1HQUB

Human immunodeficiency virus type 1
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
430
structure length
430
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Lys103Asn mutation of HIV-1 RT: a novel mechanism of drug resistance.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords POL POLYPROTEIN
total genus 96
structure length 430
sequence length 430
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2000-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1hquB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1hquB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1hquB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1hquB03
3H98A 4DL6A 2UVRA 2HNZA 1JLFB 2ZE2B 2C22A 1EP4A 4O44A 3GV7B 5J2QA 5KT3A 4J9RA 4ECWA 4J9NA 5HROA 5FDLB 2WB4A 1C1CA 3DLGB 2HNZB 1LW2A 4H54A 5KFQA 4KBIA 1S1TA 4TQRA 3MFHA 4NLWA 4K4WA 1JLCA 3BGRB 1T94A 4NLVA 4U6PA 2BQ3A 4ZPDA 3MFIA 2OPRA 4TLRA 4ECUA 2ILYA 4EO6A 4J9QA 3NMAA 3DRRA 3KLIB 5D3GA 3GYNA 3FFIB 5CYQB 3MEGA 4DG1B 4URSA 4Y34A 3KHLA 3PW0A 2C2RA 3KK2A 5KFJA 2WOMB 4NRUA 4KHRA 4TYAA 1RA6A 1JLAA 1N4LA 1NHVA 4XPEA 3BQ0A 1RT7A 1MMLA 3LAMA 5I3UB 2YKNB 2JC1A 5KG7A 3DMJB 1GX5A 4O3OA 3TAMA 3D28A 3JSMB 3H40A 2OPPB 4H4MA 2RDJA 4RW6A 5KT4A 5KG3A 1S1VA 5DQGA 4LQ3A 4KHMA 3PW7A 4FS2A 5DGBA 4IFYA 1KHVA 3LP0A 2FJVA 1DTQB 1DLOA 5T14A 5KFMA 4NZ0A 5KFTA 2BE2B 2W8LA 3BQ1A 3MF5A 4ECXA 4K4ZA 2C2DA 1J5OB 4WFZA 2ASDA 4Q0BA 1S9FA 5KG4A 3KK1A 4K4SA 1IKWA 4DL7A 1HPZB 5KG0A 1RTJA 2YNIA 4MK7A 4Y3CA 1RT6A 1S6PA 4J9SA 2BE2A 4ICLB 4WE1B 4F4YA 4K50A 4J9MA 5KFEA 2W7PA 1SH0A 3G86A 2W9BB 1RT4A 3LP1A 3V4IA 3E01A 4RUAA 1ZETA 2GIQA 3QO9A 3G6YA 3DLKB 4NLGA 4DL3A 3UDLA 2D3UA 4YR2A 1C1BA 3PR4A 3LALA 3H5UA 4ED0A 4WXWA 1FKPA 3Q8RB 2D41A 5C24A 1TL3B 3MR6A 2E9TA 4O3NA 4RW4A 5EUHA 1TKZA 3FQLA 4IH5A 3IN5A 3CDEA 1KHWA 1RT3A 4KV8B 3H5XA 4IG3A 5FDLA 4NLYA 4ZVGA 3N6MA 4I7FB 3ISND 2WRMA 3GIKA 4IQXA 3KMQA 3Q8PB 3PJWA 2YNFA 2BRKA 2BQUA 4R8UA 3Q8QB 4G1QB 1BQMA 3V6DB 2YKMB 1RTDA 4ZP8A 3OSNA 1RA7A 4NLSA 3RAQA 4IR9A 4TY9A 3M9MB 2AU0A 4IDKB 4DL5A 2WOMA 4KFBB 4QWBA 1TKXB 1JLAB 4O4RA 2IJNA 1JKHA 3PVXA 4NLUA 1N48A 4KO0B 4J9OA 3NAIA 4HYKA 1FK9B 4GC6A 2WONA 4J9PA 3I0SB 1SH3A 2W9CB 3FQKA 2VG6B 2UUWA 4Y2AA 3QZ7A 1QAJA 4U7CA 1REVB 5KFOA 2OPQB 1N5YB 1FK9A 1LWCB 2UVUA 3PW5A 4ECVA 2E9RX 4R5PA 5HROB 3CJ2A 1IM4A 1IKYA 1QE1B 1RTHA 1XR6A 5JXSA 1S97A 4MFBA 3T19A 4IRDA 2AX1A 1K1QA 3IRXB 5KFYA 2FVCA 2FLNA 3BSOA 2FJXA 4ECYA 3SFGA 3BSAA 5CYMA 2VG7B 5KFVA 1IKXA 1SH2A 3GIMA 4I2PA 3FFIA 5CYQA 3MEGB 4DG1A 3DRRB 4M94A 2ZKUA 5KT2A 2XGQA 3TQ1A 1TVRA 4M95A 3H2LA 4ID5A 2ILZA 1RT4B 3V4IB 3PJXA 5HLFB 5F9NA 5KFZA 2HNDA 3EPGA 1TL3A 4QW8A 3DRPB 3QIPA 4K4XA 4RW4B 3KLGB 1RT2B 1I6JA 2FVSA 2HWIA 2IC3B 3T5KA 2OPPA 2YNHB 4H4MB 3KLHA 1S1UB 3GIIA 4NLTA 3HHKA 2YKNA 3BSCA 4PUOA 3OHAA 1RT1B 3KLGA 5I42B 4XPCA 5F9LA 3LP0B 4RNNA 5J2NB 2IM0A 4KAIA 2F8EX 1DTQA 2WTFA 4F4WA 2WK4A 4RW8A 1N6QB 2CJQA 4NLXA 2BRLA 3DI6A 5F8HA 3PR5B 1JLEB 3N6NA 1S0NA 4NCGB 1YVFA 3CVKA 2VG5B 2W9AA 3OSPA 4TN2A 3M8PB 1XR7A 3RBEA 1NHUA 2DPIA 4B3OB 3KK1B 2J6SA 2V9WA 4KKOA 2FVPA 1BQMB 2UVVA 4YP3A 2W9BA 3CO9A 2VG5A 1JLGA 5J1EA 3DM2A 3M8PA 3KHGA 5KFHA 2B5JA 3KMSA 3QGGA 2W9CA 2E9ZA 4IRKA 2FVQA 4KO0A 5F8MA 1IKVB 1BQNA 5KFSA 2XCAA 3DM2B 3BR9A 4NLOA 4I2QB 4NYZA 1KLMA 2R8HA 4Q8FA 4ED2A 2OPSB 2I5JA 2I1RA 1TKZB 5F8IA 3RB6A 4RW9A 2ATLA 4I2QA 1IKYB 1QE1A 1RTHB 1S1XA 1OS5A 2V4QA 4Q45A 4IRCA 4YQWA 3MR3A 1EP4B 4O44B 2XC9A 1TQLA 3PHEA 4NLRA 3FSIA 4ED7A 1VRTA 2IAJA 2IM1A 2V4RA 2XGPA 1RTDB 2HMIB 1W25A 2J6TA 4FBTA 4ZP6A 4YR0A 3ISNC 2V0NA 4KE5A 4ZP9A 3MR2A 1Z4UA 3CJ0A 3BSNA 4I2PB 3RB3A 1JKHB 2D7SA 2J6UA 1ZTWA 2HMIA 4IDKA 3V6KA 4K4VA 5F8NA 3DRPA 3QIPB 3DDKA 5DQHA 3DOKB 3G6VA 3OL6A 3EPIA 4ID5B 3N6LA 4MIAA 4PQUA 1SV5B 2FLLA 4ED3A 5KFCA 1REVA 1RYSA 4RNOA 2B6AB 2O5DA 4MK8A 4PUOB 4RNMA 2IC3A 1RT1A 1TKTA 1SUQB 3DLEB 3QLHB 4KB7A 4YMEA 3QYYA 4K4UA 2OPQA 3KOAA 5F8GA 5KFLA 4J9LA 5J2PA 2B6AA 4ZP7A 2IBKA 5C42B 3HVWA 3C6TA 1LW0A 2BR0A 3CJ4A 3MEEB 3KLEA 4ECQA 3T5LA 1S6QB 5KT5A 3IS9B 2YNGA 4B3OA 3TVKA 3ICLA 3I5AA 1HNIA 1D1UA 3LP2A 5EWFA 5L1IA 2ZD1A 4DL4A 3H5SA 1IKXB 4KKOB 1TVRB 4ZMMA 3BGRA 5KG6A 3UPFA 1JLGB 5J1EB 1MU2A 3QIDA 4ZHRA 1RT6B 1S6PB 1ZTTA 3RB0A 5DG9A 1HPZA 1S9EA 5KFWA 1S1UA 3PZPA 5DGAA 2JLEA 1HQEA 1TV6A 4WFYA 2R8IA 4O4GA 3M8QA 4WYWA 3C6UA 4ECSA 4Q44A 3E01B 4XO0A 4QWEA 5DLFA 1S48A 2B43A 5L1KA 3V6JA 3MEDB 3DLGA 5KFRA 5EWGA 4LSNA 1CSJA 4JUZA 3PW4A 3H4DA 4RZRA 1RT5A 4Y2CA 4HKQA 4RU9A 1FKOB 1HMVA 3DRSA 2ASLA 3IG1A 2AWZA 5C25B 3CIZA 4EBEA 4ED8A 1RTIA 4NLQA 1N56A 5KFGA 3ITHB 2BANB 3V6HA 3DRSB 2JEIA 2VA2A 2R8GA 3I0SA 2GIRA 5J2PB 3JSMA 5F8LA 4RW9B 2RF2B 4RW6B 5DG7A 1T03B 4RNFA 4EBDA 1C1CB 2I5JB 2CKWA 4ZVEA 5KFIA 4TQSA 5KT6A 5J2QB 5L9XA 3KLFB 1HARA 1QAIA 3IS9A 2HAIA 4LQ9A 2R2SA 4DL2A 2JEFA 4TY8B 4RUCA 1VRTB 2IAJB 3MEEA 2W7OA 1N5YA 2QV6A 3LP2B 1C0UA 5KFBA 3V81B 1IKWB 3GIJA 5D3GB 1DTTB 1R0AA 5EWEA 3JYTA 2OPRB 1T05B 3QZ8A 4FS1A 3MECA 4ZHRB 2VG7A 4R8UB 5DLGA 2ASJA 4IR1A 4MKAA 3OLAA 3T5JA 1MU2B 1SV5A 2XI3A 3QGHA 4JV0A 2ALZA 2C2EA 4ZVHA 1T3NA 1FKPB 5HP1A 1TKTB 1SUQA 3DLEA 3LAKA 3QLHA 5C24B 4IKAA 5I3UA 4TXSA 4O3RA 3DYAA 5KFPA 3DMJA 4ED6A 1EETB 3KJVA 4QW9A 3T5HA 2VG6A 4F4XA 2EC0A 1LWEB 1JLQB 2IM3A 1XR5A 1S0MA 2HNYA 3DYAB 5C42A 4H4OB 4R0EA 3G6XA 2AX0A 4ZPAA 4Q43A 4QWCA 4I7FA 4R5PB 2D3ZA 3VQSA 3NGDA 4QWAA 2FLPA 4LSNB 1S6QA 3NAHA 3OHBA 4MIBA 1N6QA 4Q0BB 1LWFA 3FRZA 4EBCA 2R2RA 4G3IA 4G1QA 3V6DA 2VA3A 4X2BA 2IA6A 3D5MA 4ZPBA 4ZPCA 3IGNA 2ZD1B 3QGIA 5C25A 2BQRA 1C0TA 2IM2A 3H4BA 1D0EA 4EYIB 4LSLB 3T1AA 4TYBA 5C5JA 1C1BB 5HBMA 3LANA 3IG1B 1S9EB 4MH8A 3I5CA 4IOBA 3Q8SB 3QO9B 3IGVA 4ECRA 3I0RB 4RW7A 2FJWA 4NRTA 3SFUA 4URQU 3M9OB 1JXLA 2JEGA 4PWDB 3M8QB 1RDRA 3M9NB 5KG2A 2AGQA 2JEJA 1C2PA 4EYHB 4IFVB 1TL1A 1WNEA 1TP7A 4WFXA 3CJ5A 4NLDA 4ECZA 1VRUB 3EZUA 1IKVA 2XCPA 1S49A 2YNHA 1JLBB 1UWBB 3HVTB 1RT3B 4KV8A 3KLHB 4O3PA 4YR3A 2AGOA 4QWDA 1U09A 3MEDA 3OL7A 3IRXA 1S0OA 2WHOA 5F8JA 2IJFA 2R2UA 2WCXA 3E51A 5J2NA 5DQIA 3KHHA 3OL9A 1RYRA 4MK9A 3BQ2A 1LW2B 1HNVA 5J2MA 3BJYA 3OLBA 4KFBA 2JC0A 1DTTA 1HMVB 1R0AB 1JLEA 4K4YA 3NBPB 3SI8A 3JYTB 2UUTA 1HQUB 2OH2A 1S1WA 4ZVFA 2C28A 2HWHA 1HYSB 3CDUA 2RKIA 1HNVB 1JLCB 1RTIB 5J2MB 4WZQA 3MR5A 5JUMA 3ITHA 3NKYA 4GC7A 2R2TA 5KFUA 3KK2B 1JIHA 2B5JB 3DOKA 4Q8EA 2W8KA 2XI2A 1S9GB 1T03A 4WZMA 3H59A 3KK3A 2HNYB 3RAXA 4QPXA 2RF2A 1JLQA 1LWEA 3H5YA 3CDWA 4NLPA 3CWJA 1RT7B 4TY8A 4MFBB 3BREA 3KHRA 3UQSA 4O3SA 5K14B 3KLFA 4EO8A 3KLVA 3DI6B 1C0UB 4OL8A 3GILA 2R8JA 1S1XB 4EEYA 5KT7A 3NL0A 5CYMB 1S10A 5K14A 3V81A 3PW2A 4URGA 1C0TB 3C6TB 1S1TB 2YNGB 4MKBA 4F50A 2XWYA 1DLOB 3HVAA 3KLEB 3MTKA 1T05A 1RTJB 5HLFA 3GV5B 3MECB 1HNIB 4ECTA 5L1JA 4ICLA 1RT2A 2QE5A 3KLIA 5HBMB 5EDWA 1BQNB 2YNIB 5HP1B 2HNDB 5KG1A 2R8KA 4JV1A 3LP1B 3HKWA 2DPJA 4JV2A 2UVWA 1EETA 3KJVB 1KLMB 5KFNA 3I5BA 5I42A 4IFVA 1JLBA 2RDIA 1HQEB 1TV6B 1JX4A 5L1LA 3OL8A 4K4TA 4KSEB 4IH6A 4NCGA 1S1VB 4RW8B 1GX6A 5KFAA 3RBDA 4H4OA 3TAMB 1RAJA 4IG3B 5DG8A 5KFDA 1NNDA 4IFYB 2FVRA 1LW0B 4FBUA 3DOLA 3GQCA 1HQUA 5KFXA 1LWFB 2YNFB 1QUVA 4O3QA 1HYSA 1RT5B 2RKIB 4LSLA 3NBPA 3CJ3A 5KFFA 4F4ZA 1S1WB 4IG0B 3DOLB 3GV8B 4RNHA 1J5OA 5KFKA 2AGPA 5KG5A 4WE1A 4PQUB 1FKOA 2YKMA 4PWDA 4WYLA 2AQ4A 2OPSA 4IG0A 3I0RA 4RW7B 2WONB 4ED1A 1K1SA 3UR0A 1TKXA 2IMWP 1S9GA 3KK3B 1JLFA 2ZE2A 4IH7A 1TL1B 2BANA 1UWBA 3HVTA 2GC8A 3DLKA 4WXOA 4J9KA 3RB4A 1LWCA 3KNAA 3FDSA 1VRUA 1S4FA 4O4GB 4DEZA 3C6UB
chains in the Genus database with same CATH superfamily
4A8FA 2UVRA 1WOPA 2HNZA 2FJAB 3CC4S 1MSWD 3MGJA 4U7UD 1ROFA 3GV7B 5J2QA 5KT3A 1O5JA 1UPMB 2GAGC 4F0MA 4KPYA 1G1XA 3OUYB 3GZ7A 3GG1A 4KH0B 1GNKA 4J7CA 2GZOA 3ZTRA 2ZH6A 2HHTA 2VPYB 3W7BA 1LQ9A 2KDOA 3AT1B 3ETMA 2RHQB 3ZO7A 1S1TA 1U48A 4V19J 1R0BG 1WDDA 1FTRA 4NLVA 4M5IA 2KVQE 4LF7F 4U6PA 1I1GA 2BQ3A 4QU7A 1SJQA 2ILYA 1EX8A 3KLIB 1UW9A 2W25A 3M7VA 5HQMA 3FFIB 2DNKA 4E8UA 2MKIA 4B3MJ 4F2RA 4USVA 3PYEA 2QMXA 3WX8A 1RISA 3MUTP 3VAGA 4MT1A 1M5HA 2ZBCA 2HHHJ 2WOMB 1N32J 3MMCB 4ETXA 1RA6A 1NHVA 2Z4PA 3QSIA 3AD8C 5ITHA 2BX6A 3FC9A 4M5JA 1U47A 2LDIA 3P96A 1MMLA 4LRCA 4PAAA 3U1MA 2ZJRQ 1PYOB 2LQJA 2Z8QA 2MZRA 3GCXP 1FCAA 4DZ6A 1I94J 3R2CJ 4DV0J 1RAIB 4RW6A 4N8NA 5B09A 5DQGA 1S1VA 4LQ3A 3PIPQ 3G4SS 1S59A 3CCJS 2NS1B 2G1DA 3Q86A 1X4EA 2HFZA 5LOQA 3GFZA 3MAHA 5KOXA 2JLGA 3LP0A 1UKUA 2W7AA 3DLJA 2VHGA 1DLOA 3W61A 3TYTA 2HHQA 3OFHA 4O3QA 3W5YA 5D4LA 4ECXA 4K4ZA 3D6TB 4P7VA 2O66A 1J5OB 2VJVA 3RRHA 2C2DA 5DETA 2H48B 2EK1A 1IKWA 3TQEA 2UU9F 1HPZB 1CG2A 4XIUA 1RTJA 1RSCA 2RUSA 3C46A 4Y3CA 2UXBF 5DDQC 2DD8S 1BC6A 2DNPA 4RLEA 1HQ2A 3DFEA 3MMBB 5GAGU 1F3FA 1M5OC 4K50A 5T41A 2EFVA 1KLNA 2C2MB 1FE4A 4CLPA 2MQNA 4KHPF 3NGSA 4F4KA 4N41A 2GIQA 2XMJA 3DLKB 2ADCA 1NH8A 1S7IA 3NRBA 2PE8A 3PR4A 1IM6A 4F02A 3CF5Q 4LF7J 1FKPA 5HI7A 3UR3C 4O3NA 3M8RA 3MWBA 5EUHA 1M1KT 2I9SA 3FQLA 1XC9A 1IJEB 3UCZP 4OX9J 3CCRS 2R7VA 1R3NA 1SC4B 2HHSA 1SC6A 3Q22A 2IY5B 1RT3A 3GJSB 1YLXA 2CNKB 2Z57B 2KT2A 1VQKS 4NL5A 3ISND 4DSFA 5U47A 3J80U 4X4UA 2YNFA 3GSDA 1T9VA 4HTIA 3TEHB 2WAQD 4R8UA 3FSXA 3G8TA 1VC5A 3V6DB 1BQMA 1RTDA 2B4UA 2HS3A 3GYGA 4OYXA 1QSYA 2PI5A 4IR9A 3ZZUA 3GFXA 2AU0A 2MZSA 2CJXB 5FLXU 4DL5A 4KFBB 1OPIA 4J9VA 1RWUA 4QWBA 2HWTA 3CJ8A 4QJVA 4KHPJ 1VISA 4JI7F 3VV2B 1KRPA 4J9PA 2R42A 4RBUA 4AT1B 3P6YC 2QA1A 3CDAA 5A0YB 3CIMA 2UUWA 4OHVA 1FESA 4Y2AA 3QZ7A 2XLJA 1FI4A 1X0PA 2BJ1A 3R5CA 4LRBA 4PEOA 3K59A 4DR3J 1N5YB 1LWCB 5JVGQ 2E1MC 3PW5A 4V1Ak 5CXTA 2CJKA 1N54B 1NU4A 3GSIA 3AA8A 2IJRA 1XR6A 3HHLB 3TP2A 3NMRA 1HIYA 3GR1A 3T19A 4JI0J 2HFUA 1K1QA 4GKKF 1N8RT 2FPHX 1PGZA 1N0UA 2K3KA 2OAUA 5KFYA 2FVCA 2JRSA 4RWXA 4F7VA 3A1YG 4ZN3A 2FJXA 3J80Y 3BSOA 2J9DE 4WF9Q 1SB6A 2BE7D 2DB1A 2LEBA 2LLZA 5KFVA 3QQCD 2N3OA 5D4NA 3R7NB 1IKXA 1SH2A 5ETOA 4DV4J 2NSCA 4F36A 2ATCB 2DXEA 5IV4A 3CCSS 1U2RA 4OZ0A 4DDFA 3FEXB 3OJUA 1TZ0A 1F9FA 1WEXA 3JQJA 3H2LA 4ID5A 2ILZA 3PJXA 1U1NA 4DQIA 3LO3A 5KFZA 4FP9A 4DN0A 2V8GA 1TL3A 2W4DA 4K4XA 2RUGA 1FXDA 3CCZA 3MCOA 4PABA 1RACB 5BR8F 2HWIA 5DRKA 2G4BA 3GIIA 4LR9A 1VQYA 1KEKA 1VQ9S 4B02A 2HGLA 2FJDB 3RBXA 3N4WA 2K2PA 4Q7AA 5CD4A 3G82B 3X1LB 3LP0B 5J2NB 2DHGA 2IM0A 2F8EX 1GAOA 4ZVOB 4F4WA 4RW8A 5JJBA 2CJQA 2E5IA 4NLXA 2Z0GA 2BRLA 4MYTA 4DN9A 1NAQA 4JI4F 1YVFA 1TL7A 2W9AA 5K8PA 5GMDA 1TK0A 3M8PB 1H7XA 2DGXA 4ANDA 1J5EF 2P5VA 4B3OB 1FWKA 1U6ZA 1EQ0A 3FZBA 2FVPA 2HIQA 4YP3A 4WKRA 1FRKA 5J1EA 2B5JA 5ETQA 3KMSA 2YBVA 2JVOA 4B3SF 2AJ1A 2ZBRA 3CD6S 4KH1B 3FCVA 3IWLA 4PWUA 1RHKB 1BQNA 1SVDA 2IVYA 2VDIA 3B6BA 5F3TA 5CCMA 4DR5F 2FYXA 4GVLA 3ZZRA 2ERRA 3ZFVA 2H4WB 4P72A 2EI5A 2MJNA 2I0XA 3IAM9 3SV3A 4K0KJ 1YKWA 2I5JA 2I1RA 4BBYA 4G1IA 1CEZA 5L39A 1RWNB 1CJTA 2QA4G 2VONA 2ZH5A 1S1XA 2V4QA 3MM6B 1HHQA 3F56A 3GFYA 1FXRA 2UUAJ 3RJMB 2DNLA 3PIOQ 1GMWA 3PHEA 4PKDB 1S12A 5IS2A 1OQ6A 2ZH2A 1YTYA 3R6GB 4FYDA 1Y10A 2GMLA 1RTDB 3MMAA 3TZYA 1KC8T 3HDSA 4FBTA 5BYQA 2VPWB 4JBCA 4ZP6A 2V0NA 2W24A 1A0OB 1Z4UA 2ACMA 1VRQC 2CNLB 2IVMA 3CJ0A 4XK8C 1RAOA 2D7SA 3TZZA 1U1PA 2J6UA 2BV3A 3D9BA 1L3VA 3S01A 3GG0A 3I96A 4DR7J 4K4VA 5F8NA 3DRPA 2ZEJA 3DDKA 5DQHA 1NM2A 1SJ3P 3OL6A 4ID5B 4ZIVA 3IBCB 3KKFA 1KVIA 2FLLA 1XK8A 4L72B 5L1IA 4B3TJ 4RNOA 2CRLA 1JXVA 1FD8A 4QIFA 4PUOB 4ZCLA 3ZTOA 3B4DA 3CGIA 3QLHB 2Z2YB 3IR7B 2OPQA 3KYLA 1UL3A 2HK2A 4C0OC 5F8GA 2LFVA 1N36F 2ZBQA 3K5NA 1D3WA 1LW0A 1N34J 1L3SA 2VQFJ 1VCTA 2GA7A 2XHWA 4ECQA 3BM7A 3T5LA 1KNZA 4B3OA 3E8OA 4WWSA 2KVIA 3ICLA 2AYEA 5IXUA 2AJ2A 1D1UA 2FHOB 3U02A 2QG9B 4LUBA 5T7LA 1VOMA 2J7UA 3J81U 5I3PA 2GJIA 3QFHA 4JI8F 4ANEA 3BGRA 1WKLA 2WBRA 2L9WA 1JLGB 3UPFA 1U1QA 3T41A 2MQOA 2O1PA 1RT6B 1S6PB 1Q8IA 3AY0A 4ED4A 5AXNA 3RB0A 2XWXA 3PX6A 3VTIA 3PZPA 2XEXA 4OQJA 2A18A 2R8IA 1VBYA 4G65A 1B0VA 4PR6A 4WYWA 4LF9J 3KUEA 4ECSA 5J1NA 2WB1D 4QWEA 2W2PP 5ETRA 2HHXA 1PYTA 3QT5A 1R8CA 2Z58B 3R1LA 3PEHA 3GYXB 5KFRA 2DNZA 5EWGA 1EJ7L 3LGMA 4LREA 4JUZA 3PW4A 1VQLS 5E0OA 1TK8A 4F67A 1IBMJ 4ITSA 3OTBA 3D6FB 4RU9A 1MLAA 2FHJA 3D0GE 4WPAA 5G0RB 2KZMA 5HVHA 3K2YA 3ENQA 4WK1A 5A76A 2MY8A 3CCQS 1YRUA 5HJXA 1LK5A 5IFMA 2YWEA 3AAWB 2XQCA 1U2FA 3D0IE 2F4VF 2AJQA 3SQOP 2Y9HA 5IT9U 3CIZA 2CPEA 4RL1A 2H51B 1QM9A 1UWAA 4NLQA 3H25A 4ED8A 1FFGB 1K0VA 1GT8A 1M1GA 1NKEA 1CJVB 4U67Q 1V3RA 3DRSB 2RAQA 2VA2A 3I0SA 1CC8A 1VBKA 2KFYA 1CJTB 1X60A 4DUYJ 5DS7A 2V50A 2FLOA 2I5JB 4HLBA 2NYIA 1CQMA 3LF0A 5J2QB 1U6BA 3L7OA 2PC6A 5DM7Q 1HARA 2AIRB 3IS9A 2GJFA 2CUYA 4QIVA 4Y2KA 5E5NA 4RUCA 5HMWA 1VRTB 2IAJB 2XMTA 2M8HA 2XB2D 5FJ4A 4L75A 4ZA1A 2MQQA 2HBQB 3DNCA 4JI0F 3IO1A 1S7HA 3UD5A 2K1RB 1IKWB 4DL0C 5KFBA 1MG7A 1IBMF 1WD6A 2X51A 3C15A 1HWLA 4X4TA 2R4FA 1NH7A 4JI6J 2IHR1 1T05B 2DJWA 3EE3A 3JSBA 2Y0BB 2DRBA 1IQZA 4ZHRB 2QIFA 2RRBA 2VG7A 4Y2MA 3RAMA 4YHHF 3VWSA 4IOCQ 1IVZA 2K7JA 5DLGA 1M5PC 3OLAA 4FVCA 3HP6A 3MEKA 2YWHA 3QGHA 1S77D 1HD1A 3NNHA 3ENAA 1V9OA 2D69A 2LKZA 4ZVHA 2BM0A 4FXDA 2LQ8A 2K3IA 1B4SA 2B8QA 1SUQA 3PYGA 4O3RA 3BGFA 4TXSA 3VVUA 4EWTA 1XN9A 2UUBJ 2H5IB 3DOMA 3TARA 2GGPA 3TJ8A 3TA0A 3KJVA 3M8ZA 4CZCA 3T5HA 2VG6A 2BKPA 2ZNZA 1LWEB 1JLQB 4FYVB 3UDCA 4QYZK 2GMJA 2HRTA 4JI3J 2OP5A 4UZCA 5C42A 1FTCA 3HSJA 3G6XA 2XNQA 2LQ9A 5HVFA 2ZFHA 4Q43A 3HSDA 1XIQA 3NGDA 1X4DA 4QWAA 3MAQA 4CDIA 1U02A 3G96A 1IBKJ 4MIBA 2GHPA 1N6QA 4EBCA 3LQVA 4GMKA 4C8OA 4ELVA 1S79A 1HW8A 4G3IA 2D1CA 1YJNS 4IQMA 2H65B 3OT9A 2DEJA 1XWLA 5K5MA 1GH8A 4ZPCA 4AL6A 1YIJS 3AXKA 1C0TA 3KG1A 4OJHA 4U8VA 2XM3A 4QYZJ 2FHJD 5C5JA 1FVQA 1TL7B 3R1HA 3IG1B 1S9EB 4MH8A 3R8YA 1FDDA 1I3OB 1TMMA 2M52A 3BPDA 1H2VZ 4RW7A 2J7WA 3R5BA 4NRTA 4PG8A 2OGUA 2GHVC 3M9OB 2ZJPQ 4B9SA 2CPHA 3M8QB 1YQHA 1Q53A 2KO1A 5KG2A 3M9NB 4EYHB 3IWNC 3C66A 1ZZFA 3EVWA 1TL1A 4DHVA 3GCWP 3D68A 3TOQA 3WZ0A 3NGRA 4NX9A 2WVEA 5E33A 2AJ0A 4OYZA 1UJ4A 2FQQB 5E3QA 5CCLA 1JLBB 1WEZA 2PMZD 4CH1A 4JI1F 1AB8A 1HD0A 4FPIA 4JYAF 3CC7S 2HSEB 1JK9B 2HGMA 1YDLA 1F5BA 1HBUA 1MMNA 1HBOA 2G9OA 1TL4A 4FN5A 3HHDA 2KT3A 3MCNA 2IJFA 2R2UA 4D3GA 4ZCMA 3BQ2A 3AD7C 4X4SA 3EXYA 4JP8A 2U2FA 4KFBA 2JC0A 3OLBA 2PI4A 4XAKA 1HMVB 2DIVA 4FF3A 5L46A 3JYTB 2OH2A 1HQUB 4NZ7A 1S1WA 3W64A 1H2UX 3MURP 3CDUA 1HYSB 2MHNA 1HNVB 4LBIA 1QVGR 1B3TA 2IPOB 1HNWJ 1ZM9A 3MR5A 1BLUA 3ITHA 4YB6A 2Y1IA 2RRNA 4S0MA 1KS2A 1JIHA 1PAEX 2DNQA 1UFWA 2C42A 4I4BA 4NOHA 5IT0A 1S9GB 2MKJA 2OMLA 3M32A 4NXMJ 4WZMA 3KK3A 3J7Z5 2ZOGA 2BE9B 3GB0A 5CD4H 3RAXA 1L3TA 2CQPA 2DCUB 3OPKA 1LKZA 4NLPA 3CWJA 4TY8A 4MFBB 3BREA 2VJUA 3HSZA 5K14B 1KVJA 4DPYA 1ZAXA 3HO1A 4C3MA 1UZDA 2E7WA 1C0UB 1WF1A 3GILA 2CNNB 5HMXA 4DXLA 2J9EA 1ZM3A 2B4OA 4C8KA 1PJ5A 2NUHA 2CQ1A 2V2ZA 1H74A 1YJUA 2HK3A 4ID8A 2K1RA 5LM7E 4DU8A 3PW2A 4Z2XA 2YNGB 1VQPS 4CT8A 2FJEB 2NLWA 1VQSA 2IIHA 2EBGA 1S0VA 3KLEB 3MTKA 1RTJB 5HLFA 2ZBPA 2A6OA 4ECTA 5A2QY 4C98A 3THPA 1UCNA 4YB5A 1RT2A 3TJ9A 2MDAA 1K9MT 5EDWA 2CQ3A 3MMJA 2HNDB 4JB8B 4DQRA 2IYGA 1F2HA 3QMQA 2IDEA 2E1CA 3AQOA 2V5HG 3FBEA 2UVWA 5KFNA 2GMHA 2LA6A 2C3YA 3BH6B 2QEXS 1TTHB 5I42A 1FRJA 1WC5A 3BH7B 3FBFA 3HFZB 1SL0A 1JLBA 3M2UA 2V4JB 2RDIA 1HQEB 1IN0A 4FF2A 1R8BA 4FNIA 4KTQA 4K4TA 1DY3A 5KFAA 3RBDA 2HHUA 4CLZA 3QBCA 3EZOA 4IFYB 3BV8A 2HFVA 4LJMA 4DV5F 3DOLA 2RD5C 4AYBD 1WF0A 2KM8B 2VC1A 5KFXA 1XMOF 1VI7A 1LWFB 3R6LB 1HYSA 2R7XA 3M6WA 3LWLA 4RBVA 4LFAF 1X5PA 3AXMA 3M05A 2YKOA 5KFFA 4F4ZA 1SJ4P 2EBEA 3GV8B 3DOLB 2QGFB 2J76E 1J5OA 4TNOA 1YBAA 3W5ZA 2AGPA 3K89A 2BYCA 4Q2LA 3MPWA 1WJ9A 2AQ4A 4PG5A 2CG8A 2OPSA 2L41A 4DI6A 1K1SA 1KONA 2CQ0A 4QR2A 1TKXA 4CO4A 2HS0A 3CJSA 3TAPA 1QSSA 4P9SA 3OR2A 5K8NA 1K73T 3RBEA 3BGUA 4P75A 2RRAA 1UWBA 3HVTA 1RAEB 2HEKA 2N4CA 3TANA 4N47A 1F5CA 3NCRA 2ZUAA 5DDRC 4LRFA 3PM9A 5A8RB 4TU8A 1YITS 2UXDF 2CIMA 3PG9A 3H98A 4DV0F 4V19X 1EP4A 4OJ3A 3SEOA 2W2OP 5GMKa 1G2EA 2CPXA 2RMLA 2WB4A 1OY9A 1CJUA 3ILOA 3DLGB 1S76D 3AJ2A 1TKDA 3PRDA 2GQQA 2RS8A 4TQRA 2V68A 3MFHA 1WG1A 3CNQP 2XZTB 1JLCA 4NLWA 3BGRB 3EVMA 1RE1B 2E7VA 2J0WA 3P5BP 4ZPDA 3QT7A 4ELTA 4TLRA 4ECUA 4EO6A 3IR5B 3G8SA 3DRRA 2KT5A 2MEWA 2WVCA 5D3GA 1BE4A 1VIOA 1ZA1B 3DXBA 3TVYA 2VUGA 3M8WA 3MEGA 4Y34A 5LSOA 3RBZA 5GAEU 1X7VA 4NWBA 2RQCA 3KK2A 3BGLA 3L9ZA 1IR1A 4OZ2A 4NRUA 2V8PA 4KHRA 4YY3F 5KFJA 1N4LA 2D9OA 4DSJA 3HK2A 4XPEA 2MZ1A 2ZHBA 2RU9A 1W7WA 4LFBJ 2WSFC 3TUPA 3K5MA 5KG7A 4O3OA 3TAMA 2BJ3A 2AYGA 4LFBF 2OPPB 3HD2A 2QO3A 5KT4A 1V3SA 4JV5F 1REGX 4EZ9A 2HQ3A 1W2IA 1XJWB 2FJBB 3TW0A 5H1SV 1LV5A 2UUCJ 4IFYA 2P6TA 4P74A 1KHVA 2MKSA 3T9ZA 4OX7A 2JJ4D 2V63A 1DTQB 3PEJA 2WW8A 2W8LA 3BQ1A 2DR7A 3MF5A 3Q23A 4K4SA 3K58A 3C15B 2AJFE 2YNIA 1DHMA 2DR5A 2R7UA 4OZLA 1RT6A 1S6PA 5IOLA 4K5RA 3T6BA 3MUMP 4LF8F 3SSSA 3MOJB 3CJRA 5DM6Q 2Z2ZA 2FD2A 2W9BB 2W7PA 4F4YA 5LJ5Y 4DR5J 1WWHA 4DR7F 1RT4A 3V4IA 1HW9A 3E01A 4ZVQB 2OEKA 2KH9A 1ZETA 3JB9k 2BDPA 3BBFA 2ACYA 4DV1J 4ED0A 2I38A 1SJ1A 3H5UA 2KM8C 4WXWA 3DLHA 3H8YA 3Q8RB 2D41A 5C24A 1TL3B 1RUSA 2Y8YA 2M3DA 3MOZA 4IH5A 3IN5A 3UD4P 5HMYA 2A2CA 1KHWA 1WOOA 3FEYB 3EMTA 4B9MA 3H5XA 5FDLA 1OSCA 1HI8A 1R31A 3HMJG 2PA8D 4DV6J 4I7FB 3K17A 2VQEJ 1K0TA 3KMQA 4A8WA 2HZAA 3CTRA 5G4DA 1FF2A 6AT1B 3Q8PB 1WEYA 5A2QU 3UWTA 1W26A 4NE9C 4G1QB 3RRGA 3ET6A 2YKMB 3VHQA 3ETOA 2H54B 3M9MB 2KKHA 1JB0C 1NPRA 4IDKB 1SIZA 1VS3A 2RHSB 3PYDA 2D3O1 4GC6A 1Q4RA 2VIHA 1VGYA 2UP1A 1T9WA 2WONA 1AZSA 1SH3A 3SSQA 4B17A 2W9CB 3FQKA 3I31A 2VG6B 1XTZA 4BC9A 1I51B 4DSEA 1FNOA 4PQAA 2KYXA 3Q8UA 4C97A 1FJGJ 2JH3A 1NSAA 2OPQB 1VYAA 4CLSA 4DX8H 2UVUA 1NSPA 4ECVA 4QZVB 2E9RX 4R5PA 4C11A 2R7RA 5HROB 2VBYA 1VC6A 1QSLA 1IKYA 1RTHA 3IRWP 3MAAA 2R7OA 1ULRA 2KRRA 1RAFB 4IRDA 1R8HA 3G8QA 2L08A 5DDOC 1HI1A 1CJKB 2HQFA 4DR6J 1R89A 4ECYA 3BSAA 5CYMA 2G13A 4DFMA 3TA2A 3VGTA 1WTFA 4I2PA 1HWJA 3FFIA 2YQ0A 1D8YA 4EZ6A 1F1BB 3MMAB 4DG1A 5F0WA 1R43A 2EKNA 3CCTA 1BHNA 4C48A 5IWAF 2HFNA 1P1LA 2QYCA 3R9LA 4M94A 5KT2A 2JSXA 4M95A 3KWMA 1RT4B 3V4IB 1OYDA 5HLFB 3PXGa 4C0HA 5F9NA 2PN6A 3EPGA 4QW8A 3QIPA 3D1QA 4ZDNA 2KG0A 3PRVA 4H4MB 3KLHA 5D8HB 3M2RB 1MN9A 1LXJA 2YKNA 1AA1B 1PBAA 1YG0A 2FGCA 4PUOA 2DGVA 2V4JA 3AJ1A 4ZVPB 1YJRA 1RT1B 3KLGA 2E1PA 5AJ3J 2G0CA 5I42B 3HT3A 2BW2A 2GV1A 3LGNA 1FRLA 1LOUA 2COLA 1DTQA 3HX9A 3ISZA 4OZ3A 1U45A 2J0QD 4OI6A 4Y28C 1NJIT 3HLUA 2LYVA 1JLEB 4P71A 2OFHX 3K5PA 2QN6B 1KFDA 4GO7X 4PPZA 1RB0A 3US5A 1XR7A 1NHUA 2DPIA 3KK1B 2J6SA 1NDKA 2VASA 4RR5A 5D4OA 1WC3A 1BQMB 2V69A 4NA2A 1JLGA 2HQCA 4YFUA 3DM2A 1NLKL 5E2QA 4BLGA 3KHGA 3DN9A 2BBEA 3A3PB 4CWBA 2FVQA 4YB1P 1M5SA 4KO0A 5F8MA 1WTBA 2OD4A 4HDGA 3ILJA 2GS8A 4FF4A 2NR0A 5E7OB 5M2PA 1S6UA 1KLMA 3SCIE 3GMGA 4A8MP 1RZMA 1RI7A 3T1YF 2QSFA 2QZ8A 3BR8A 1F60B 2X1GA 2YKAA 5F8IA 3OTOF 3HFVA 2J8AA 4DBQA 1XMQF 1SC1B 2XS5A 1HBOB 3C16B 1TELA 2DHAA 2C1EB 1AROP 1Q82T 1C4CA 2VBWA 8AT1B 3G2XA 4O44B 4I69A 1RP5A 1TQLA 2CQIA 4NLRA 3HM9A 2ZH8A 3R5GA 5I4MA 3M8YA 4OMFG 2DIUA 1YX2A 2HMIB 1XNRJ 2FZCB 4UOFA 3ISNC 1N36J 3MR2A 3MPUB 3OUYA 4I2PB 4OI0A 3ILIA 3KFWX 4DSIA 2CPYA 2HG4A 3WQPA 3HXMA 2XYHB 1KDNA 3LGHA 2EK6A 3DOKB 4DZDA 4PG4A 3HHLD 4PQUA 1AXQA 2IRUA 3MPYA 5GAGI 4B9TA 1REVA 1CULB 2B6AB 2FB0A 3QRPA 1J5EJ 5B0GA 2IC3A 1KOOA 1RT1A 3DHXA 4LF5F 2MZJA 2POKA 3KOAA 4ALZA 2P9CA 2YX7A 1YI2S 3CSKA 5ETKA 5J2PA 2B6AA 3B82A 4ZP7A 2ZITA 3HVWA 2OSQA 3EGNA 5ETMA 4OI1A 2IBKA 1ZH5A 2Q79A 3D1OA 3E3XA 1QTNB 4KGKA 3UDEA 4DPOA 4JYAJ 4WK3A 1NRKA 5KOWA 2UUCF 3PX4A 5T7LB 3BYRA 3IS9B 3CT9A 2DTJA 1HNZJ 2GCFA 5HVGA 2BKNA 3MM9A 4LF9F 3SMZA 1F2GA 1MN7A 3ZZPA 1X31C 3ZZTA 2CPZA 1G3OA 2CPIA 1AT1B 2YQ3A 5AXMA 3H5SA 2OELA 4KKOB 3FJ2A 4ZVUB 2RQMA 2HIYA 3PV8A 1RGVA 4FF1A 3OVBA 5KG6A 5J1EB 3NS5A 1BWVA 2E1RA 3D1HA 4WTYA 3TNVA 1X8DA 4JI5J 1HPZA 4M1KA 1UVKA 1Q8KA 4DV7J 2GVDA 2K8GA 1HQEA 1SI9A 2FC9A 2N7YA 2RILA 3K5OA 4WFYA 4Z7YA 3U1LA 3VZHA 5BJRA 2M4MA 3H20A 3C6UA 1OPZA 3W8GA 2L3MA 3DGPB 4LVNP 4JI1J 3FCWA 1WHWA 5B7WA 5IWAJ 4PYDA 4Y2IA 3EZ5A 5DLFA 4ILLA 3EGZA 5RUBA 5LMNF 3FEZA 2VQFF 3V4MA 4ZJQA 2LU2A 2XMWA 2EC2A 2XSJB 3IBWA 4NEZA 1CSJA 1IWGA 3DC2A 3H4DA 4AL7A 1P27B 1RT5A 4M5LA 1HHSA 1ZAWA 4CLFA 4DCOB 2MXYA 5D0HA 1OY8A 2RE1A 4OZ5A 1F5AA 1DQ9A 1ZBTA 2PMWA 1SKWA 2XS7A 3WC0A 3IM8A 2R9LA 2UV8A 3VALA 4C9DA 2I6WA 5A6WA 5K9FA 3CJQA 1HBMB 2ASLA 4A46A 2AWZA 3BGOP 1RADB 2AF6A 1RTIA 2CZ9A 1YBTA 2MKKA 1N56A 4DU7A 2LXUA 4NA1A 3ITHB 4JI6F 4ETZA 2JEIA 2R8GA 5F8LA 4DLEA 2V9KA 3BO2A 2RF2B 1FA0A 2KI2A 2HYIB 3M32B 2QRRA 4RNFA 1URRA 4WCEQ 2CKWA 5AT1B 1E6YB 5KFIA 3S1TA 2JFKA 3SBMA 5A8WA 4RPFA 3F44A 1Z1ZA 4QQBA 2JEFA 1FFWB 2IA0A 4KC5A 3NGKA 2W01A 3IR6B 1QDUB 2LDYA 4DUTA 4DL2A 1U1MA 5F41A 3IM9A 4DV7F 1N5YA 1VLYA 3BN4A 1U0HA 2QV6A 3NGUA 1E6YA 4LIWA 4USIA 3HHNB 4XTTA 1HBUB 4N8OA 1OO0B 5A8WB 3V81B 1SQFA 3J7YU 3BO3A 2EEYA 3GIJA 2VODA 5D3GB 3ZTSA 1RBAA 1Y5IB 3LOUA 4LRAA 3CEDA 1CLFA 2FIUA 3MECA 1LXNA 2BJ8A 3M2VB 4WU2A 3EX7B 3I4PA 4FS1A 3A8KA 4DF4A 4RU2A 2ASJA 9ATCB 2G0IA 3IFEA 3G87A 2RDDA 2XI3A 4JV0A 3HZEA 2OIHA 2D9PA 4G1PA 3OTEA 3KUHA 2X3GA 3FBCA 2XY7A 3CMAS 3M6UA 2MGZA 5HP1A 5I3UA 2GVZB 3DYAA 1VLOA 2HHPA 4ED6A 1XMOJ 4F4XA 3J7AN 1LEOA 1O8BA 2J7KA 3EICA 2BOPA 3PJ9A 1S0MA 1X4AA 2FUG9 1FWPA 3DYAB 4R0EA 2V34A 4K8RA 4K59A 2AX0A 1FVSA 1RHUB 3KNGA 1FRMA 5DJBA 4R5PB 2YPYA 3VQSA 2DGQA 4C11B 4QWCA 1N34F 2FLPA 4HR2A 1S6QA 1K44A 3CJKA 2DY1A 2N3LA 2BJEA 4Q0BB 1LWFA 2XMMA 1XNQF 3RRKA 1X4CA 4G1QA 2VPZB 2DR6A 4KR0B 3D5MA 3W8PA 3S8SA 3FCHA 2EG2A 2J9DA 3IGNA 3QGIA 4X4OA 2IM2A 3W62A 3KUGA 4EYIB 3L3CA 3T1AA 2U1AA 1C1BB 5HBMA 3I5CA 2QLFB 2RJZA 2ROGA 1FDNA 3I9ZA 3IGVA 2F65A 2Q1LA 3H0PA 3SCKE 5E41A 2DVIA 2JEGA 4KJIA 2NXJA 2UUBF 4OJ1A 1RDRA 3KG4A 2JEJA 4GKJJ 1C2PA 2PO4A 4OFZA 4X4PA 4NCBA 5LMUF 4NLDA 2HPUA 2DO0A 3D6MB 3EZUA 3O44A 4X84A 4QIEA 4ZPTR 3K5LA 2XMAA 3QJLA 4O3PA 1UWBB 3HVTB 3VGVA 2VFTA 4QWDA 3BKFA 1VQ5S 2N4DA 1L5UA 4WU3A 3ONQA 1CS4B 4USKA 3CD5A 3RZAA 3OL9A 5J2NA 2KXFA 1RYRA 4UUXA 1N5SA 1LW2B 4M5MA 5J2MA 4WP8A 3Q0AA 4HI2A 2ZHAA 1FNXH 3WX4A 3DGVA 3BKTA 1JLEA 1RBOB 5THWA 2MQLA 3WHIA 2DRAA 3ULHA 1NJWA 1YK9A 4WZQA 1LK7A 1U8SA 2N82B 1J27A 1Q79A 1CJVA 5HATA 2R2TA 3JTNA 1XBWA 4NI2B 5KFUA 2JL9A 3UVJA 1YJ9S 3H2VE 4PPDA 1UEVA 2BACA 1T8EA 1VQ4S 2HNYB 3OD2A 4M5DA 2YWGA 3L7UA 4LFAJ 4QPXA 1BQXA 2PMHA 4N5SA 2RF2A 4L74A 2HHVA 1RT7B 1GK8A 3N9UC 2HBYB 2AW0A 2GO8A 3UQSA 1VK3A 1KQKA 5C2GA 3KLFA 1T9YA 1T9XA 3F73A 2DR9A 4O3SA 2Y1JA 4OHZA 2X1FA 3C16A 3DLLQ 1YJWS 4EEYA 1U0HB 3NL0A 2KJWA 1BD6A 5CYMB 2EVZA 4LT6A 1S10A 4URGA 5H9EK 2ZWOA 1S1TB 4MKBA 5FD1A 1JJHA 4F50A 2HVZA 1DLOB 1EKRA 1NDPA 2BA9A 1RLDA 3HULA 3AB4B 3OTCA 4KGMA 4OYWA 2VICA 2BMBA 2HAFA 3HHEA 1R6VA 1RU1A 3GV5B 1TFYA 1CBKA 3D4JA 4DCJB 2GFFA 2A0FB 2V8DA 3UD3P 2QE5A 1AW0A 1GXUA 1VC0A 3BBBA 4AQYF 2YNIB 5HP1B 1O0PA 1FX4A 3EJMA 4EGLA 5IM0B 4JV1A 3CCMS 2HURA 5SZTA 2AEMA 5AXKA 3KJVB 4BWJA 3UO0A 5BR8J 2HRYA 3G82A 1FWLA 2CJ9A 3VAHA 4WFBQ 3OVSA 1F6TA 2CDQA 3DXSX 2VOOA 4HHJA 3PKMA 2KHCA 4DLGA 4L3KA 1B7YB 2NPIA 4IOAQ 4F0HA 3B54A 1H73A 2IBOA 1JQGA 1U6FA 2E7XA 1Q5VA 3TAMB 2RQ4A 4DV6F 1RAJA 2XZWA 3AD9C 5KFDA 4PXBA 1NNDA 2DXDA 2X1BA 3TA1A 4AFFA 5DG8A 1A9NB 5LT5A 1H38A 3GQCA 4NMXA 4O23A 4X62J 2J9CA 4J90A 3NNAA 2H4YB 3NS7B 3NBPA 1TU0B 1SL2A 1S1WB 1X9WA 3OTDA 1HWKA 5KG5A 3O8WA 4WE1A 3MI7X 1Q86T 3RUBL 4BHQA 3OXGA 3LWMA 3PDNA 3I0RA 3CE8A 2F7VA 1WOSA 4M5DB 3UR0A 2IMWP 1QJHA 4NYOA 2VKZG 2HHWA 1JLFA 2ZE2A 1TAQA 2GC8A 4NASA 1VJWA 3KNAA 5GMEA 5B08A 3K8VA 1LWCA 2W4CA 3ENWA 3NGTA 1S4FA 4O4GB 2VC0A 3OFEA 3UDVA 2WVBA 4NMLA 1ZS6A 3L7PA 4DR2F 2FDNA 1H7WA 2HZCA 2Q66A 4J9RA 4ECWA 5CA5A 1NB7A 2W1BA 5HROA 5FDLB 3L95X 3U27A 3J81Y 2A6MA 3CD0A 1PG5B 2NZCA 3WBZA 2D3OR 2HNZB 1LW2A 2L48A 4H54A 3TR5A 5KFQA 2HW3A 1SKUB 4XDCA 4DV2J 1XMBA 1Q95G 2JNJA 4WP9A 2MPUA 2V2KA 3JAMU 4J9QA 3QFWA 2CNOB 4MTPA 3GYNA 2L9DA 5CYQB 1DBDA 2SXLA 4FXVA 3QSYB 4DG1B 1BGXT 1RWMB 4URSA 2DGWA 2EC0A 1U2CA 3B8HA 1Y00A 2DBBA 4UY85 5ETLA 3WIUA 3NOGA 2ZHOA 2CQCA 5F3ZA 1RT7A 3LAMA 1WSVA 1PSDA 2YKNB 4DL4A 3NWGA 2XO6A 3DMJB 1UFLA 1WC6A 3JSMB 2RDJA 4H4MA 3ZC4A 3C2PA 4ED5A 3J7ZT 2ZVIA 4HVZA 2E44A 2E66A 4FS2A 1LNQA 3N0VA 2DGTA 3GE9A 3I4HX 3O3LA 5DGBA 2KFNA 3UE2A 3KDOA 3LW5C 2FJVA 1G6BA 2VU5A 5HL7Q 5T14A 1RHRB 4FYYB 2HRUA 5KFMA 2QMUB 2CXEA 3VQTA 1VQMS 3EM1A 5IT9Y 3JQKA 3W9JA 4O0NA 1S9FA 5KG4A 3KK1A 1X0FA 4TLQA 1FJGF 3WDOA 4LRDA 4DL7A 2DR8A 5KG0A 1HNWF 4DV2F 2AZ1A 1OWXA 1WELA 2EXUA 1E6VA 1P1TA 2GQ2A 4KQZA 1Y11A 2ZNYA 2ROPA 1Y9OA 4WE1B 4HTJA 1W2BR 2DGUA 3J7A1 2OO4A 3M1VB 3BKUA 1SH0A 3G86A 3MM7A 3QGPA 1D9DA 1TL5A 2ZVSA 3QO9A 3N79A 5B0FA 2KXHA 3G6YA 4DL3A 8ATCB 1NK7A 4W92B 3UDLA 2HVIA 3LALA 2NYHA 3OR2B 1NK5A 3MR6A 3SV4A 5EX3A 3EUNA 1ACMB 1TKZA 3N5BA 2M2BA 3HFKA 4OYAA 5D78A 1QTMA 1XNRF 4RWWA 4B08A 4DFPA 2B9WA 4DV4F 3CDEA 1Q78A 4P2FA 1XQIA 2B7BB 1NXIA 4ZS6A 4DPTA 4IG3A 4ZVGA 3RG6A 4A8SA 2JHEA 3NEKA 3GIKA 4PWWA 3PHTA 3PJWA 1X5TA 4RKUC 3OFGA 5ETSA 2RQKA 3V5RA 1FRHA 2W2QP 4CH0S 3Q8QB 3G71S 4ZP8A 1A6LA 1RA7A 4TY9A 1UP1A 1XEZA 3TI0A 1TKXB 1JLAB 4O4RA 2JVRA 1JKHA 4OLPA 4DUZF 3PVXA 1N48A 2JLFA 4KO0B 2XMKA 1LFPA 3NAIA 4BC7A 4LVOP 2ZJQQ 4J9OA 1KSPA 2N7CA 1RBLA 3MUVP 4NEYA 3D2WA 1DRZA 4C3LA 3CMES 1PJ7A 1REVB 3CB4A 4TKTA 5KFOA 3KTQA 1FK9A 1WDTA 4X66F 4K5SA 3CPWR 2YWWA 1IM4A 1QE1B 5JXSA 1S97A 1S0OA 1APSA 3K57A 2YWKA 1R6YA 2AX1A 1RK8A 1PJ6A 5MAOA 1CS4A 2PSZA 4FDFA 5E3RA 4I6YA 1GMVA 2FLNA 4NCAA 4OZ1A 1Y5NB 2H9ZA 1Y7PA 3R97A 5E3AA 1BUXA 4A8KA 2DO4A 4LFCF 4C7QA 3DRXA 4MYUA 2QLXA 1WHYA 4CLWA 5C2CA 3GIMA 1FT8A 3MEGB 3EGVA 2HVHA 2GO9A 3LTOA 3DRRB 2ZKUA 3Q89A 4EMDA 1S57A 3TZXA 2XGQA 1TVRA 3A12A 2KZZA 2EWHA 4AQYJ 2QFIA 2HNDA 3A8EA 1Z2LA 1KR4A 3GWCA 2O3DA 3PTWA 4AD6A 1RT2B 1GTEA 2FVSA 1ITPA 2O01C 4X64J 4AXJA 2OPPA 2YNHB 1FNMA 4LF6J 1S1UB 4C4WA 3BSCA 4ZLLA 1VFJA 5FLXY 1YZ6A 4XPCA 4RNNA 1KD1T 2WTFA 4ILMA 1Q16B 2V6AA 1MW7A 4KPCA 3OQ2A 5IQ6A 2LQBA 3SDEB 2NXCA 3N6NA 5HAOA 4AE5A 5F8HA 3MM9B 3PR5B 3I55S 4GKJF 1RKJA 4P6QA 1QAYA 2ZC3A 3GJTB 1R7IA 3A3NB 2W4PA 2YQ1A 1XMQJ 1NCLA 1PILA 1XERA 5IQQA 1ZYQA 2Y1RI 3IA0A 4KKOA 3R7SB 2V9WA 4X4VA 1D9AA 4TU7A 3CO9A 2VG5A 2QSWA 3PACA 4LF8J 3M8PA 4N77A 5KFHA 2J8SA 1ZM2A 3QGGA 1N5TA 4KY3A 2W9CA 2F9DA 2E9ZA 4CO5A 5CQGA 3D3BJ 3NMAA 4A8XA 3FZ2A 1HNXF 4UT4A 5KAKA 5KFSA 4L6V3 4X4RA 3BR9A 1D09B 3W65A 4IO1A 2Q6BA 4NYZA 4Y0FA 2DNOA 4Q8FA 1UVMA 3DHWC 3FVYA 3JTOA 4CLUA 5D0RA 1WORA 4RW9A 4YS2A 4USWA 4ATNA 1V3ZA 1OIAA 1PAUB 4CRJA 7FD1A 1QE1A 5K8MA 3L09A 4Q45A 4IRCA 1IBLJ 1URNA 4YQWA 2JOQA 4DV1F 2W2NP 2XC9A 2QMWA 3FSIA 4I68A 4QIWD 4ED7A 2IM1A 3PFEA 5BYRA 1AUSL 2J6TA 4OYMA 2BOAA 4YR0A 3RB3A 3I32A 2F1FA 3BSNA 4JI8J 2PT0A 4X66J 1FDBA 2VL1A 4F04B 2HMIA 2OEMA 4HH0A 1KN6A 3QIPB 1WACA 4RUHA 3G6VA 3G9CA 3EPIA 4WIIA 4MIAA 3HD1A 1SV5B 3W9IA 4ED3A 2LCWA 2AV5A 1RYSA 1KOHA 2O5DA 5A0YA 4B9VA 2GGPB 2PEHA 4MK8A 4HI1A 1FHTA 1WHXA 2Q43A 3GPAA 5IC4B 1X9SA 3A3OB 4YMEA 1SUQB 4KB7A 4YHHJ 1B64A 1CPZA 3KJQB 3FRYA 1EAYC 1RWWB 5KFLA 4DR2J 3RGIA 2EFGA 3CO0P 2F9JA 3C6TA 2VFRA 2B3TB 5JVHQ 2C3OA 2V67A 1VBXA 3CJ4A 4PG7A 2Z2MA 4ENOA 2ADBA 2HVDA 2VOPA 2QTWA 4KRWA 3TVKA 4YY3J 2VF3A 3MPDA 1H0HB 3OR1B 4K2XA 2QLJB 2EPIA 1T9UA 4L76A 1NDCA 2AT1B 2B0GA 2V2QA 1RWPB 3GONA 3KJFB 3HT0A 3NLCA 5EWFA 4CCHA 1IKXB 3QAUA 1JJ2R 4ZMMA 5IM0A 2DNMA 1MU2A 1P8GA 3B78A 3HZGA 4OI3A 3TWZA 3M2VA 3TUZC 1ZTTA 5CABA 3VAKA 3SSRA 1S6OA 1Q0NA 3AOAA 5DG9A 1SL1A 1TFWA 1S9EA 2BJ9A 4P10A 2DGSA 2XNRA 5KFWA 2DYAA 1S1UA 4KGVB 2JLEA 2OD6A 2MKCA 4NA3A 4ZPVR 2DNYA 4O4GA 4X4NA 2K7KA 1Q81T 1WSRA 1Y0HA 2KJVA 3M4XA 3BS9A 3V2UC 3E01B 4XO0A 2CPDA 4Q44A 4N76A 4X4QA 1DJ0A 1WHVA 2B43A 4MAKA 5L1KA 3OW2R 3V6JA 4LR8A 5HMZA 1IR2A 2A10A 2VD3A 3NWRA 3SDEA 3DLGA 1T0TV 2VFUA 3W5XA 4LSNA 4DFJA 3CW2C 2XSFA 3VVTA 4RZRA 2XG8A 1NK6A 4HKQA 1CQNA 3W66A 4LBPA 2AJ4A 1FKOB 1SIWB 4DV3J 1GQEA 1RWOB 3CJKB 2Y1LB 4WKYA 4LIRA 4L73A 2BABA 2HQDA 3A13A 3LPEA 1HMVA 3QWPA 3UNGC 3LH2S 2UZAA 1FJ7A 3PRBA 3DRSA 3IG1A 1YJTA 4P7TA 5C25B 2LXFA 4HACA 4EBEA 4NI2A 4DUZJ 4W4MA 1HR0F 3Q8YA 1NHKL 5KFGA 4DR1J 1F9EB 2RVJA 3F41A 2BANB 3V6HA 3K0JA 4FYWB 4I64A 3G6ES 4ZLNA 2DITA 3M30B 2CQ2A 3R3TA 4RW9B 4UZBA 4RW6B 1C1CB 3Q2TC 1B0PA 2LEAA 1ZZNA 1ZPWX 4TQSA 1PC4A 3MD3A 1LFWA 3FBBA 4H4KA 2HQIA 2M0GB 5L9XA 4I6WA 3KLFB 1J2VA 3EXCX 2HAIA 2P9EA 3R5AA 2R2SA 2HFSA 1SKRA 2XTJP 4FZVA 4DR4F 3MEEA 2KN4A 5LXRA 2W7OA 2UXCJ 5IZHA 2F5GA 1WKKA 3FUYA 4IUFA 1C0UA 2CA9A 1Q1KA 1PKUA 3SZ2A 5CAAA 1DTTB 2NXUA 3WC2A 5B0BA 5LMUJ 5GAHU 3JYTA 2DRDA 3FMWA 3PYFA 4TVAB 3QZ8A 1X4HA 2NXEA 4UTGA 4D3HA 1P9QC 2KU7A 4IR1A 1GMUA 4MKAA 1UPPA 2R7QA 2OMOA 3SIPB 5IC6B 2ALZA 3AFGA 2NQPA 2OKQA 3BZQA 2DXFA 2PDAA 3PCOB 3SCJE 1UETA 1RLCL 4CM0A 1RAGB 1T3NA 2E5LF 3QLHA 3LAKA 4IKAA 1UVJA 5H9FK 3T1HJ 5KFPA 3DDNA 3H90A 3M2UB 1NMEB 3VAFA 1HI0P 5KTQA 4QW9A 3CD7A 2VDHA 3CMQA 2MQPA 3W2WB 3C14B 2VH7A 3CJTA 2HNYA 4F0KA 1HBNB 4KGXB 3R27A 3DDIA 3DOMB 2UXBJ 4H4OB 2AEFA 2YXLA 2I8EA 4M8LA 3EYZA 4A8YA 2MY7A 1NDLA 2GAHC 3DU5A 4LSNB 2G2YA 3TZWA 4X62F 4C8YA 4J5OA 4MKVA 2C3UA 3ELHA 5EGYA 3OHBA 1SC3B 4I67A 3ZZ0A 4BCAA 4ZN1A 2ZZMA 2R2RA 4YN3B 3V6DA 1JJCB 3LPYA 2IA6A 1KBRA 2ROEA 4ZPBA 4CYUB 2ZD1B 5C25A 1OMSA 3KG0A 3H4BA 1D0EA 2D74B 1U1KA 4TYBA 2AKWB 3P4UB 4CI0B 3O2IA 5HN0A 1Q8BA 4IOBA 3VR1A 2E5GA 4R25A 3QO9B 3I0RB 1NK0A 4P2MA 1MWQA 2JWNA 2OJ3A 1EIYB 4JI5F 4CO1A 2LMIA 4H4KC 1X4FA 1WI6A 1X4BA 1XNQJ 2F8MA 2DNNA 1TP7A 2DH8A 4DSKA 3JTPA 4WFXA 3CDBA 4ECZA 1T7PA 5AXLA 4BWMA 2C2ZB 1S49A 3N01A 2YNHA 1RT3B 1TUWA 3J7YI 1FEEA 2QX0A 2MTLA 3VZIA 1U09A 2OFGX 2YH0A 1AYEA 3IRXA 4GVBA 2CWKA 2MYFA 2UUAF 2RB7A 2WHOA 2YX1A 3MZIA 2WCXA 4PYAA 3E51A 4A8OA 5DQIA 3KHHA 5F8JA 2GIFA 2QL7B 4ZVRB 4MK9A 1PO6A 3D66A 4OIXA 2NSBA 1CJUB 1R0AB 5EX0A 5CHCB 2CVEA 2B51A 2UUTA 3ADAC 1IR0A 3PY8A 4ZVFA 2AYMA 2BEFA 2BM1A 4FYXB 1SJFA 3DU6A 3BDPA 3E2EA 1T02A 5J2MB 1JLCB 1RTIB 1VQOS 5JUMA 3GLJA 3NKYA 4U96A 5B0EA 1UJ6A 1YSJA 3QATA 5H9EJ 3J81j 2WVFA 4Q2MA 3VAJA 4F8RA 2B5JB 2VFVA 3W63A 2F8HA 3O5TB 2W8KA 2XI2A 1T03A 1HLWA 1EQMA 3LA0A 4F25A 4C6AA 1CULA 3H2UB 2UV8G 4WP3A 5A8KB 2PGCA 2KTQA 1KTQA 3Q24A 3C14A 3BBCA 5ETNA 4RX6A 2A3JA 3MAAB 6FD1A 3KHRA 1DZ5A 3BN7A 5HK4A 2R8JA 1MNEA 2DK2A 2HZVA 3ZZYA 3TAQA 4NPOA 1S1XB 1RWKB 1FDAA 1U4BA 4B3RJ 4R0JA 2X7IA 3MTJA 4W90B 3D3CJ 4U9RA 4X64F 1VQ7S 3HVAA 4LF6F 1NK9A 5LJ3Y 2B4VA 1H2TZ 4WBFA 2EW9A 2CVIA 3FKBA 3JXOA 4USJC 1NKBA 1UMJA 2EG1A 2KL8A 4DPXA 2CDRB 4PCQA 1WUUA 3KLIA 1IXKA 3CCES 2RS2A 1BQNB 2FY1A 1UZHA 9RUBA 3LP1B 2DPJA 1N0VC 6FDRA 1GFWB 2YVSA 1EETA 2ZBIA 1KLMB 1R27B 1RKIA 1YRTA 2IMOA 1N33J 2W2MP 4EK2A 4CNYA 5HQ8A 1TV6B 1H3DA 2KG1A 2QA4S 1JX4A 4QR1A 2QLWA 3OL8A 1RU2A 2XULA 4KSEB 1R0CB 2M88A 4IH6A 1MWYA 2QL9B 3MPVA 1S1VB 4RW8B 4DS5A 1UAWA 1KWMA 2DH7A 4H4OA 1JNRB 3NNCA 5ETPA 1G4CA 1KVKA 4YUDA 2FVRA 3DGPA 2QC3A 5J1PA 1NZ8A 3HJVA 4CLLA 1HNXJ 2YNFB 1QUVA 3GU0A 2CAJA 2RKIB 4P2XA 2XMVA 3OR1A 3VCDA 4LSLA 2NXNA 3CJ3A 4ZLPA 2IFXA 1DQ8A 5M2UA 4DR3F 4IG0B 1UEUA 4EFAC 4JI3F 4RNHA 2DNHA 3P3DA 2MJUA 4U8YA 3UI3A 2G0JA 2NUUG 4LF1A 2OTLS 3HVRA 4PQUB 1FKOA 2VV5A 2YKMA 2KFZA 3AOCA 1KQSR 1RJJA 2Q3PA 4AXIA 2VQEF 5LL6d 1M5KC 3GR0A 3C3LA 5ADZA 4CO2A 3M8SA 1N32F 1GEHA 1S9GA 2BW7A 4HDHA 4YDXA 2ZDOA 3D54A 3M6XA 5GAEI 1AUDA 4IH7A 4WXOA 1YBUA 1V6HA 4J9KA 3DLKA 3RB4A 3A4TA 1VQ8S 4QPTA 2UU9J 1VRUA 2A2DA 2IDLA 4JV5J 2B8PA 2KB2A 4OX6A 5EN1A 4DL6A 1RTZA 1JLFB 2ZE2B 1GMWD 2FHKA 4O44A 3DRYA 3HI9A 3TX8A 2C22A 3ZZOA 1KQGB 4J9NA 2AD9A 1C1CA 5LSLA 3UNYA 2C2OB 2ZH7A 2CWXA 2AP6A 1RHQB 3MM5B 4CTAA 4KBIA 1ZOTA 2L9NA 4K4WA 3RYLA 1K47A 1DARA 1I5OB 1R8AA 1T94A 1Y3JA 2MQMA 3BB5A 3S6EA 1VBZA 4J37A 1O51A 1NUEA 3MFIA 2OPRA 3R7BB 3ZXWA 4EI2A 1HR0J 1Y5LB 1U25A 2PD1A 1GXLA 5E3CA 2ABYA 4ZVSB 2C2RA 2GQCA 5HANA 2QT7A 2BJ7A 3DLBA 2ZM6J 2DHXA 4TYAA 1HA1A 1JLAA 4JI2J 2OTJS 1D9FA 2XS2A 1K8AT 1F3VA 4QU6A 3BQ0A 1X5OA 2JZ5A 3RU0A 1M1HA 3PKYA 3C19A 5I3UB 2GVZA 2JC1A 3H40A 1GX5A 2HGNA 3D28A 2OHDA 4F26A 2WZ1A 3B4MA 3BEGB 2OUGA 1KKHA 4C8MA 3VGSA 2IRYA 5KG3A 5L38A 1M5VC 4QCLA 3HHLA 4KHMA 3PW7A 1NSKL 5D77A 4N7TA 3FSYA 1ZM4A 1RXOB 2BZ2A 5BYSA 3KXDA 4ES2A 1YJVA 4M5GA 4C8NA 3OV7A 2DEIA 2F3JA 2ZOMA 1UVLA 2FZKB 1CJKA 2DH9A 3I87A 2BE2B 3JS9A 4NZ0A 5KFTA 5C7PA 1UFKA 3HSGA 4WFZA 4Q0BA 4ZVTB 1RWXB 4NYPA 5L9NA 1P9YA 2ASDA 1VQ6S 3QRRA 1WC0A 4MK7A 4DQPA 5HJYA 5AE1A 3CXCR 2BE2A 4ICLB 1U49A 2ZC4A 4DX7A 2LEPA 1EARA 5D0GA 3DKDA 4U95A 5KFEA 4J9MA 2XYGB 4FVMA 2R7TA 4CYUA 3LP1A 4RUAA 2QFJA 3CCVS 4MIWA 4UQTA 4NLGA 3TJAA 3GIRA 4MJKA 2D3UA 5GAHI 1C1BA 4OZJA 4YR2A 4LFCJ 2XMUA 2H3EB 3MR7A 2E9TA 1FERA 4RW4A 2E5HA 2YY3A 5LMNJ 1X5SA 1FRXA 2LVWA 2CZ4A 3RTVA 4OI4A 3P49B 1S99A 2PFDA 1IBLF 4KV8B 2G2ZA 2B9EA 1NJZA 4NLYA 3N6MA 1ICEB 3VAMA 3PFOA 2GJ2A 3MM6A 2ZH3A 1KFSA 2WRMA 4PG6A 4IQXA 3HKZD 3FMBA 4HHUA 3T1YJ 2LP4A 4DUYF 2BRKA 1JNZB 1IQTA 5EHHA 2XLIA 2LA4A 2BQUA 2X1AA 2EFPA 3T3FA 3GTYX 3NS6A 3OSNA 4OHYA 4DX5A 4NLSA 4USUA 3O1LA 4HACB 3RAQA 2WOMA 1FO1A 2MSTA 3BPSP 2P8IA 3CCWA 2IJNA 2MGZB 4NLUA 3H7HB 2JDJA 4HYKA 4DV5J 1FK9B 4B3TF 3I0SB 4C2MA 1PBUA 3ENVA 1U7LA 2KYZA 1OJ4A 1HFEL 1UTAA 4K7QA 1NK8A 4L3NA 1NKCA 3MXHP 1EZZB 1QAJA 4OX8A 2R7WA 4U7CA 3SYZA 3BO4A 1QLNA 2V8VA 3AHPA 1N52B 4ZIWA 2MSSA 5CZXA 3CCUS 3CJ2A 3L4BC 4JOUA 1FX2A 3NCQA 3NY0A 4MFBA 4NZ6A 2ASYA 4CM2A 2PFFB 2WVDA 4Z37A 3JAMY 3QAEA 4KYZA 2E5JA 2FHMA 5K8OA 2CFXA 3IRXB 3LUYA 3OXLA 1NPKA 1NBEB 1OSDA 3SFGA 4F3MA 4OV6A 4P52A 7FDRA 2VG7B 1KP6A 4E98A 2ZZTA 3NXZA 1N5QA 1Y3KA 4E2FB 5CYQA 1VR6A 2PEBA 2M8DB 3OL7A 3OTOJ 4ELUA 5FIIA 1R8PA 4UOCA 4AUKA 2MLYA 3TQ1A 2R7SA 4YDDB 1DQAA 1PYSB 4FNHA 3U7JA 4Q5VA 3W2WA 2MHEA 2XY5A 2ALYB 3DRPB 4RW4B 3KLGB 1I6JA 3H42A 1VHIA 2DISA 3HHKA 2IC3B 2CQDA 3T5KA 1FJCA 1OYEA 7AT1B 4NLTA 3NP5A 1ZPVA 4HHHA 3ZTPA 4A8QA 2ZH9A 1FXLA 4U7UK 1A7GE 1RHJB 4HH1A 2ZH4A 1B70B 1WC4A 2LXIA 5F9LA 4KAIA 1F9HA 4CNZA 3D0HE 4J91A 4I0WA 2WK4A 3QJPA 4GKKJ 1B7FA 1N6QB 4ZJOA 2QL5B 2IRXA 1VDHA 3QNWB 3N5FA 3DI6A 3AODA 3SQGB 1S0NA 4NCGB 2VFSA 3CVKA 5D15A 4IO9Q 2VG5B 4F2SA 1U24A 1FD2A 4TN2A 3OSPA 1Y4ZB 4DOZA 2Z2LA 3HPOA 4E0DA 1YZ7A 2MKHA 3O6QA 1U1LA 2UVVA 2W9BA 4B3MF 3IXQA 1QD1A 4UF4A 4LF4J 2KRBA 5L8RC 2HQGA 3GFHA 1HKAA 3IAS9 3MM8B 4RO0A 4DMZA 4DR1F 1HBMA 4F3OA 4IRKA 4OHWA 1IKVB 3W2VA 3MCMA 2YWFA 4PXDA 3ZZZA 1WG5A 2VBZA 3GJRB 2XCAA 3DM2B 3EDQB 4NLOA 4I2QB 3W3SA 3TUJC 3PO4A 1PIEA 2R8HA 2M5YA 4ED2A 2OPSB 3FK4A 5I3QA 2YX4A 2WSCC 2AZ3A 1QUPA 4RUBA 1TKZB 3RB6A 2XZDB 2J5AA 2ATLA 2H5EA 4GVBB 3MHYA 4I2QA 2YTCA 1IKYB 1RTHB 4XDDA 1OS5A 2ZWPA 3QPIA 5ETVA 3AB2B 2Z56B 5SUHA 1PCAA 2MB0B 4WJBA 1YJ7A 1YRXA 1EP4B 3UCGA 3MR3A 3TO8A 4WFNQ 3A8JA 1MMDA 1VRTA 2IAJA 2V4RA 2XBPA 2XGPA 5HSPA 3RR8A 1W25A 3ET6B 3OBIA 1BWEA 2AYBA 3MM5A 1H72C 4KE5A 4ZP9A 1VIXA 4I1TA 2CZVC 1JKHB 4M5KA 4ES3A 2F4FA 2HBZB 1ZTWA 4IDKA 3BDEA 1JMTA 4B3SJ 3RR7A 4LF4F 2E5LJ 1RWVB 2APOA 2A1BA 5AE2A 3P45B 3N6LA 4ZCKA 2G2OA 5KFCA 4MKYA 4QOTA 1VQNS 1D8ZA 4B9UA 2VKRA 4RNMA 4ILRA 4MMOA 5CYJA 1IJFB 1TKTA 3DLEB 4A47A 2BXJA 2F63A 3W60A 3QYYA 5JMNA 1X4GA 4DPWA 3R5JB 4K4UA 4QIGA 4CH7A 2ZOFA 4J9LA 2QJ3A 5C42B 5DZ6A 4RJVA 4QR0A 4DCPB 2BR0A 4QBUA 2I2YA 1GXTA 1HBNA 3MEEB 5M2RA 3OXFA 3KLEA 1M90T 1AFJA 1S6QB 5KT5A 4YOEA 4K2JA 1SBRA 1NEEA 2YNGA 2HLUA 3TEGA 3ZTQA 4BDPA 4ZCIA 2AEJA 1DAXA 2DT9A 4PZVA 4C3KA 4DJBA 3IBFB 2NREA 3QJJA 3I5AA 1HNIA 3UW1A 3LP2A 5HQLA 1BY9A 2ZD1A 1DURA 1M0SA 1O6XA 3AOBA 4GO5X 1NB2A 2CPJA 3U1NA 3CC2S 2YPZA 4DSLA 1TVRB 2XO7A 1B99A 1NZAA 3RW6A 1RAAB 1DFDA 3P8BB 3QIDA 1H98A 4ZHRA 1E6VB 2MKYA 3UCUP 3NCPA 3M6VA 1UA1A 4UY8T 1NJYA 3M2RA 5DGAA 3KHLA 1TV6A 4C0BA 3KJNB 1SPBP 3BF4A 5A8RA 3M8QA 1RQ0A 2E29A 5LXYA 4Y00A 1TR0A 1P6TA 2J0XA 3SCLE 1NPPA 4A4JA 4TU9A 1S48A 4KGZB 3HHLC 4LBHA 1YGYA 3MEDB 1NJXA 1HL6A 4YEAA 1FEHA 2V8HA 1ZA2B 1AFIA 4ERDA 4J9UE 5DDPC 3EDRB 3T9NA 3JSYA 4Y2CA 2C3MA 3VAIA 4RBTA 1EB0A 2ZZNA 1QAXA 4B3RF 4ER8A 2M70A 1TK5A 2EFNA 4OLOA 3D6HB 1H6KX 5LSRA 2FY8A 4NXMF 5AJ3F 5IT4A 3MM8A 1PC5A 4GRSA 4ANCA 4OZNA 4PRFA 1V5VA 3F0NA 3IC1A 4DQQA 3PO5A 4CP5A 5MLCV 2HVEA 3POTB 1L3UA 2Y3YA 2DNRA 2BJDA 2B4PA 4OYPA 2MMYA 1EKSA 5GVQA 5B0DA 2LU1A 2C3PA 1FE0A 2FTRA 4G6VB 1MROA 1T11A 3FGVA 2VBXA 4M5NA 1CVJA 3THTA 2GIRA 3TRGA 5J2PB 3JSMA 2XY6A 3CULA 3UVJB 2H5JB 5B0CA 5DG7A 1WKJA 3EGWB 1T03B 4EBDA 4CO0A 4WFAQ 4OYBA 2DGOA 2PIIA 4ZVEA 3UN3A 4CT9A 3I9V9 5KT6A 1SKSA 1FJEB 4LQ9A 1QAIA 4OJGA 2CYYA 4CO3A 4KIAA 1ELOA 2Y0SD 2WSEC 3MD1A 4TY8B 4USTA 5HO4A 2RIJA 1X9MA 1T3OA 3T1HF 1T9TA 2CQGA 3LP2B 2CQBA 3TUIC 1MWZA 4BS2A 3THVA 1RCOB 4ZK7M 1R0AA 3UFCX 5EWEA 2VB6A 2CQHA 1TMJA 2OSRA 2RNEA 3HF5A 2OPRB 4N56A 4PXCA 4DF8A 1IUJA 1U1RA 1Q7YT 1JJ4A 2YKQA 4W98A 3WIVA 1N33F 2YH1A 1WC1A 2G1HA 2MQ8A 3M1VA 4ES1A 4R8UB 1KQFB 4DFKA 1S72S 3T5JA 1MU2B 1SV5A 2KHDA 4HT7A 4DPUA 4DS4A 3ZNJ1 3MMCA 1EHWA 3GJQB 2HHHF 4UOGA 2C2EA 3DCAA 3T6JA 1FKPB 5CH7B 4C8LA 4X65F 1TKTB 3DLEA 5C24B 3VGUA 1UVIA 4DV3F 4ZOSA 1RAHB 2BVZA 3JSRA 3DMJA 4M5HA 1EETB 2NCKL 2WW4A 1TUVA 2FC8A 2GNKA 2IM3A 3QRQA 1S4EA 3IWXA 1XR5A 2CG4A 2HBRB 4I6AA 4DX6A 5AE3A 2B56A 3I56S 1YHQS 2XYPB 4FXWA 5B0AA 2UXDJ 3TVZA 4ZPAA 4OX9F 1OQ3A 1BMQB 4I7FA 1VK8A 2D3ZA 1TAUA 4QYRA 1IWAA 1F0XA 5A6PA 1WG4A 3QT6A 1L3KA 3NAHA 5DO2A 1UA0A 2BUNA 3FRZA 1SJRA 2CJYB 1ZAVA 3D7SB 3QWUA 3MMBA 5F0UA 1HHTP 2VA3A 4LF5J 4X2BA 4USMA 5H9FJ 2V2VA 3PNIA 2C2KB 5E3PA 1V5IB 2MZQA 1VHFA 3C8YA 4NXNF 3K8WA 2BQRA 3RW7A 1SXLA 3POTA 4LSLB 3AQPA 1KTVA 2PA3A 2B7CB 1G7CB 4CLTA 3LANA 3Q8SB 4F3QA 2GW8A 4ZITA 4B9LA 4ECRA 2FJWA 2B9YA 3Q8VA 3SFUA 2KXNB 4URQU 1JXLA 2ZKTA 4ZJLA 2RT3A 2UXCF 4PWDB 2AGQA 1FFSB 1YWXA 4X65J 4JI4J 1FRIA 2CPFA 4IFVB 2V94A 2H1YA 4JI2F 1TUGB 2RU3A 2ZM6F 2K06A 4PXEA 1WNEA 4OHXA 2OLWA 3CJ5A 5CZVA 2BKOA 4WTOB 1VRUB 1IKVA 4O0IA 2XCPA 3KLHB 5GADI 2AGOA 4KV8A 1FKAF 4YR3A 2AMCB 4C8ZA 1QVFR 3MEDA 4M63A 1C4AA 2RSQA 3JQMA 1N5VA 5D4PA 3TX0A 1LWXA 5G0RA 1S5ZA 3W1YC 3R5DA 2OEJA 1HNVA 4I56A 1NK4A 2XLKA 3BJYA 2JFDA 1Z2ZA 2ZUGA 2M9KA 4DQSA 1DTTA 1JWWA 2JX2A 3SQGA 2MLXA 5ETTA 3NBPB 2P2CB 4K4YA 3SI8A 4K0KF 3OFFA 1U8WA 2C28A 1UJ5A 2HWHA 2EKYA 1JXEA 3CUNA 4NXNJ 2NPFA 2RKIA 3OHAA 3OVAA 3PX0A 1WF2A 1T95A 3HCXA 3AH6A 3ILLA 3KDNA 4GC7A 4FPRA 4Y65A 3QT8A 3KK2B 4KT0C 5A8KA 2F4VJ 3MCSA 4USHA 4FKXA 3DOKA 4Q8EA 4DR6F 4CIOA 3H59A 3A8IA 2F40A 5BXIA 3M30A 2EFOA 2CADA 2FGOA 4FKYA 1JLQA 1LWEA 2QA2A 2E1AA 4UW2A 8RUCA 3CDWA 3OJSA 1VMBA 3H5YA 1CC7A 2IYIA 2M7SA 2VPXB 2LECA 1IBCB 2DCLA 3DI6B 4EO8A 3KLVA 4OL8A 1UEKA 3N28A 2DHHA 5KT7A 4DR4J 2HKEA 3ZNUA 1UVNA 5K14A 4DWIA 3V81A 2DHSA 1U1OA 4OYIA 1C0TB 3C6TB 2P9GA 2XWYA 4CLYA 5IV3A 4LSZB 4CLKA 5DZ7A 1T05A 2HS4A 4CTAB 3MECB 1HNIB 1Q7LB 1QY7A 1U0SA 3Q2SC 4UUWA 4UQGA 5L1JA 4ICLA 2CJAA 2MZTA 2QYGA 3UN5A 2B9XA 5HBMB 5K20B 2Q6CA 3NOCA 5GADU 4J9SA 2R8KA 2J0SD 5KG1A 4IYQA 2DNGA 2CQ4A 3HKWA 4OI2A 4JV2A 2P6SA 3IMQJ 3R2DJ 4CQ1A 2DY9A 3PW0A 3IP0A 3I5BA 3D67A 2IVFB 2NZ4A 4IFVA 3FNNA 1HNZF 2GVDB 4LMZA 1NO8A 4Y6IA 1SCJB 5L1LA 2XHCA 1BXNA 2HFOA 2EFQA 3MDFA 1Q8LA 4LR7A 3W9HA 4NCGA 2VZ9A 3S7RA 1GX6A 3UN2A 4A48A 2Y8WA 1N88A 4HL9A 1HWUA 3I6PA 4WIQA 2GHWA 2GX8A 3NG8A 2DKOB 2ZH1A 4IG3B 2RH3A 4B9NA 3K7RA 3P5TL 4HEA9 1RCXB 1LW0B 1OY6A 2HLTA 2MLZA 2Z30B 3X3UA 4FBUA 1IBKF 4JI7J 1NSQA 4Z7CA 1HQUA 4F4AA 2YKPA 4ZKAA 4ZLJA 2O67A 1HWIA 2AHOB 2OI2A 2WBMA 3EWGA 1RT5B 2R3VA 1UW4A 3BYPA 4P2SA 3EVOA 5D0EA 4EUVA 4YB7A 2FZGB 2XSJA 3CCLS 3W2VB 4OV1A 4UOHA 5KFKA 2X3DA 1RABB 2ZDPA 3GP9A 3AA9A 1SQGA 1RHMB 2LQ5A 4AL5A 4PWDA 4WYLA 4ZPWR 1Q5YA 2QLBB 3MM7B 1WI8A 2C2NA 4IG0A 4RW7B 1B0TA 2WONB 1AZSB 1GTHA 3Q83A 4HT5A 3VF0B 4ED1A 5D6GA 1SQEA 1VJQA 2CJBA 1I94F 3KK3B 4LF2A 1U26A 4P73A 3V6KA 1TL1B 2BANA 3SXLA 3HJFA 3AJDA 1MROB 4OYOA 3FDSA 3I82A 4EU0A 4DEZA 3C6UB
chains in the Genus database with same CATH topology
4A8FA 2UVRA 2FJAB 2HNZA 3CC4S 1MSWD 3MGJA 1ROFA 3GV7B 5J2QA 5KT3A 1O5JA 4KPYA 1G1XA 3OUYB 3GZ7A 3GG1A 1GNKA 2HHTA 2ZH6A 2VPYB 3W7BA 1LQ9A 2KDOA 4V19J 1S1TA 1U48A 1FTRA 4NLVA 4LF7F 4U6PA 1I1GA 2BQ3A 1SJQA 2ILYA 3KLIB 2W25A 2MKIA 3FFIB 2DNKA 4E8UA 3K0JA 4F2RA 2QMXA 1RISA 3MUTP 3VAGA 1M5HA 2ZBCA 2WOMB 3MMCB 4ETXA 1RA6A 1NHVA 2Z4PA 5ITHA 1U47A 2LDIA 3P96A 1MMLA 3U1MA 2ZJRQ 2LQJA 2Z8QA 2MZRA 1FCAA 4N8NA 4RW6A 5B09A 5DQGA 1S1VA 4LQ3A 3PIPQ 3G4SS 3CCJS 2NS1B 2G1DA 1X4EA 2HFZA 3GFZA 3MAHA 5KOXA 2JLGA 3LP0A 1UKUA 2W7AA 3DLJA 1DLOA 2HHQA 3TYTA 3OFHA 4ECXA 5D4LA 4K4ZA 3RRHA 4P7VA 2O66A 1J5OB 2C2DA 5DETA 2EK1A 1IKWA 2UU9F 1HPZB 1CG2A 4XIUA 1RTJA 3C46A 4Y3CA 2UXBF 5DDQC 2DD8S 1BC6A 2DNPA 4RLEA 3DFEA 3MMBB 5GAGU 1M5OC 4K50A 5T41A 2EFVA 1KLNA 4KHPF 1FE4A 2MQNA 4F4KA 4N41A 2GIQA 2XMJA 3DLKB 2ADCA 1NH8A 3NRBA 2PE8A 3PR4A 4F02A 3CF5Q 1FKPA 5HI7A 3UR3C 4O3NA 3M8RA 3MWBA 5EUHA 1M1KT 2I9SA 3FQLA 1XC9A 1IJEB 3UCZP 3CCRS 1R3NA 2HHSA 1SC6A 3Q22A 1RT3A 2KT2A 1VQKS 4NL5A 3ISND 4DSFA 5U47A 4X4UA 2YNFA 3GSDA 4HTIA 2WAQD 4R8UA 3FSXA 3G8TA 1VC5A 3V6DB 1BQMA 1RTDA 2B4UA 2HS3A 1QSYA 2PI5A 4IR9A 3ZZUA 3GFXA 2AU0A 2MZSA 4DL5A 4KFBB 1OPIA 4QWBA 1RWUA 2HWTA 4QJVA 4JI7F 1KRPA 4J9PA 4RBUA 3P6YC 2QA1A 3CDAA 5A0YB 3CIMA 2UUWA 4OHVA 1FESA 4Y2AA 3QZ7A 2XLJA 1X0PA 3R5CA 3K59A 1N5YB 1LWCB 5JVGQ 2E1MC 3PW5A 5CXTA 2CJKA 1N54B 1NU4A 3AA8A 1XR6A 3HHLB 3TP2A 3NMRA 3GR1A 3T19A 1K1QA 4GKKF 1N8RT 2FPHX 1PGZA 1N0UA 2K3KA 2OAUA 5KFYA 2FVCA 2JRSA 4RWXA 3SV3A 3A1YG 3BSOA 2FJXA 3J80Y 4WF9Q 2J9DE 1SB6A 2DB1A 2LEBA 2LLZA 5KFVA 2N3OA 5D4NA 1IKXA 1SH2A 2NSCA 3CCSS 1U2RA 4OZ0A 4DDFA 3FEXB 3OJUA 1TZ0A 1F9FA 1WEXA 4DQIA 3H2LA 4ID5A 2ILZA 3PJXA 1U1NA 3LO3A 5KFZA 4FP9A 4DN0A 2V8GA 1TL3A 2W4DA 4K4XA 2RUGA 1FXDA 3CCZA 5BR8F 2HWIA 5DRKA 2G4BA 3GIIA 1VQYA 1KEKA 1VQ9S 4B02A 2HGLA 2FJDB 3N4WA 2K2PA 4Q7AA 3X1LB 3LP0B 5J2NB