1HQZ1

Cofilin homology domain of a yeast actin-binding protein abp1p
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
139
structure length
139
Chain Sequence
LEPIDYTTHSREIDAEYLKIVRGSDPDTTWLIISPNAKKEYEPESTGSSFHDFLQLFDETKVQYGLARVSPPGSDVEKIIIIGWCPDSAPLKTRASFAANFAAVANNLFKGYHVQVTARDEDDLDENELLMKISNAAGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Phased translation function revisited: structure solution of the cofilin-homology domain from yeast actin-binding protein 1 using six-dimensional searches.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Structural protein
molecule keywords ACTIN-BINDING PROTEIN
total genus 36
structure length 139
sequence length 139
chains with identical sequence 2, 3, 4, 5, 6, 7, 8, 9
ec nomenclature
pdb deposition date 2000-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF00241 Cofilin_ADF Cofilin/tropomyosin-type actin-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.20.10 Alpha Beta 3-Layer(aba) Sandwich Severin Severin 1hqz100
2MOTA 1J72A 5KYXB 1F7SA 1PD0A 4PKHB 5A1MA 3EGXA 2MP4A 1UDMA 3CJCG 3EGDA 1NLVG 1YVNG 1M2VB 3A5LS 2LJ8A 2FF6G 5FAFA 3L50A 1SVQA 3CI5G 5KYUA 3A5MS 1MDUA 1M2OA 1T3YA 1M4JA 2HD7A 1V6FA 1NMDG 4CBUG 1P8XA 5KYUB 1NPHA 2FH4A 2VACA 1D0NA 1T2LA 3FFKA 4PKGG 5KYYA 5KYWB 2W0IA 2FH3A 1WNJA 2I2QA 2XF1A 1WFSA 2LLFA 5FAEA 2LXXA 4Z94G 5IVUA 5KYWA 3EG9A 1COFA 1D4XG 3EGDB 2FGHA 1M2VA 1WM4A 5HVKD 2NUPB 4LIZA 2VIKA 1AK6A 1P8ZG 1SVYA 4S10C 2NUPA 4BEX1 3TU5B 2XFAA 3CIPG 2QTVA 1JHWA 3FG6A 4CBWG 5KYYB 1CNUA 2MV2A 5DD2A 1TMWA 1ESVS 1NM1G 2FH2A 1PCXA 1C0FS 4KEDA 3A5NS 1T44G 1Q8GA 4CBXG 1C0GS 1X67A 3EG9B 4KEFA 1AK7A 1HQZ1 2NUTB 2KVKA 3CJBG 1QPVA 3EGXB 1H1VG 4JD2H 5L6WC 3EFOB 1TVJA 2NUTA 2FF3A 3A5OS 4PKIG 3EH1A 1DEJS 5HVKB 3Q2BA 3FFNA 1EQYS 1RGIG 3EFOA 1AHQA 1SVRA 5KYNA 2L72A 1Q8XA 4KEEA 3FG7A 2D8BA 1YAGG 1T3XA 1KCQA 5KYXA 3DAWB 3EH2A 1PD1A 2VILA 1VKKA 1VFQA 1CFYA 2FH1A
chains in the Genus database with same CATH superfamily
2MOTA 1J72A 5KYXB 1F7SA 1PD0A 4PKHB 5A1MA 3EGXA 2MP4A 1UDMA 3CJCG 3EGDA 1NLVG 1YVNG 1M2VB 3A5LS 2LJ8A 2FF6G 5FAFA 3L50A 1SVQA 3CI5G 5KYUA 3A5MS 1MDUA 1M2OA 1T3YA 1M4JA 2HD7A 1V6FA 1NMDG 4CBUG 1P8XA 5KYUB 1NPHA 2FH4A 2VACA 1D0NA 1T2LA 3FFKA 4PKGG 5KYYA 5KYWB 2W0IA 2FH3A 1WNJA 2I2QA 2XF1A 1WFSA 2LLFA 5FAEA 2LXXA 4Z94G 5IVUA 5KYWA 3EG9A 1COFA 1D4XG 3EGDB 2FGHA 1M2VA 1WM4A 5HVKD 2NUPB 4LIZA 2VIKA 1AK6A 1P8ZG 1SVYA 4S10C 2NUPA 4BEX1 3TU5B 2XFAA 3CIPG 2QTVA 1JHWA 3FG6A 4CBWG 5KYYB 1CNUA 2MV2A 5DD2A 1TMWA 1ESVS 1NM1G 2FH2A 1PCXA 1C0FS 4KEDA 3A5NS 3DA7A 1T44G 1Q8GA 4CBXG 1C0GS 1X67A 3EG9B 4KEFA 1AK7A 1HQZ1 2NUTB 2KVKA 3CJBG 1QPVA 3EGXB 1H1VG 4JD2H 5L6WC 3EFOB 1TVJA 2NUTA 2FF3A 3A5OS 4PKIG 3EH1A 1DEJS 5HVKB 3Q2BA 3FFNA 1EQYS 1RGIG 3EFOA 1AHQA 1SVRA 5KYNA 2L72A 1Q8XA 4KEEA 3FG7A 2D8BA 1YAGG 1T3XA 1KCQA 5KYXA 3DAWB 3EH2A 1PD1A 2VILA 1VKKA 1VFQA 1CFYA 2FH1A
chains in the Genus database with same CATH topology
2MOTA 1J72A 5KYXB 1F7SA 1PD0A 4PKHB 5A1MA 3EGXA 2MP4A 1UDMA 3CJCG 3EGDA 1NLVG 1YVNG 1M2VB 3A5LS 2LJ8A 2FF6G 5FAFA 3L50A 1SVQA 3CI5G 5KYUA 3A5MS 1MDUA 1M2OA 1T3YA 1M4JA 2HD7A 1V6FA 1NMDG 4CBUG 1P8XA 5KYUB 1NPHA 2FH4A 2VACA 1D0NA 1T2LA 3FFKA 4PKGG 5KYYA 5KYWB 2W0IA 2FH3A 1WNJA 2I2QA 2XF1A 1WFSA 2LLFA 5FAEA 2LXXA 4Z94G 5IVUA 5KYWA 3EG9A 1COFA 1D4XG 3EGDB 2FGHA 1M2VA 1WM4A 5HVKD 2NUPB 4LIZA 2VIKA 1AK6A 1P8ZG 1SVYA 4S10C 2NUPA 4BEX1 3TU5B 2XFAA 3CIPG 2QTVA 1JHWA 3FG6A 4CBWG 5KYYB 1CNUA 2MV2A 5DD2A 1TMWA 1ESVS 1NM1G 2FH2A 1PCXA 1C0FS 4KEDA 3A5NS 3DA7A 1T44G 1Q8GA 4CBXG 1C0GS 1X67A 3EG9B 4KEFA 1AK7A 1HQZ1 2NUTB 2KVKA 3CJBG 1QPVA 3EGXB 1H1VG 4JD2H 5L6WC 3EFOB 1TVJA 2NUTA 2FF3A 3A5OS 4PKIG 3EH1A 1DEJS 5HVKB 3Q2BA 3FFNA 1EQYS 1RGIG 3EFOA 1AHQA 1SVRA 5KYNA 2L72A 1Q8XA 4KEEA 3FG7A 2D8BA 1YAGG 1T3XA 1KCQA 5KYXA 3DAWB 3EH2A 1PD1A 2VILA 1VKKA 1VFQA 1CFYA 2FH1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MOT A;  1J72 A;  5KYX B;  1F7S A;  1PD0 A;  4PKH B;  5A1M A;  3EGX A;  2MP4 A;  1UDM A;  3CJC G;  3EGD A;  1NLV G;  1YVN G;  1M2V B;  3A5L S;  2LJ8 A;  2FF6 G;  5FAF A;  3L50 A;  1SVQ A;  3CI5 G;  5KYU A;  3A5M S;  1MDU A;  1M2O A;  1T3Y A;  1M4J A;  2HD7 A;  1V6F A;  1NMD G;  4CBU G;  1P8X A;  5KYU B;  1NPH A;  2FH4 A;  2VAC A;  1D0N A;  1T2L A;  3FFK A;  4PKG G;  5KYY A;  5KYW B;  2W0I A;  2FH3 A;  1WNJ A;  2I2Q A;  2XF1 A;  1WFS A;  2LLF A;  5FAE A;  2LXX A;  4Z94 G;  5IVU A;  5KYW A;  3EG9 A;  1COF A;  1D4X G;  3EGD B;  2FGH A;  1M2V A;  1WM4 A;  5HVK D;  2NUP B;  4LIZ A;  2VIK A;  1AK6 A;  1P8Z G;  1SVY A;  4S10 C;  2NUP A;  4BEX 1;  3TU5 B;  2XFA A;  3CIP G;  2QTV A;  1JHW A;  3FG6 A;  4CBW G;  5KYY B;  1CNU A;  2MV2 A;  5DD2 A;  1TMW A;  1ESV S;  1NM1 G;  2FH2 A;  1PCX A;  1C0F S;  4KED A;  3A5N S;  1T44 G;  1Q8G A;  4CBX G;  1C0G S;  1X67 A;  3EG9 B;  4KEF A;  1AK7 A;  1HQZ 1;  2NUT B;  2KVK A;  3CJB G;  1QPV A;  3EGX B;  1H1V G;  4JD2 H;  5L6W C;  3EFO B;  1TVJ A;  2NUT A;  2FF3 A;  3A5O S;  4PKI G;  3EH1 A;  1DEJ S;  5HVK B;  3Q2B A;  3FFN A;  1EQY S;  1RGI G;  3EFO A;  1AHQ A;  1SVR A;  5KYN A;  2L72 A;  1Q8X A;  4KEE A;  3FG7 A;  2D8B A;  1YAG G;  1T3X A;  1KCQ A;  5KYX A;  3DAW B;  3EH2 A;  1PD1 A;  2VIL A;  1VKK A;  1VFQ A;  1CFY A;  2FH1 A; 
#chains in the Genus database with same CATH topology
 2MOT A;  1J72 A;  5KYX B;  1F7S A;  1PD0 A;  4PKH B;  5A1M A;  3EGX A;  2MP4 A;  1UDM A;  3CJC G;  3EGD A;  1NLV G;  1YVN G;  1M2V B;  3A5L S;  2LJ8 A;  2FF6 G;  5FAF A;  3L50 A;  1SVQ A;  3CI5 G;  5KYU A;  3A5M S;  1MDU A;  1M2O A;  1T3Y A;  1M4J A;  2HD7 A;  1V6F A;  1NMD G;  4CBU G;  1P8X A;  5KYU B;  1NPH A;  2FH4 A;  2VAC A;  1D0N A;  1T2L A;  3FFK A;  4PKG G;  5KYY A;  5KYW B;  2W0I A;  2FH3 A;  1WNJ A;  2I2Q A;  2XF1 A;  1WFS A;  2LLF A;  5FAE A;  2LXX A;  4Z94 G;  5IVU A;  5KYW A;  3EG9 A;  1COF A;  1D4X G;  3EGD B;  2FGH A;  1M2V A;  1WM4 A;  5HVK D;  2NUP B;  4LIZ A;  2VIK A;  1AK6 A;  1P8Z G;  1SVY A;  4S10 C;  2NUP A;  4BEX 1;  3TU5 B;  2XFA A;  3CIP G;  2QTV A;  1JHW A;  3FG6 A;  4CBW G;  5KYY B;  1CNU A;  2MV2 A;  5DD2 A;  1TMW A;  1ESV S;  1NM1 G;  2FH2 A;  1PCX A;  1C0F S;  4KED A;  3A5N S;  3DA7 A;  1T44 G;  1Q8G A;  4CBX G;  1C0G S;  1X67 A;  3EG9 B;  4KEF A;  1AK7 A;  1HQZ 1;  2NUT B;  2KVK A;  3CJB G;  1QPV A;  3EGX B;  1H1V G;  4JD2 H;  5L6W C;  3EFO B;  1TVJ A;  2NUT A;  2FF3 A;  3A5O S;  4PKI G;  3EH1 A;  1DEJ S;  5HVK B;  3Q2B A;  3FFN A;  1EQY S;  1RGI G;  3EFO A;  1AHQ A;  1SVR A;  5KYN A;  2L72 A;  1Q8X A;  4KEE A;  3FG7 A;  2D8B A;  1YAG G;  1T3X A;  1KCQ A;  5KYX A;  3DAW B;  3EH2 A;  1PD1 A;  2VIL A;  1VKK A;  1VFQ A;  1CFY A;  2FH1 A; 
#chains in the Genus database with same CATH homology
 2MOT A;  1J72 A;  5KYX B;  1F7S A;  1PD0 A;  4PKH B;  5A1M A;  3EGX A;  2MP4 A;  1UDM A;  3CJC G;  3EGD A;  1NLV G;  1YVN G;  1M2V B;  3A5L S;  2LJ8 A;  2FF6 G;  5FAF A;  3L50 A;  1SVQ A;  3CI5 G;  5KYU A;  3A5M S;  1MDU A;  1M2O A;  1T3Y A;  1M4J A;  2HD7 A;  1V6F A;  1NMD G;  4CBU G;  1P8X A;  5KYU B;  1NPH A;  2FH4 A;  2VAC A;  1D0N A;  1T2L A;  3FFK A;  4PKG G;  5KYY A;  5KYW B;  2W0I A;  2FH3 A;  1WNJ A;  2I2Q A;  2XF1 A;  1WFS A;  2LLF A;  5FAE A;  2LXX A;  4Z94 G;  5IVU A;  5KYW A;  3EG9 A;  1COF A;  1D4X G;  3EGD B;  2FGH A;  1M2V A;  1WM4 A;  5HVK D;  2NUP B;  4LIZ A;  2VIK A;  1AK6 A;  1P8Z G;  1SVY A;  4S10 C;  2NUP A;  4BEX 1;  3TU5 B;  2XFA A;  3CIP G;  2QTV A;  1JHW A;  3FG6 A;  4CBW G;  5KYY B;  1CNU A;  2MV2 A;  5DD2 A;  1TMW A;  1ESV S;  1NM1 G;  2FH2 A;  1PCX A;  1C0F S;  4KED A;  3A5N S;  3DA7 A;  1T44 G;  1Q8G A;  4CBX G;  1C0G S;  1X67 A;  3EG9 B;  4KEF A;  1AK7 A;  1HQZ 1;  2NUT B;  2KVK A;  3CJB G;  1QPV A;  3EGX B;  1H1V G;  4JD2 H;  5L6W C;  3EFO B;  1TVJ A;  2NUT A;  2FF3 A;  3A5O S;  4PKI G;  3EH1 A;  1DEJ S;  5HVK B;  3Q2B A;  3FFN A;  1EQY S;  1RGI G;  3EFO A;  1AHQ A;  1SVR A;  5KYN A;  2L72 A;  1Q8X A;  4KEE A;  3FG7 A;  2D8B A;  1YAG G;  1T3X A;  1KCQ A;  5KYX A;  3DAW B;  3EH2 A;  1PD1 A;  2VIL A;  1VKK A;  1VFQ A;  1CFY A;  2FH1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...