1HQXA

R308k arginase variant
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
314
structure length
314
Chain Sequence
b'KPIEIIGAPFSKGQPRGGVEKGPAALRKAGLVEKLKETEYNVRDHGDLAFVDVPNDSPFQIVKNPRSVGKANEQLAAVVAETQKNGTISVVLGGDHSMAIGSISGHARVHPDLCVIWVDAHTDINTPLTTSSGNLHGQPVAFLLKELKGKFPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYIIKTLGIKYFSMTEVDKLGIGKVMEETFSYLLGRKKRPIHLSFDVDGLDPVFTPATGTPVVGGLSYREGLYITEEIYKTGLLSGLDIMEVNPTLGKTPEEVTRTVNTAVALTLSCFGTKKEGNHKPETDYL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ARGINASE
publication title Subunit-subunit interactions in trimeric arginase. Generation of active monomers by mutation of a single amino acid.
pubmed rcsb
source organism Rattus norvegicus
molecule tags Hydrolase
total genus 112
structure length 314
sequence length 314
chains with identical sequence B, C
ec nomenclature ec 3.5.3.1: Arginase.
pdb deposition date 2000-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00491 Arginase Arginase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.800.10 Alpha Beta 3-Layer(aba) Sandwich Arginase; Chain A Ureohydrolase domain 1hqxA00
1P8NA 4GWCA 2PHAA 3M1RA 4G3HA 4MYNA 5HJ9A 4Q41A 2PHOA 3MMRA 4HWWA 1HQHA 4IU1A 1HQFA 3LHLA 1P8PA 4GSMA 3E8ZA 2ZAVA 4ITYA 4RHMA 2CEVA 3E6VA 1P8SA 1TBHA 3E6KA 4IE3A 4MYKA 1D3VA 1T5GA 3RLAA 3CEVA 3TF3A 1ZPEA 4CEVA 1WVBA 3THJA 1PQ3A 5CEVA 4HZEA 1RLAA 4Q3UA 3LP7A 1HQ5A 4Q3TA 4RLAA 1T5FA 3SL1A 4MYFA 3F80A 3NIPA 3MFVA 4Q3VA 4Q3QA 4RHQA 4IXVA 4Q3RC 3MJLA 1TBLA 2A0MA 3MFWA 4IE2A 4MXRA 1T4TA 3E9BA 1P8RA 3LP4A 4GSVA 4GSZA 1CEVA 3SJTA 4FCKA 5HJAA 1WOGA 3THHA 3GN0A 1TA1A 1T4RA 1WOIA 3SL0A 1T4PA 1T4SA 4IE1A 3PZLA 3SKKA 1WOHA 4RHIA 1HQXA 4DZ4A 1ZPGA 4Q40A 4IU4A 1P8OA 3KV2A 4Q3RA 4I06A 2PLLA 3NIQA 5RLAA 2EF5A 4IU0A 1GQ6A 4RHKA 4IU5A 2RLAA 4FCIA 1GQ7A 3NIOA 3TH7A 4RHJA 1P8MA 1WVAA 4GWDA 2AEBA 3E8QA 1R1OA 1TBJA 2EIVA 4IXUA 4Q42A 4HXQA 1XFKA 3THEA 2EF4A 3DJ8A 3GMZA 4RHLA 4Q3SA 1P8QA 4MYLA 4Q3PA 1HQGA
chains in the Genus database with same CATH superfamily
1P8NA 5DC8A 1T69A 4GWCA 2PHAA 3M1RA 3EZTA 4G3HA 4MYNA 5HJ9A 4BKXB 4Q41A 3MZ3A 1C3SA 2PHOA 3MMRA 3MZ7A 4HWWA 1HQHA 4IU1A 5EFJD 1HQFA 4BZ7A 3SFHA 3LHLA 1P8PA 4ZURA 5EEIA 3MZ6A 3E8ZA 4GSMA 4QA3A 2ZAVA 4ZUQA 4ITYA 4RHMA 2CEVA 5DC6A 3EZPA 3E6VA 1P8SA 5EEFA 1TBHA 3C0YA 3E6KA 1ZZ0A 4IE3A 4MYKA 5G12A 1D3VA 4BZ8A 3ZNRA 4RN0A 1T5GA 3RLAA 3CEVA 3TF3A 5A2SA 1ZPEA 4CEVA 1WVBA 2VQWG 1ZZ1A 4BZ5A 3THJA 5EF8A 5G17A 4ZUNA 4QA7A 5G0JA 1PQ3A 5G1CA 5CEVA 4HZEA 1RLAA 2VCGA 5G0XA 3MZ4A 3F0RA 5EFKB 4ZUPA 4Q3UA 5G10A 4CBYA 5EEMA 3LP7A 5THSA 1HQ5A 4Q3TA 4RLAA 5D1DA 1T5FA 5FUEA 5G3WA 3SL1A 5THVA 5G1BA 3C0ZA 5D1BA 5BWZA 4MYFA 3F80A 1T67A 4QA6A 4ZUMA 3MFVA 3NIPA 4Q3VA 5LI3A 4Q3QA 4RHQA 4BZ9A 4IXVA 5EENA 1T64A 4Q3RC 5EFNA 4QA4A 3MJLA 1TBLA 2A0MA 3MFWA 4IE2A 4LXZA 4MXRA 1T4TA 3RQDA 5EFGA 3Q9BA 3ZNSA 1P8RA 3E9BA 4QA1A 1ZZ3A 1VKGA 3LP4A 5EFBD 4GSVA 4GSZA 4ZUOA 4A69A 1CEVA 3SJTA 3MENA 4RN1A 4FCKA 4RN2A 5HJAA 2VQQA 1WOGA 3THHA 5G0HA 3GN0A 2V5XA 1TA1A 3EW8A 1T4RA 1WOIA 5EF7A 3SL0A 1T4PA 1T4SA 4IE1A 3PZLA 4QA0A 5EEKA 3SKKA 1WOHA 4RHIA 5DC7A 1HQXA 3EWFA 3F07A 4QA2A 5EFHA 3MAXA 4DZ4A 5THTA 1ZPGA 4Q40A 5G0GA 4IU4A 1C3RA 1P8OA 3KV2A 4Q3RA 3F06A 4LY1A 5IWGA 4I06A 2PLLA 3NIQA 5G0YA 5RLAA 2EF5A 4CBTA 2VQMA 4IU0A 1GQ6A 4RHKA 5DC5A 2VQOA 4QA5A 3Q9CA 4IU5A 5ICNB 2VQJA 5THUA 2RLAA 4FCIA 1GQ7A 3NIOA 3TH7A 4RHJA 3SFFA 2GH6A 1P8MA 1WVAA 4GWDA 5FCWA 5IX0A 2AEBA 3E8QA 1R1OA 2VQVA 1TBJA 2EIVA 4IXUA 4Q42A 4CQFA 4BZ6A 4HXQA 5G11A 5G0IA 1W22A 2V5WA 5G13A 1XFKA 3THEA 1C3PA 2EF4A 5D1CA 3DJ8A 3GMZA 3Q9EA 4RHLA 4Q3SA 3C10A 1P8QA 3Q9FA 5JI5A 4MYLA 4Q3PA 5G1AA 1HQGA
chains in the Genus database with same CATH topology
1P8NA 4GWCA 2PHAA 3M1RA 4G3HA 4MYNA 5HJ9A 4Q41A 2PHOA 3MMRA 4HWWA 1HQHA 4IU1A 1HQFA 3LHLA 1P8PA 4GSMA 3E8ZA 2ZAVA 4ITYA 4RHMA 2CEVA 3E6VA 1P8SA 1TBHA 3E6KA 4IE3A 4MYKA 1D3VA 1T5GA 3RLAA 3CEVA 3TF3A 1ZPEA 4CEVA 1WVBA 3THJA 1PQ3A 5CEVA 4HZEA 1RLAA 4Q3UA 3LP7A 1HQ5A 4Q3TA 4RLAA 1T5FA 3SL1A 4MYFA 3F80A 3NIPA 3MFVA 4Q3VA 4Q3QA 4RHQA 4IXVA 4Q3RC 3MJLA 1TBLA 2A0MA 3MFWA 4IE2A 4MXRA 1T4TA 3E9BA 1P8RA 3LP4A 4GSVA 4GSZA 1CEVA 3SJTA 4FCKA 5HJAA 1WOGA 3THHA 3GN0A 1TA1A 1T4RA 1WOIA 3SL0A 1T4PA 1T4SA 4IE1A 3PZLA 3SKKA 1WOHA 4RHIA 1HQXA 4DZ4A 1ZPGA 4Q40A 4IU4A 1P8OA 3KV2A 4Q3RA 4I06A 2PLLA 3NIQA 5RLAA 2EF5A 4IU0A 1GQ6A 4RHKA 4IU5A 2RLAA 4FCIA 1GQ7A 3NIOA 3TH7A 4RHJA 1P8MA 1WVAA 4GWDA 2AEBA 3E8QA 1R1OA 1TBJA 2EIVA 4IXUA 4Q42A 4HXQA 1XFKA 3THEA 2EF4A 3DJ8A 3GMZA 4RHLA 4Q3SA 1P8QA 4MYLA 4Q3PA 1HQGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P8N A;  4GWC A;  2PHA A;  3M1R A;  4G3H A;  4MYN A;  5HJ9 A;  4Q41 A;  2PHO A;  3MMR A;  4HWW A;  1HQH A;  4IU1 A;  1HQF A;  3LHL A;  1P8P A;  4GSM A;  3E8Z A;  2ZAV A;  4ITY A;  4RHM A;  2CEV A;  3E6V A;  1P8S A;  1TBH A;  3E6K A;  4IE3 A;  4MYK A;  1D3V A;  1T5G A;  3RLA A;  3CEV A;  3TF3 A;  1ZPE A;  4CEV A;  1WVB A;  3THJ A;  1PQ3 A;  5CEV A;  4HZE A;  1RLA A;  4Q3U A;  3LP7 A;  1HQ5 A;  4Q3T A;  4RLA A;  1T5F A;  3SL1 A;  4MYF A;  3F80 A;  3NIP A;  3MFV A;  4Q3V A;  4Q3Q A;  4RHQ A;  4IXV A;  4Q3R C;  3MJL A;  1TBL A;  2A0M A;  3MFW A;  4IE2 A;  4MXR A;  1T4T A;  3E9B A;  1P8R A;  3LP4 A;  4GSV A;  4GSZ A;  1CEV A;  3SJT A;  4FCK A;  5HJA A;  1WOG A;  3THH A;  3GN0 A;  1TA1 A;  1T4R A;  1WOI A;  3SL0 A;  1T4P A;  1T4S A;  4IE1 A;  3PZL A;  3SKK A;  1WOH A;  4RHI A;  1HQX A;  4DZ4 A;  1ZPG A;  4Q40 A;  4IU4 A;  1P8O A;  3KV2 A;  4Q3R A;  4I06 A;  2PLL A;  3NIQ A;  5RLA A;  2EF5 A;  4IU0 A;  1GQ6 A;  4RHK A;  4IU5 A;  2RLA A;  4FCI A;  1GQ7 A;  3NIO A;  3TH7 A;  4RHJ A;  1P8M A;  1WVA A;  4GWD A;  2AEB A;  3E8Q A;  1R1O A;  1TBJ A;  2EIV A;  4IXU A;  4Q42 A;  4HXQ A;  1XFK A;  3THE A;  2EF4 A;  3DJ8 A;  3GMZ A;  4RHL A;  4Q3S A;  1P8Q A;  4MYL A;  4Q3P A;  1HQG A; 
#chains in the Genus database with same CATH topology
 1P8N A;  5DC8 A;  1T69 A;  4GWC A;  2PHA A;  3M1R A;  3EZT A;  4G3H A;  4MYN A;  5HJ9 A;  4BKX B;  4Q41 A;  3MZ3 A;  1C3S A;  2PHO A;  3MMR A;  3MZ7 A;  4HWW A;  1HQH A;  4IU1 A;  5EFJ D;  1HQF A;  4BZ7 A;  3SFH A;  3LHL A;  1P8P A;  4ZUR A;  5EEI A;  3MZ6 A;  3E8Z A;  4GSM A;  4QA3 A;  2ZAV A;  4ZUQ A;  4ITY A;  4RHM A;  2CEV A;  5DC6 A;  3EZP A;  3E6V A;  1P8S A;  5EEF A;  1TBH A;  3C0Y A;  3E6K A;  1ZZ0 A;  4IE3 A;  4MYK A;  5G12 A;  1D3V A;  4BZ8 A;  3ZNR A;  4RN0 A;  1T5G A;  3RLA A;  3CEV A;  3TF3 A;  5A2S A;  1ZPE A;  4CEV A;  1WVB A;  2VQW G;  1ZZ1 A;  4BZ5 A;  3THJ A;  5EF8 A;  5G17 A;  4ZUN A;  4QA7 A;  5G0J A;  1PQ3 A;  5G1C A;  5CEV A;  4HZE A;  1RLA A;  2VCG A;  5G0X A;  3MZ4 A;  3F0R A;  5EFK B;  4ZUP A;  4Q3U A;  5G10 A;  4CBY A;  5EEM A;  3LP7 A;  5THS A;  1HQ5 A;  4Q3T A;  4RLA A;  5D1D A;  1T5F A;  5FUE A;  5G3W A;  3SL1 A;  5THV A;  5G1B A;  3C0Z A;  5D1B A;  5BWZ A;  4MYF A;  3F80 A;  1T67 A;  4QA6 A;  4ZUM A;  3MFV A;  3NIP A;  4Q3V A;  5LI3 A;  4Q3Q A;  4RHQ A;  4BZ9 A;  4IXV A;  5EEN A;  1T64 A;  4Q3R C;  5EFN A;  4QA4 A;  3MJL A;  1TBL A;  2A0M A;  3MFW A;  4IE2 A;  4LXZ A;  4MXR A;  1T4T A;  3RQD A;  5EFG A;  3Q9B A;  3ZNS A;  1P8R A;  3E9B A;  4QA1 A;  1ZZ3 A;  1VKG A;  3LP4 A;  5EFB D;  4GSV A;  4GSZ A;  4ZUO A;  4A69 A;  1CEV A;  3SJT A;  3MEN A;  4RN1 A;  4FCK A;  4RN2 A;  5HJA A;  2VQQ A;  1WOG A;  3THH A;  5G0H A;  3GN0 A;  2V5X A;  1TA1 A;  3EW8 A;  1T4R A;  1WOI A;  5EF7 A;  3SL0 A;  1T4P A;  1T4S A;  4IE1 A;  3PZL A;  4QA0 A;  5EEK A;  3SKK A;  1WOH A;  4RHI A;  5DC7 A;  1HQX A;  3EWF A;  3F07 A;  4QA2 A;  5EFH A;  3MAX A;  4DZ4 A;  5THT A;  1ZPG A;  4Q40 A;  5G0G A;  4IU4 A;  1C3R A;  1P8O A;  3KV2 A;  4Q3R A;  3F06 A;  4LY1 A;  5IWG A;  4I06 A;  2PLL A;  3NIQ A;  5G0Y A;  5RLA A;  2EF5 A;  4CBT A;  2VQM A;  4IU0 A;  1GQ6 A;  4RHK A;  5DC5 A;  2VQO A;  4QA5 A;  3Q9C A;  4IU5 A;  5ICN B;  2VQJ A;  5THU A;  2RLA A;  4FCI A;  1GQ7 A;  3NIO A;  3TH7 A;  4RHJ A;  3SFF A;  2GH6 A;  1P8M A;  1WVA A;  4GWD A;  5FCW A;  5IX0 A;  2AEB A;  3E8Q A;  1R1O A;  2VQV A;  1TBJ A;  2EIV A;  4IXU A;  4Q42 A;  4CQF A;  4BZ6 A;  4HXQ A;  5G11 A;  5G0I A;  1W22 A;  2V5W A;  5G13 A;  1XFK A;  3THE A;  1C3P A;  2EF4 A;  5D1C A;  3DJ8 A;  3GMZ A;  3Q9E A;  4RHL A;  4Q3S A;  3C10 A;  1P8Q A;  3Q9F A;  5JI5 A;  4MYL A;  4Q3P A;  5G1A A;  1HQG A; 
#chains in the Genus database with same CATH homology
 1P8N A;  4GWC A;  2PHA A;  3M1R A;  4G3H A;  4MYN A;  5HJ9 A;  4Q41 A;  2PHO A;  3MMR A;  4HWW A;  1HQH A;  4IU1 A;  1HQF A;  3LHL A;  1P8P A;  4GSM A;  3E8Z A;  2ZAV A;  4ITY A;  4RHM A;  2CEV A;  3E6V A;  1P8S A;  1TBH A;  3E6K A;  4IE3 A;  4MYK A;  1D3V A;  1T5G A;  3RLA A;  3CEV A;  3TF3 A;  1ZPE A;  4CEV A;  1WVB A;  3THJ A;  1PQ3 A;  5CEV A;  4HZE A;  1RLA A;  4Q3U A;  3LP7 A;  1HQ5 A;  4Q3T A;  4RLA A;  1T5F A;  3SL1 A;  4MYF A;  3F80 A;  3NIP A;  3MFV A;  4Q3V A;  4Q3Q A;  4RHQ A;  4IXV A;  4Q3R C;  3MJL A;  1TBL A;  2A0M A;  3MFW A;  4IE2 A;  4MXR A;  1T4T A;  3E9B A;  1P8R A;  3LP4 A;  4GSV A;  4GSZ A;  1CEV A;  3SJT A;  4FCK A;  5HJA A;  1WOG A;  3THH A;  3GN0 A;  1TA1 A;  1T4R A;  1WOI A;  3SL0 A;  1T4P A;  1T4S A;  4IE1 A;  3PZL A;  3SKK A;  1WOH A;  4RHI A;  1HQX A;  4DZ4 A;  1ZPG A;  4Q40 A;  4IU4 A;  1P8O A;  3KV2 A;  4Q3R A;  4I06 A;  2PLL A;  3NIQ A;  5RLA A;  2EF5 A;  4IU0 A;  1GQ6 A;  4RHK A;  4IU5 A;  2RLA A;  4FCI A;  1GQ7 A;  3NIO A;  3TH7 A;  4RHJ A;  1P8M A;  1WVA A;  4GWD A;  2AEB A;  3E8Q A;  1R1O A;  1TBJ A;  2EIV A;  4IXU A;  4Q42 A;  4HXQ A;  1XFK A;  3THE A;  2EF4 A;  3DJ8 A;  3GMZ A;  4RHL A;  4Q3S A;  1P8Q A;  4MYL A;  4Q3P A;  1HQG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...