1HR0D

Crystal structure of initiation factor if1 bound to the 30s ribosomal subunit
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
208
structure length
208
Chain Sequence
GRYIGPVCRLCRREGVKLYLKGERCYSPKCAMERRPYPPGQHGQKRARRPSDYAVRLREKQKLRRIYGISERQFRNLFEEASKKKGVTGSVFLGLLESRLDNVVYRLGFAVSRRQARQLVRHGHITVNGRRVDLPSYRVRPGDEIAVAEKSRNLELIRQNLEAMKGRKVGPWLSLDVEGMKGKFLRLPDREDLALPVQENLVIEFYSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Crystal structure of an initiation factor bound to the 30S ribosomal subunit.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ribosome
total genus 62
structure length 208
sequence length 208
ec nomenclature
pdb deposition date 2000-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00163 Ribosomal_S4 Ribosomal protein S4/S9 N-terminal domain
D PF01479 S4 S4 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1050.10 Mainly Alpha Orthogonal Bundle Ribosomal Protein S4 Delta 41; Chain A, domain 1 Ribosomal Protein S4 Delta 41; Chain A, domain 1 1hr0D01
3.10.290.10 Alpha Beta Roll Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A RNA-binding S4 domain 1hr0D02
4GKJD 4GKKD 2UU9D 4DR6D 4JI0D 1XMQD 4JI7D 2UXCD 4DR4D 2ISTA 4KHPD 1VIOA 4OX9D 4JI4D 4DR3D 3T1HD 3T1YD 4B3SD 2UUAD 4LFCD 4DV6D 2UXDD 4OUDA 5BR8D 4JI2D 2F4VD 4DUZD 4DV1D 4DV0D 4NXND 4X65D 1XNRD 4DR7D 3HP7A 1IBKD 4YY3D 4B3TD 4DV4D 4JI5D 2UUBD 2ZM6D 2K6PA 1HNZD 1HR0D 4JI6D 4K0KD 1C06A 4DV5D 2UUCD 5LMND 2KTLA 1HNWD 1KSVA 2E5LD 4DV3D 4NXMD 1N32D 1N33D 4X62D 4JI1D 1P9KA 1KSKA 2UXBD 1FJGD 4LF7D 4DR1D 4DUYD 1HNXD 4LF6D 5IWAD 2VQFD 1H3FA 1IBMD 4B3MD 2VQED 1DM9A 4DR2D 4AQYD 4JYAD 4B3RD 2HHHD 4LF5D 4LFAD 4DV2D 3DH3A 4LFBD 4X66D 1IBLD 5LMUD 1XNQD 4LGTA 4X64D 3OTOD 4LF9D 3KBGA 4DR5D 4JV5D 1C05A 1H3EA 4YHHD 1JH3A 4LF4D 1I94D 1XMOD 1J5ED 4LF8D 1N36D 1N34D 2JANA 1FKAD 4DV7D 4JI3D 1KSLA 4JI8D
chains in the Genus database with same CATH superfamily
4GKJD 4GKKD 2UU9D 4DR6D 4NNJA 4JI0D 5IT9E 1XMQD 4JI7D 2UXCD 4DR4D 2ISTA 4KHPD 5FLXE 1VIOA 4OX9D 4JI4D 4DR3D 3T1HD 3T1YD 4B3SD 2UUAD 4LFCD 4II3A 4DV6D 2I1SA 2L3NA 2UXDD 4OUDA 5BR8D 4JI2D 2F4VD 5FQ2B 4DUZD 1Y8QB 4DV1D 3KYDB 4DV0D 4NXND 4X65D 1XNRD 4DR7D 3HP7A 1IBKD 4YY3D 4B3TD 4II2A 3KYCB 3ONGA 4DV4D 4JI5D 2UUBD 2ZM6D 2K6PA 1HNZD 5KNLA 1HR0D 4JI6D 3J81E 5LL6S 4K0KD 1C06A 2LQ7A 4DV5D 2NVUB 3CMMA 2UUCD 5LMND 2KTLA 1HNWD 1KSVA 2E5LD 4DV3D 4NXMD 1N32D 1N33D 4X62D 4JI1D 1P9KA 1KSKA 2UXBD 1FJGD 4LF7D 3ONHA 4DR1D 4DUYD 1HNXD 4LF6D 5IWAD 1Y8RB 2VQFD 1H3FA 1IBMD 4B3MD 2VQED 1DM9A 4DR2D 4AQYD 4JYAD 4B3RD 2HHHD 4LF5D 4LFAD 4DV2D 3DH3A 4LFBD 4X66D 1IBLD 5LMUD 1XNQD 4LGTA 3JAME 4X64D 3OTOD 4LF9D 3KBGA 4DR5D 3J7AF 4JV5D 1C05A 1H3EA 5A2QE 4YHHD 1JH3A 1Y8XB 3FN1A 4LF4D 1I94D 2ZTBA 1XMOD 1J5ED 4LF8D 1N36D 1N34D 3J80E 2JANA 1FKAD 4DV7D 4W5VB 4JI3D 1KSLA 4JI8D
chains in the Genus database with same CATH topology
4GKJD 4GKKD 2UU9D 4DR6D 4JI0D 1XMQD 4JI7D 2UXCD 4DR4D 2ISTA 4KHPD 1VIOA 4OX9D 4JI4D 4DR3D 3T1HD 3T1YD 4B3SD 2UUAD 4LFCD 4DV6D 2L3NA 2UXDD 4OUDA 5BR8D 4JI2D 2F4VD 4DUZD 4DV1D 4DV0D 4NXND 4X65D 1XNRD 4DR7D 3HP7A 1IBKD 4YY3D 4B3TD 4DV4D 4JI5D 2UUBD 2ZM6D 2K6PA 1HNZD 1HR0D 4JI6D 4K0KD 1C06A 4DV5D 2UUCD 5LMND 2KTLA 1HNWD 1KSVA 2E5LD 4DV3D 4NXMD 1N32D 1N33D 4X62D 4JI1D 1P9KA 1KSKA 2UXBD 1FJGD 4LF7D 4DR1D 4DUYD 1HNXD 4LF6D 5IWAD 2VQFD 1H3FA 1IBMD 4B3MD 2VQED 1DM9A 4DR2D 4AQYD 4JYAD 4B3RD 2HHHD 4LF5D 4LFAD 4DV2D 3DH3A 4LFBD 4X66D 1IBLD 5LMUD 1XNQD 4LGTA 4X64D 3OTOD 4LF9D 3KBGA 4DR5D 4JV5D 1C05A 1H3EA 4YHHD 1JH3A 4LF4D 1I94D 1XMOD 1J5ED 4LF8D 1N36D 1N34D 2JANA 1FKAD 4DV7D 4JI3D 1KSLA 4JI8D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GKJ D;  4GKK D;  2UU9 D;  4DR6 D;  4JI0 D;  1XMQ D;  4JI7 D;  2UXC D;  4DR4 D;  2IST A;  4KHP D;  1VIO A;  4OX9 D;  4JI4 D;  4DR3 D;  3T1H D;  3T1Y D;  4B3S D;  2UUA D;  4LFC D;  4DV6 D;  2UXD D;  4OUD A;  5BR8 D;  4JI2 D;  2F4V D;  4DUZ D;  4DV1 D;  4DV0 D;  4NXN D;  4X65 D;  1XNR D;  4DR7 D;  3HP7 A;  1IBK D;  4YY3 D;  4B3T D;  4DV4 D;  4JI5 D;  2UUB D;  2ZM6 D;  2K6P A;  1HNZ D;  1HR0 D;  4JI6 D;  4K0K D;  1C06 A;  4DV5 D;  2UUC D;  5LMN D;  2KTL A;  1HNW D;  1KSV A;  2E5L D;  4DV3 D;  4NXM D;  1N32 D;  1N33 D;  4X62 D;  4JI1 D;  1P9K A;  1KSK A;  2UXB D;  1FJG D;  4LF7 D;  4DR1 D;  4DUY D;  1HNX D;  4LF6 D;  5IWA D;  2VQF D;  1H3F A;  1IBM D;  4B3M D;  2VQE D;  1DM9 A;  4DR2 D;  4AQY D;  4JYA D;  4B3R D;  2HHH D;  4LF5 D;  4LFA D;  4DV2 D;  3DH3 A;  4LFB D;  4X66 D;  1IBL D;  5LMU D;  1XNQ D;  4LGT A;  4X64 D;  3OTO D;  4LF9 D;  3KBG A;  4DR5 D;  4JV5 D;  1C05 A;  1H3E A;  4YHH D;  1JH3 A;  4LF4 D;  1I94 D;  1XMO D;  1J5E D;  4LF8 D;  1N36 D;  1N34 D;  2JAN A;  1FKA D;  4DV7 D;  4JI3 D;  1KSL A;  4JI8 D; 
#chains in the Genus database with same CATH topology
 4GKJ D;  4GKK D;  2UU9 D;  4DR6 D;  4NNJ A;  4JI0 D;  5IT9 E;  1XMQ D;  4JI7 D;  2UXC D;  4DR4 D;  2IST A;  4KHP D;  5FLX E;  1VIO A;  4OX9 D;  4JI4 D;  4DR3 D;  3T1H D;  3T1Y D;  4B3S D;  2UUA D;  4LFC D;  4II3 A;  4DV6 D;  2I1S A;  2L3N A;  2UXD D;  4OUD A;  5BR8 D;  4JI2 D;  2F4V D;  5FQ2 B;  4DUZ D;  1Y8Q B;  4DV1 D;  3KYD B;  4DV0 D;  4NXN D;  4X65 D;  1XNR D;  4DR7 D;  3HP7 A;  1IBK D;  4YY3 D;  4B3T D;  4II2 A;  3KYC B;  3ONG A;  4DV4 D;  4JI5 D;  2UUB D;  2ZM6 D;  2K6P A;  1HNZ D;  5KNL A;  1HR0 D;  4JI6 D;  3J81 E;  5LL6 S;  4K0K D;  1C06 A;  2LQ7 A;  4DV5 D;  2NVU B;  3CMM A;  2UUC D;  5LMN D;  2KTL A;  1HNW D;  1KSV A;  2E5L D;  4DV3 D;  4NXM D;  1N32 D;  1N33 D;  4X62 D;  4JI1 D;  1P9K A;  1KSK A;  2UXB D;  1FJG D;  4LF7 D;  3ONH A;  4DR1 D;  4DUY D;  1HNX D;  4LF6 D;  5IWA D;  1Y8R B;  2VQF D;  1H3F A;  1IBM D;  4B3M D;  2VQE D;  1DM9 A;  4DR2 D;  4AQY D;  4JYA D;  4B3R D;  2HHH D;  4LF5 D;  4LFA D;  4DV2 D;  3DH3 A;  4LFB D;  4X66 D;  1IBL D;  5LMU D;  1XNQ D;  4LGT A;  3JAM E;  4X64 D;  3OTO D;  4LF9 D;  3KBG A;  4DR5 D;  3J7A F;  4JV5 D;  1C05 A;  1H3E A;  5A2Q E;  4YHH D;  1JH3 A;  1Y8X B;  3FN1 A;  4LF4 D;  1I94 D;  2ZTB A;  1XMO D;  1J5E D;  4LF8 D;  1N36 D;  1N34 D;  3J80 E;  2JAN A;  1FKA D;  4DV7 D;  4W5V B;  4JI3 D;  1KSL A;  4JI8 D; 
#chains in the Genus database with same CATH homology
 4GKJ D;  4GKK D;  2UU9 D;  4DR6 D;  4JI0 D;  1XMQ D;  4JI7 D;  2UXC D;  4DR4 D;  2IST A;  4KHP D;  1VIO A;  4OX9 D;  4JI4 D;  4DR3 D;  3T1H D;  3T1Y D;  4B3S D;  2UUA D;  4LFC D;  4DV6 D;  2L3N A;  2UXD D;  4OUD A;  5BR8 D;  4JI2 D;  2F4V D;  4DUZ D;  4DV1 D;  4DV0 D;  4NXN D;  4X65 D;  1XNR D;  4DR7 D;  3HP7 A;  1IBK D;  4YY3 D;  4B3T D;  4DV4 D;  4JI5 D;  2UUB D;  2ZM6 D;  2K6P A;  1HNZ D;  1HR0 D;  4JI6 D;  4K0K D;  1C06 A;  4DV5 D;  2UUC D;  5LMN D;  2KTL A;  1HNW D;  1KSV A;  2E5L D;  4DV3 D;  4NXM D;  1N32 D;  1N33 D;  4X62 D;  4JI1 D;  1P9K A;  1KSK A;  2UXB D;  1FJG D;  4LF7 D;  4DR1 D;  4DUY D;  1HNX D;  4LF6 D;  5IWA D;  2VQF D;  1H3F A;  1IBM D;  4B3M D;  2VQE D;  1DM9 A;  4DR2 D;  4AQY D;  4JYA D;  4B3R D;  2HHH D;  4LF5 D;  4LFA D;  4DV2 D;  3DH3 A;  4LFB D;  4X66 D;  1IBL D;  5LMU D;  1XNQ D;  4LGT A;  4X64 D;  3OTO D;  4LF9 D;  3KBG A;  4DR5 D;  4JV5 D;  1C05 A;  1H3E A;  4YHH D;  1JH3 A;  4LF4 D;  1I94 D;  1XMO D;  1J5E D;  4LF8 D;  1N36 D;  1N34 D;  2JAN A;  1FKA D;  4DV7 D;  4JI3 D;  1KSL A;  4JI8 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...