1HQZ1

Cofilin homology domain of a yeast actin-binding protein abp1p
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
139
structure length
139
Chain Sequence
LEPIDYTTHSREIDAEYLKIVRGSDPDTTWLIISPNAKKEYEPESTGSSFHDFLQLFDETKVQYGLARVSPPGSDVEKIIIIGWCPDSAPLKTRASFAANFAAVANNLFKGYHVQVTARDEDDLDENELLMKISNAAGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Phased translation function revisited: structure solution of the cofilin-homology domain from yeast actin-binding protein 1 using six-dimensional searches.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Structural protein
molecule keywords ACTIN-BINDING PROTEIN
total genus 36
structure length 139
sequence length 139
chains with identical sequence 2, 3, 4, 5, 6, 7, 8, 9
ec nomenclature
pdb deposition date 2000-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF00241 Cofilin_ADF Cofilin/tropomyosin-type actin-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.20.10 Alpha Beta 3-Layer(aba) Sandwich Severin Severin 1hqz100
2FH3A 1WFSA 5IVUA 3CJCG 1D4XG 3DAWB 1AK6A 2XF1A 3A5OS 2FH1A 4CBWG 1H1VG 2LXXA 1AHQA 1COFA 2LLFA 3A5NS 1M2VB 2HD7A 2FF3A 1ESVS 1DEJS 4LIZA 1Q8XA 1NPHA 1PCXA 5KYYB 1UDMA 2VILA 2KVKA 3EH2A 2NUPB 3A5MS 3FFKA 1CFYA 5KYUA 1VKKA 1TMWA 1J72A 1M4JA 2D8BA 1P8ZG 1T3YA 2LJ8A 3EGDA 2FGHA 3FG6A 4JD2H 1HQZ1 4S10C 3FFNA 1T44G 5KYWB 1T3XA 1Q8GA 5A1MA 1VFQA 1KCQA 2VIKA 2W0IA 5FAEA 3EGXA 1F7SA 1RGIG 2L72A 2QTVA 1C0GS 3EG9A 5KYXA 1CNUA 3EFOB 1QPVA 5DD2A 1V6FA 2FH2A 4Z94G 4BEX1 1M2OA 2NUTA 1P8XA 1WNJA 1SVYA 2VACA 1YVNG 4PKGG 4CBUG 1AK7A 3EGDB 2MV2A 1X67A 5KYWA 4CBXG 2I2QA 1SVQA 3CI5G 5HVKB 1MDUA 1M2VA 1C0FS 1JHWA 5KYYA 1YAGG 1NLVG 2NUTB 3EH1A 3Q2BA 1EQYS 1T2LA 2FF6G 3A5LS 1TVJA 1D0NA 3L50A 5HVKD 4PKIG 1WM4A 3EGXB 3CIPG 5FAFA 4PKHB 3EG9B 1PD0A 2FH4A 3TU5B 5KYXB 1SVRA 1NMDG 3FG7A 1PD1A 2NUPA 3EFOA 1NM1G 4KEEA 4KEFA 5L6WC 3CJBG 5KYUB 2MOTA 2XFAA 5KYNA 4KEDA 2MP4A
chains in the Genus database with same CATH superfamily
2FH3A 1WFSA 5IVUA 3CJCG 1D4XG 3DAWB 1AK6A 2XF1A 3A5OS 2FH1A 4CBWG 1H1VG 2LXXA 1AHQA 1COFA 2LLFA 3A5NS 1M2VB 2HD7A 2FF3A 1ESVS 1DEJS 4LIZA 1Q8XA 1NPHA 1PCXA 5KYYB 1UDMA 2VILA 2KVKA 3EH2A 2NUPB 3A5MS 3FFKA 1CFYA 5KYUA 1VKKA 1TMWA 1J72A 1M4JA 2D8BA 1P8ZG 1T3YA 2LJ8A 3EGDA 2FGHA 3FG6A 4JD2H 1HQZ1 4S10C 3FFNA 1T44G 5KYWB 1T3XA 1Q8GA 5A1MA 1VFQA 1KCQA 2VIKA 2W0IA 5FAEA 3EGXA 1F7SA 1RGIG 2L72A 2QTVA 1C0GS 3EG9A 5KYXA 1CNUA 3EFOB 1QPVA 5DD2A 1V6FA 2FH2A 4Z94G 4BEX1 1M2OA 2NUTA 1P8XA 1WNJA 1SVYA 2VACA 1YVNG 4PKGG 4CBUG 1AK7A 3EGDB 2MV2A 1X67A 5KYWA 4CBXG 2I2QA 1SVQA 3CI5G 5HVKB 1MDUA 1M2VA 1C0FS 1JHWA 5KYYA 1YAGG 1NLVG 2NUTB 3EH1A 3Q2BA 1EQYS 1T2LA 2FF6G 3A5LS 1TVJA 1D0NA 3L50A 5HVKD 4PKIG 1WM4A 3EGXB 3CIPG 3DA7A 5FAFA 4PKHB 3EG9B 1PD0A 2FH4A 3TU5B 5KYXB 1SVRA 1NMDG 3FG7A 1PD1A 2NUPA 3EFOA 1NM1G 4KEEA 4KEFA 5L6WC 3CJBG 5KYUB 2MOTA 2XFAA 5KYNA 4KEDA 2MP4A
chains in the Genus database with same CATH topology
2FH3A 1WFSA 5IVUA 3CJCG 1D4XG 3DAWB 1AK6A 2XF1A 3A5OS 2FH1A 4CBWG 1H1VG 2LXXA 1AHQA 1COFA 2LLFA 3A5NS 1M2VB 2HD7A 2FF3A 1ESVS 1DEJS 4LIZA 1Q8XA 1NPHA 1PCXA 5KYYB 1UDMA 2VILA 2KVKA 3EH2A 2NUPB 3A5MS 3FFKA 1CFYA 5KYUA 1VKKA 1TMWA 1J72A 1M4JA 2D8BA 1P8ZG 1T3YA 2LJ8A 3EGDA 2FGHA 3FG6A 4JD2H 1HQZ1 4S10C 3FFNA 1T44G 5KYWB 1T3XA 1Q8GA 5A1MA 1VFQA 1KCQA 2VIKA 2W0IA 5FAEA 3EGXA 1F7SA 1RGIG 2L72A 2QTVA 1C0GS 3EG9A 5KYXA 1CNUA 3EFOB 1QPVA 5DD2A 1V6FA 2FH2A 4Z94G 4BEX1 1M2OA 2NUTA 1P8XA 1WNJA 1SVYA 2VACA 1YVNG 4PKGG 4CBUG 1AK7A 3EGDB 2MV2A 1X67A 5KYWA 4CBXG 2I2QA 1SVQA 3CI5G 5HVKB 1MDUA 1M2VA 1C0FS 1JHWA 5KYYA 1YAGG 1NLVG 2NUTB 3EH1A 3Q2BA 1EQYS 1T2LA 2FF6G 3A5LS 1TVJA 1D0NA 3L50A 5HVKD 4PKIG 1WM4A 3EGXB 3CIPG 3DA7A 5FAFA 4PKHB 3EG9B 1PD0A 2FH4A 3TU5B 5KYXB 1SVRA 1NMDG 3FG7A 1PD1A 2NUPA 3EFOA 1NM1G 4KEEA 4KEFA 5L6WC 3CJBG 5KYUB 2MOTA 2XFAA 5KYNA 4KEDA 2MP4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FH3 A;  1WFS A;  5IVU A;  3CJC G;  1D4X G;  3DAW B;  1AK6 A;  2XF1 A;  3A5O S;  2FH1 A;  4CBW G;  1H1V G;  2LXX A;  1AHQ A;  1COF A;  2LLF A;  3A5N S;  1M2V B;  2HD7 A;  2FF3 A;  1ESV S;  1DEJ S;  4LIZ A;  1Q8X A;  1NPH A;  1PCX A;  5KYY B;  1UDM A;  2VIL A;  2KVK A;  3EH2 A;  2NUP B;  3A5M S;  3FFK A;  1CFY A;  5KYU A;  1VKK A;  1TMW A;  1J72 A;  1M4J A;  2D8B A;  1P8Z G;  1T3Y A;  2LJ8 A;  3EGD A;  2FGH A;  3FG6 A;  4JD2 H;  1HQZ 1;  4S10 C;  3FFN A;  1T44 G;  5KYW B;  1T3X A;  1Q8G A;  5A1M A;  1VFQ A;  1KCQ A;  2VIK A;  2W0I A;  5FAE A;  3EGX A;  1F7S A;  1RGI G;  2L72 A;  2QTV A;  1C0G S;  3EG9 A;  5KYX A;  1CNU A;  3EFO B;  1QPV A;  5DD2 A;  1V6F A;  2FH2 A;  4Z94 G;  4BEX 1;  1M2O A;  2NUT A;  1P8X A;  1WNJ A;  1SVY A;  2VAC A;  1YVN G;  4PKG G;  4CBU G;  1AK7 A;  3EGD B;  2MV2 A;  1X67 A;  5KYW A;  4CBX G;  2I2Q A;  1SVQ A;  3CI5 G;  5HVK B;  1MDU A;  1M2V A;  1C0F S;  1JHW A;  5KYY A;  1YAG G;  1NLV G;  2NUT B;  3EH1 A;  3Q2B A;  1EQY S;  1T2L A;  2FF6 G;  3A5L S;  1TVJ A;  1D0N A;  3L50 A;  5HVK D;  4PKI G;  1WM4 A;  3EGX B;  3CIP G;  5FAF A;  4PKH B;  3EG9 B;  1PD0 A;  2FH4 A;  3TU5 B;  5KYX B;  1SVR A;  1NMD G;  3FG7 A;  1PD1 A;  2NUP A;  3EFO A;  1NM1 G;  4KEE A;  4KEF A;  5L6W C;  3CJB G;  5KYU B;  2MOT A;  2XFA A;  5KYN A;  4KED A;  2MP4 A; 
#chains in the Genus database with same CATH topology
 2FH3 A;  1WFS A;  5IVU A;  3CJC G;  1D4X G;  3DAW B;  1AK6 A;  2XF1 A;  3A5O S;  2FH1 A;  4CBW G;  1H1V G;  2LXX A;  1AHQ A;  1COF A;  2LLF A;  3A5N S;  1M2V B;  2HD7 A;  2FF3 A;  1ESV S;  1DEJ S;  4LIZ A;  1Q8X A;  1NPH A;  1PCX A;  5KYY B;  1UDM A;  2VIL A;  2KVK A;  3EH2 A;  2NUP B;  3A5M S;  3FFK A;  1CFY A;  5KYU A;  1VKK A;  1TMW A;  1J72 A;  1M4J A;  2D8B A;  1P8Z G;  1T3Y A;  2LJ8 A;  3EGD A;  2FGH A;  3FG6 A;  4JD2 H;  1HQZ 1;  4S10 C;  3FFN A;  1T44 G;  5KYW B;  1T3X A;  1Q8G A;  5A1M A;  1VFQ A;  1KCQ A;  2VIK A;  2W0I A;  5FAE A;  3EGX A;  1F7S A;  1RGI G;  2L72 A;  2QTV A;  1C0G S;  3EG9 A;  5KYX A;  1CNU A;  3EFO B;  1QPV A;  5DD2 A;  1V6F A;  2FH2 A;  4Z94 G;  4BEX 1;  1M2O A;  2NUT A;  1P8X A;  1WNJ A;  1SVY A;  2VAC A;  1YVN G;  4PKG G;  4CBU G;  1AK7 A;  3EGD B;  2MV2 A;  1X67 A;  5KYW A;  4CBX G;  2I2Q A;  1SVQ A;  3CI5 G;  5HVK B;  1MDU A;  1M2V A;  1C0F S;  1JHW A;  5KYY A;  1YAG G;  1NLV G;  2NUT B;  3EH1 A;  3Q2B A;  1EQY S;  1T2L A;  2FF6 G;  3A5L S;  1TVJ A;  1D0N A;  3L50 A;  5HVK D;  4PKI G;  1WM4 A;  3EGX B;  3CIP G;  3DA7 A;  5FAF A;  4PKH B;  3EG9 B;  1PD0 A;  2FH4 A;  3TU5 B;  5KYX B;  1SVR A;  1NMD G;  3FG7 A;  1PD1 A;  2NUP A;  3EFO A;  1NM1 G;  4KEE A;  4KEF A;  5L6W C;  3CJB G;  5KYU B;  2MOT A;  2XFA A;  5KYN A;  4KED A;  2MP4 A; 
#chains in the Genus database with same CATH homology
 2FH3 A;  1WFS A;  5IVU A;  3CJC G;  1D4X G;  3DAW B;  1AK6 A;  2XF1 A;  3A5O S;  2FH1 A;  4CBW G;  1H1V G;  2LXX A;  1AHQ A;  1COF A;  2LLF A;  3A5N S;  1M2V B;  2HD7 A;  2FF3 A;  1ESV S;  1DEJ S;  4LIZ A;  1Q8X A;  1NPH A;  1PCX A;  5KYY B;  1UDM A;  2VIL A;  2KVK A;  3EH2 A;  2NUP B;  3A5M S;  3FFK A;  1CFY A;  5KYU A;  1VKK A;  1TMW A;  1J72 A;  1M4J A;  2D8B A;  1P8Z G;  1T3Y A;  2LJ8 A;  3EGD A;  2FGH A;  3FG6 A;  4JD2 H;  1HQZ 1;  4S10 C;  3FFN A;  1T44 G;  5KYW B;  1T3X A;  1Q8G A;  5A1M A;  1VFQ A;  1KCQ A;  2VIK A;  2W0I A;  5FAE A;  3EGX A;  1F7S A;  1RGI G;  2L72 A;  2QTV A;  1C0G S;  3EG9 A;  5KYX A;  1CNU A;  3EFO B;  1QPV A;  5DD2 A;  1V6F A;  2FH2 A;  4Z94 G;  4BEX 1;  1M2O A;  2NUT A;  1P8X A;  1WNJ A;  1SVY A;  2VAC A;  1YVN G;  4PKG G;  4CBU G;  1AK7 A;  3EGD B;  2MV2 A;  1X67 A;  5KYW A;  4CBX G;  2I2Q A;  1SVQ A;  3CI5 G;  5HVK B;  1MDU A;  1M2V A;  1C0F S;  1JHW A;  5KYY A;  1YAG G;  1NLV G;  2NUT B;  3EH1 A;  3Q2B A;  1EQY S;  1T2L A;  2FF6 G;  3A5L S;  1TVJ A;  1D0N A;  3L50 A;  5HVK D;  4PKI G;  1WM4 A;  3EGX B;  3CIP G;  3DA7 A;  5FAF A;  4PKH B;  3EG9 B;  1PD0 A;  2FH4 A;  3TU5 B;  5KYX B;  1SVR A;  1NMD G;  3FG7 A;  1PD1 A;  2NUP A;  3EFO A;  1NM1 G;  4KEE A;  4KEF A;  5L6W C;  3CJB G;  5KYU B;  2MOT A;  2XFA A;  5KYN A;  4KED A;  2MP4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...