4L 2XG5A 3GSRB 2DLEA 2IWGA 2D9QB 1BQLH 3RZCB 3VFTA 3FFDB 4PJBB 4PJ5B 3M1BB 4JAMA 1T5WA 5E2TL 1M7DA 2M26A 4R7DB 2V7HB 4DKEL 2Y6SC 5AG9A 1WBZB 2Z91A 2XZQL 4QGTA 2MJWA 3QPQC 2W65A 1MI5B 4LPCA 4RFNC 3PGDB 4FABL 3MJ9H 5HDOA 1QG3A 4RNRB 3G5YA 2AXFB 5A43C 2R1YA 3BMWA 1MRFL 2Z9TA 2DQCH 3RWCB 2FCBA 3DGGB 3CAFA 1U8LB 3G6AB 2ZPKL 1YUHA 3EYOA 3QEQD 4LSPH 4L3EE 4HZLB 3KNBB 3QEGH 2VXTH 1R5IA 3PWNA 4MJ5B 3SGEH 2BZDA 3T1FB 1S7TB 4J4PC 3CFDA 3MROA 5FOJA 5J9PA 1K3IA 1UM4H 5AZ2H 1BZ9A 1GGIL 1CFNA 2D31A 4HJJL 1MELA 4K94L 5I8CB 4EDXB 3MBED 4RSVA 2VLKD 2ZUTA 1S78D 5GGQH 1E6JH 3IF1A 43CAB 1SVZA 5C0DA 4YZFE 1KTLB 2XKUA 1NLDL 1CR9L 2EDNA 1HQRB 2D0HA 4Y89A 3DHJA 3ZT6A 5DA0B 1I9RL 2Y06H 4U49A 1Q9OB 2RQ8A 1MF2L 1INDH 4XT1C 4XHQA 1R5VA 2PYEE 4PJEF 1ZT7A 4XNZB 2IBZY 4OCMC 4BJLA 6FABH 1EEYB 3D9AH 4NM8H 5EO1A 5JO5B 4DW2L 1IM9B 5I15H 4P4KB 4Z8FH 4FHBD 1AO7E 5EORL 3LQAH 1MCLA 1T0NA 3AS1A 3CXHK 5E2WL 4K7PH 3HC4L 1F42A 1D5BB 2EDEA 1B0RA 3MPCA 1S9XB 3D25A 3MJ8B 5FM8A 4HKZB 2LTQB 3H9HB 4QO1A 2NX5B 1JPGB 4GKNB 2R4SH 1S7VA 4R4BA 2OMBA 2VDPH 1DQDL 1FNEA 2G5BB 3RVTC 3WO4B 4HG4J 4J4PD 3IAQA 1ONQB 3MTRA 1BFVL 4PV9B 4WVRA 1S3KH 5DJYB 4BSWA 3X3GL 3R0NA 4P2QB 3DV4A 2P5EE 4Y5XA 3GB7B 5TQ0H 4P2QE 3U36B 1FO0A 1A4KA 1L9NA 4GKOA 4X8JB 5ISZA 1YA5A 3ZT5A 1XF5B 3B2VH 3KXFB 1AO7A 3ARGA 5E5MB 1GGBL 1IAOB 5ANMB 4IMLA 2DLHA 3TCXA 5HI4C 3EOBB 1MJJB 3TN0B 4OF7A 1KT2A 2ZSVA 5FF6B 1EHNA 4MSWA 5KBNC 2BNQD 4XPHL 5T1DL 4Y5VB 3BP5B 4YHYC 1PSKL 4FQIH 3BH8A 4K07A 1NJ9B 4ERSL 3ZHDA 2AVGA 2BVPB 2E8ZA 2BNUA 1MRDL 2MFNA 1CT8B 4HWEH 1NL0H 4TQEH 2EH7H 1FFNA 1F3DJ 5SWZA 3BEWA 4CDHA 1DUZA 4LBEB 2WIIA 2XG4A 4PBXA 4Q6IA 5D1XC 2E27H 1T7VA 2OJEA 1ZXQA 1T2QH 3GK8H 1I9RH 2FGWH 1TPXC 4QHNB 1RUMH 3DROB 3QUXB 5FFLA 4Y16B 4B7LA 1T0PB 2IANE 5DRZA 3ORJA 3VRIA 5DLMH 3B8YA 2JCCB 3DX6A 1GZQA 1FJ1B 4N68A 2FX7H 5F7UA 1BD2D 4PLKC 3GIVA 3HUJA 4Z8FL 3HB3C 3BX7C 1U6AH 5DJAB 2NY4B 4RQQA 3RL1A 2AXJA 3LKOB 4P46A 4WV1A 3FAWA 4OLZH 4L8SA 3GUTB 4M7JH 1IVLA 4NRZB 3SGKA 3B9KD 5FGSA 4WHYH 3TH4T 3CX5K 1HXYB 4JHAH 5I73C 3VD7A 5B22A 4O2CA 1DBML 4PLJC 4H25A 4P9HH 4PGDB 5GGVH 43C9A 4CU6A 5FYKL 4DTGL 4LLQB 4NKMB 3UTZB 5DD1H 2PW2A 1MY5A 4ZG1A 3FQTB 1OAUH 4WU5B 4HWBL 5HHOD 1J8HD 1D7FA 4MA8H 4WTXA 1E4JA 1S7TA 4GSDH 4MDIA 3L5WB 4WUUB 3KG5A 2IPKB 3ULVE 7FABH 2IFFL 1OP5K 5HVWA 2DQFA 2X7LA 5E94A 3LZFL 4XMLH 3IU4H 3OB8A 4FFWC 5K9OA 5MEPA 2DM3A 4YBLC 3S3JA 4R3SA 4YHKH 2FB4L 4Y2OA 1JNHA 5TGBA 3OJ2C 2ITCB 3BKYL 3EHBC 4JM4H 5DQ9A 4YDLB 3NPSC 3UBXB 4JFQA 4AT6A 4ZNEE 1KEGL 4H88H 1Q9OA 1V3KA 4IMKA 4K3JH 4AIXA 3R8QA 4OSUH 1T3FA 4PJ5A 4H5SA 3LEVL 5JR1L 4X6CB 4HUUB 4LLDB 2DJ4A 4E0RA 1EFXA 2P44B 2GK2A 3FTGB 3OG6B 2COQA 3C5JB 3I3DA 3HNSH 3AROA 4U1KA 3ARYA 4ZOAA 4JY6A 4CJ1A 5CLWA 3OJDB 1B4JH 1G6RL 2MSPA 2VDOL 1CICA 2RGSA 3BGAA 4NN5B 1JF1A 1DL7H 4G8IB 5ALCL 1V3MA 2BFVL 4NQVB 4AH2B 4UB0H 1G1YA 3L3IA 4KV5E 4YXLL 5ALBL 1KJMA 1OTSC 3F7VB 5HI5C 4I48B 3O45B 3ZE2E 4FG6D 3TC9A 5ICYB 2VR5A 2VXUL 1FNGA 1RK1A 1UC6A 3GNML 3G5XA 4OIIL 25C8H 3BZFA 4OLWH 1NCBH 4FTVA 4NM8L 4DW2H 4QF1B 4Y16C 1NLBH 4QWWD 2EDOA 4M7LT 1H9VA 1AP2A 1PD6A 4XHJC 2DQTL 1NAKH 3BW9A 5JXEC 5FGCB 3AS3A 3TN0A 1WZ1L 1MCIA 3MQIA 3HCVA 5LCVL 2IF7A 3IXAB 3QZWB 1A6WL 5DMGC 5IVXF 4WEUD 3RI5F 1FZKB 2CO6B 3BRDA 3L3HA 3CX5J 2X4UB 4M1GL 2NTFB 2XACC 1QQDB 1WTLA 3VXPB 5EBWB 5T3ZE 4Q2ZB 1BQUA 2GI7A 1KFAH 3V95A 3O8XC 2CD0A 1KIRB 3C09C 3S7GA 4QXGL 4U6XA 3LN5B 2EH8H 1EEYA 4LSSL 4FFZH 4U6TA 3VWJC 1R6VA 3WE6B 4WCYH 3VXQA 4HK3J 5ID1A 4QXUL 3BIKA 3LKRA 5GS1B 2EKSB 2G75A 3NAAL 1IAIL 5E1AB 1MFEH 4R9HA 4ZPVB 1YDPB 2CUMA 5IR1A 1FG2A 5GSRA 3UO1L 1XR9A 3KWWB 3DURB 4I77L 3B9DA 1NGQL 1KULA 3S37L 3MREA 3T3ME 1OVZA 3KPSD 4GSDL 1IILE 4PJDE 4OM1H 1KELH 5D7KD 3G6DH 4PJDB 4GG6A 4HUXA 1RHFA 1F8TL 3VI4E 4X6FB 1T5XB 4MJIA 3DSFL 5IHZB 3I6KA 3V7AG 3JXAA 1L0XA 1BP3B 3MRLA 4I3GA 1U3JA 2YN5A 4OFPA 3SQOL 3VXUE 3QQ9D 3TVMA 5C0GB 1NCAL 4PJ7E 2PXYA 4QHLA 4L8DA 3QCTL 1N7MH 4J1UB 3QEGL 4K9EC 4P4KC 3V9FA 2QSCH 5EA0L 2BDNH 1XFPA 3L7EB 1VADB 1N26A 3DMMB 4ORGA 4JQIH 3TJHD 1NMBH 2C4FU 4HUVB 4R7DA 1KUMA 3BPLC 1FE8H 4OJFH 3RNQB 1XMWA 5CJQH 2MHAB 1BJ8A 2GUOB 5D7KE 4PJBE 1DZBA 5GZOC 4K9EL 4ZOCA 2NYYC 4K3EH 2X1WL 5ITBL 3BDYH 2D9CA 4PRDA 3UTPE 2C7UA 5KS9B 2HFGH 3PP3K 3L3OA 2BFVH 2CR6A 2VZ3A 3NCJL 2X4TA 5DJZB 4F9LC 1F4YL 1HQRA 4NO3B 1N4XH 3SKUD 3X14B 3MO1B 1WFUA 2AJZA 4MHHG 3NCYP 1DFBH 4JFPA 5EORH 3S35X 3LQAL 4LLDA 1K8IA 2VRAA 4LCWA 2H2PD 2ZSWA 3RKPA 3MLSL 2H1PH 2Q86A 1HHIA 2ICWA 3ALPA 4KJWD 2YSSA 3QIBC 1LD9A 3N9GL 2DQTH 4OF3A 2DWEB 1XCQB 1MUJB 3AB0B 1IAIM 3I02A 1AD9B 1N2RA 3AC0A 5EFIB 3QAZB 4YEFA 3WIIL 1OLLA 2H6PB 1ZLVH 2FDBP 4LGPB 2ESVD 4V1DD 1OGAD 2E3VA 4HMDA 3FJTA 5TDOA 2X4QA 3I50L 4NDMA 4D9LH 3U0WL 3W82A 2VISB 1DBBL 4XCCH 1U41A 4HIIA 1T6VN 4QHKJ 3DLQR 3TLRA 4Z76B 4O5LH 3SCMD 1T1YA 3DUHA 1WCBB 4GAFB 1YYMH 1YQVH 3L9RA 4Q9QL 1Z0NA 3Q3GB 2H26B 3SQOH 2ZG3A 4JRXB 3DX8B 4JJHA 1IGJA 5J9PB 1OPGL 3U4EB 1LO2L 3HG1B 5FGCE 3AY4A 1YEJL 3QUXD 4GKSA 1QR4A 1MRFH 3DJ9A 3L95A 3GMPB 5KAQF 3QUMA 3OGOE 3VXSD 4FQ2L 2VLMD 3KPOA 3CVIL 3IDXH 4EI6A 2XIDA 2UYLA 3RWFA 1S8DB 3C9NA 5FYKU 5DJAA 3GMNA 5K9QG 3WNOA 5DHXB 3CLFL 5FCSH 2XT1B 4W4OC 5DZNA 2DYPA 1KJ2L 4FZ8L 2WBJC 3WE6A 3OKOB 1ES0B 4F58L 2W0KA 4FQQB 1T80A 1IAOA 1CDHA 4NO0D 2WUCH 1V8HA 4NO2B 5EZOL 2X10A 5C92A 4G8FA 3VXRD 3LN4A 3MCG1 4XVTH 2DWDA 5LGJA 1YNLH 2Z31D 4PRAA 3LMJH 3PL6B 3KHOA 2LQRA 1ND0A 4E42B 2YZ1A 2NY0B 3O6FB 4NN7B 3W0WA 5TE6H 3GKWL 4U1HB 4HQQH 4NPYB 4I3RL 3B9AA 2NYYD 3GSWB 1QBBA 2NQCA 2VH5H 5DUPL 5K9KB 3PQYA 5KVFH 2VZ1A 3IAGC 1F3DH 4GXVH 3D85D 4OFKA 3OHXA 1OGAE 4XCYA 2E9WA 3U7YL 4WV1B 3ARUA 3O3AA 3GUTA 5EIVA 2XY2A 2QQLH 5IBTH 4Y4FC 5A40E 4IMLB 5HDBE 2NXYC 5GZNC 1K3ZA 1KT2B 4PJ7B 5C6TL 1KENL 4E5XB 4BQ8A 3HUJB 1VSCA 1MCPH 1IGCL 2ATKB 2NY6D 3I2CH 5IB4B 1AXTL 3KPTA 1W0WA 4OLUH 3PNWA 5CGMA 4M5ZH 4ZS7H 5GISL 2J8UE 3IJSB 2EYRA 3M1BA 5FO7A 1IGYA 3U82B 1MCEA 1NMAL 3DUUA 3KYNB 2OSLB 3O3BA 4YFLF 4GAGL 2QQKH 1RUQL 4P46D 5D6DC 3S36L 4B0MM 2EXWC 3RGHA 4TSBL 2WIIB 4OBSA 3MBEA 4G6MH 1LO4L 1N6QH 2Y4SA 4KK5D 4I9WE 5C08D 2YRLA 1S9XA 3BZEA 3W81A 2HRPL 2AGJL 3V6OA 2K7PA 4NHCH 3O2WL 4UOJA 1JNLH 1YQ2A 4OZGF 3JWDL 4GRWE 3QFDB 5CMAA 3TBYA 1MRDH 1FZOA 4J2XA 3EJZC 3T65B 3SGDI 5IGXL 3EDKA 3SKMA 4KQ4L 1YEEL 1OAZL 1ADQA 4FRWA 2DQFB 1DLHB 4PGBB 3CFJA 2EDDA 3O9WD 3MA7A 3DPBA 2MCG1 2GW5A 5D2LA 1MUJA 3MNVA 2XWTA 3BP6A 1FPTL 5FYJH 4P46B 4X8JA 2C3VB 3BDYL 5SWSE 4QYOA 5ESVB 4MCYB 3C5JA 2MPAH 3FO0L 3ARFA 2ICEA 3PP3H 5SWSB 3GM8A 1IAKB 1FZJA 3VFVB 2F58H 1IEBA 3V6ZA 1PKQB 1KTLA 4UT6H 3MRKB 2QKIA 2PUQT 2RCSH 2DKUA 5C08A 2PO6D 4M6NH 4APQA 1F4HA 4P59L 5T3XE 5D9SA 4QXWA 1FYTA 3F7RA 4XHJD 1NCCL 4ZO7A 4LEOB 3UTOA 1U6AL 4PRIA 4XAKD 4OLEA 2H26A 4JQXA 4HULB 1JPSH 4Q0XH 2PW1A 2OR9H 2XPGA 5LJYH 1DUZB 2F53A 2EDRA 1RZGA 3VXTB 5GGTL 2X2YA 4UILL 4ZMAT 1U93A 1S7XB 5E1HB 1QO3A 3D2UA 3DROA 3VWKB 3W5MA 4UIKL 3KPMB 3GSVA 2NY1B 4FFZL 4YDIL 1NGXB 3DYOA 3MRRB 3MRDB 4HMEA 4LQ1A 5DRNB 5T3XH 1NBVH 5GGSY 1CQKA 4LCWB 5CILL 3D69A 4N0FA 3RKDC 3WIHL 4W68A 3T04D 1FFQA 5DD0L 2DWEA 3H2WA 2KZ1B 1ZA3A 3SGJA 2VAAB 1ERNA 3L3JA 4APQD 3P77A 1VACA 1RUKH 2F53E 5IM7B 4XCNB 1ZSDB 4NHCL 4XVUD 4LAJH 1MLCB 1AR1C 1U3HC 4KROD 2X4OB 4DVRL 4MHHI 4R0LB 3MA9H 3BVNA 1A2YB 5HYJD 4QRQA 3MNWB 3CFEB 4AG4H 2ZOLB 1NC4D 2R1WB 3GM0A 4NJAH 1Y6KR 2MHAA 2IC2A 3EDDA 4HBQA 4D0CB 4IRJB 3SOBL 3OHXB 1NMCC 2PO6A 3S4SB 4NZJA 4CNIB 3MRIA 3UTPD 1KJ3H 5I8EB 5HI3D 3LSOA 4KI1A 4YHZL 4XVSH 2JELH 4R96A 1OF2A 1EHLL 3P0YL 4LCCA 4YPGA 5I30H 1JPFA 4OSUL 4IRZH 3EGSA 1MFBH 4KI5D 1CF8H 4WJ5B 4JDVA 4AL8L 3M17A 5DMYA 4XTRD 1X5LA 4PJDF 3U9UA 5LWYH 5F96L 3T0EE 4Y4HA 5IIEA 5IQ9B 3BWUC 4JR9L 1FAKT 5C3LD 4W70A 1XGQA 3TJEH 4MA3A 3GRWL 1FNSL 4CADB 4LLMB 5BVPL 2J8UB 4X6CA 3I6KB 1HH9A 4LLWB 5HY9B 5DD6B 4WWKA 2Z35B 1VGEL 3FO9A 5EO0A 4F8TA 5SX5K 1D9KB 5EZLB 2D03L 4U1SB 5KZCD 1OSZB 2CH8A 1JHTB 4XXDB 4Y5VC 2MNUA 5MENE 4PRDB 1MH5A 4ZPVA 3CZJA 1Q9KA 3RWJA 2J3SA 4Z77B 4Y4KA 2C4FT 4Z76A 4R0LC 4GXUN 3T2NH 2BSTA 1PY4A 5D2LF 3DURA 4EZMA 1XGUB 2NY4D 1NCCH 4JG1H 4WU5A 3ZKNC 2VZUA 1SYVA 1MQ8A 2CKBB 1I9JL 4OLXL 4M43L 1I1CA 3OAUL 4G8EB 4JRXD 3CCHB 5DUML 4B41A 4GAGH 4KY1H 1TPXB 2XKSA 4ZAKA 1HHIB 1KG0A 3O6ML 1JRHL 5DWUH 5SWSA 4EUPG 1AR1D 2H8PB 2X9XA 3SE4A 5L6YL 1J1OL 1MVFA 3ECBA 4L8BA 5JA8B 2D0GA 5I66A 4E5XA 12E8H 1U8MA 3UC0L 4M3JA 1C08B 1KB5B 2VXTL 5ID0A 5L2JB 3VXPA 1QTYT 5FV2A 5E6ZA 3SDDD 2HT2C 3T77A 4Q9CA 2P24A 4R6UA 1N3NB 4OM1L 1A4JA 3QISA 1RJLA 3PWVB 4JO2L 5J11B 4YR6B 4BH7A 1I1FA 2ED7A 3KVQA 3RIAK 4C57C 2DOCA 3MNZA 1XGYL 3LH2L 2X70B 4HGKC 1JGEA 4G6JH 2Z31B 2Z8VC 3CFCH 3VXMD 4N1HB 2EKSA 3KLSA 1TJIH 4G9FE 2AJUL 5JOPD 4EN3A 1AGCA 4U1LB 4NKDB 1NC2B 4PJHE 3OJMB 4ERSH 2I9TB 1FO0L 3TFKD 2DIJA 1JF1B 3LPWA 3PE9A 4AENB 1NGPL 4LF3A 4OF8A 2HLFC 1DBJL 3GSWA 3TYGL 2NW2B 4OZFH 2KQNA 1INEL 1E28B 4D9QE 1G7QA 3KYOB 1LE5B 2VZOA 2YBRA 3NCMA 2AJXL 4P3WA 3IDGA 3OKKB 2FH6A 4ZQKA 4PS4L 1ES0A 2C3VA 3K3QA 5FV1L 3FQRA 1GRWA 1DANT 4WFFE 5IB1B 2DTSA 4LRIC 1VFUA 4Z0BL 5CZVL 2AJVL 2C3HA 1KLFA 5C0CD 3NCJH 5F7YC 5TDPB 2Y06L 1GGTA 2PXYB 3MRMA 4L3EA 4RZCA 4I4WA 5HGDA 3CDFA 1OTUD 2JB6B 4NKIH 1CL7I 1DFBL 4JANB 4KV5F 3QEQA 1CTNA 4M7JL 2R2EA 3CUPB 4ZSOE 4FXGA 5C09B 2J2ZA 2Q8AH 4MJIE 3QI9D 4WO4B 1RZGB 2YRPA 2HJLB 1DQLH 1JNNH 1GIGH 4P4RA 3V0WL 3WD5L 3M07A 1RIVH 1IGJB 3NPZB 3W0WB 1M4KA 2A38A 3GMQB 4PJ9D 2P5WE 2RBLA 2PNDA 4RX4A 3PWPE 1M7XA 5DRXB 3ZKSD 1WAAA 2VWEE 3BP7B 4WENB 1S9YB 1O0VA 3NA4A 3HI6L 1CU4H 3FQUA 3E1F1 3GSOA 3D69B 4TUKL 4HF5L 3QPQD 1EXUB 1HHGB 1AGFB 5FKPB 1VKXA 4HT1H 4IOIA 1X5FA 5E8NA 5EBGA 2XY1A 1TIUA 4X80L 5CP7A 2ZUUA 3ROLB 1PEWA 4POUB 4NT6B 3BKYH 3LY6A 1TJIL 1XR8B 3PGDA 2VC2L 4GKZA 1JFQL 2IG2L 5B8CC 4QRTB 2J5LC 3JUZA 3ARBB 1NDMA 2B1AL 3CDGB 5CSZB 3DO7A 5K93A 5ILTH 1ACYH 4LCUA 5D6CA 4CAGA 3HE6D 1CBVH 3OSKA 1J18A 1K6QH 5DEFB 1WWCA 4KTEL 4LLUA 4MGXA 3VFMB 5FUOH 4KK8D 3STZB 4DFHA 5KOVC 3TNMB 3RAJL 3T1FA 5C0AA 2BNQA 2OSLA 4MD5A 4AMKH 2PKDA 3NGBC 3WXWL 1JWMB 5E8DL 1KIUA 2E6JA 3QHFH 5D2LE 4UOW1 2YEZA 3H3PL 5L0QC 3I3EA 3F6LA 1EGJA 4JFFB 1UJ3A 5CJ5A 3S8WA 3QR2A 2IPUK 1E4XH 4P5TD 3G5VB 1FVDB 5F70A 4EI5C 35C8L 3NFPB 3WV0A 3SBWC 3BGFB 4NRXA 5L2JA 1JMXA 2Y07H 3SKMB 2E6PA 1EBPA 4KU1A 1V7NL 1IQDA 3CFJB 2ZUQB 1NLBL 2WBJD 3UJTH 4G7VH 1J1XH 4YO0B 3C9NB 3V6FB 3VG0L 2JJTA 5T3ZH 4DVBB 3ZL4L 1ZA3B 1IJ9A 1QZ1A 2NR6C 2BVOB 3TBVB 1OSZA 2CLVB 5ACZA 4K8RL 4PJFF 5DJXB 4F2MB 3CSGA 3CSYA 2OMNA 2VLRD 4QY8A 3RWEA 4NFDA 4HX1A 2G5RA 4I3RH 1XIWB 1ND0B 5DVLA 5TQ2H 1ZT1B 2HVJB 3RVXC 2MTPA 1K9TA 3B2VL 4XMPL 5CCKL 1KPVB 1XF4A 3O6LH 5F21B 3C6LD 1U8OA 5GRVL 1T1WA 5MI0C 3TBWA 2X4NA 3TIDA 2L0DA 2FECL 4D0DA 4XPHH 1J0KA 4OD1L 3LEYL 4N0FB 4FQIL 4PJEA 1S7UB 1F3RB 1N64H 2LAGB 5IV2B 1U9KA 2XWTB 1CFSA 1TZGH 3BP6B 3SE4C 1KENH 2J1KA 1K6QL 4OCNC 1VEOA 5ADOH 4JM4L 5J7CC 3GMOB 1FH5L 5BXFB 2Q7YA 4M7LH 3GSRA 2XV6B 1N0LA 1S7WB 2YD8A 2IPTL 2EIZA 1A21A 3WS6A 4CVZB 3QIUA 4JM2D 3DXAD 4NO5B 3TYGH 3B9VA 4WW1A 2DB8A 4F33A 3D3VB 1RUML 4O51B 4HJJH 2O5XH 1EJ6A 5I8KL 1DUYB 2JIXA 4KJPC 2JJSA 2WK2A 4R2GC 3RRQA 4B50A 2ZCKL 3IRZA 4FS0A 4JZOA 5IFJA 4NQDB 4DGVH 3G08A 5I0DA 1HOCB 1MRCH 2I07A 1CI5A 5C0BE 3HPJA 4G6FB 3QWOA <