1HR0E

Crystal structure of initiation factor if1 bound to the 30s ribosomal subunit
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Crystal structure of an initiation factor bound to the 30S ribosomal subunit.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ribosome
total genus 34
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2000-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1hr0E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1hr0E02
4X64I 4JYAI 3ADJA 4DV2E 4LFCI 5LMUE 4DV3I 1ZXNA 4LFAE 2HHHI 1T4OA 4OX9E 1X47A 4DR3E 4B3RI 4AQYI 2UUCI 4JI2I 2UXBE 3QT6A 4KQVA 1STUA 1B63A 3QT8A 3ADIA 1HNXE 2LUQA 2NUEA 4JI5E 4DPTA 1J5EE 4HY1A 1IBME 4NXMI 2LJHA 1ZBTA 2DIXA 3WU5A 1ZM3A 4DV2I 4DR4E 4DPUA 2R3VA 4USKA 3ZKDA 2V2VA 1ELOA 2F4VE 2A2CA 5GMDA 2BM1A 4HXZA 2VQFI 3LPSA 2DEJA 1H7SA 3J7AG 4RPFA 1IBLE 1WHNA 1RR9A 3V5RA 1B62A 1N33E 3K1JA 3HULA 5L3JA 1YZ9A 3J81C 4DR2E 3PYGA 1XMQI 2L3JA 2A2DA 1YYKA 2RS7A 4DR6E 1XNQI 4DU8A 1Z0WA 4DR1I 4DV4I 2NPFA 3WU6A 5FLXQ 4X8WA 1BKNA 4USMA 2N3GA 4HACA 4MYTA 2VQEE 4KHPI 4PRXA 4DV5E 1H73A 3VYYA 4JI4E 4M2ZA 1RC7A 3PYEA 4X64E 4JYAE 1ZM9A 4LFCE 3WU3A 4DUYI 4ZVIA 2N3HA 2E5LE 4UT4A 2J7KA 2HHHE 4DR2I 4X66E 3OTOI 4I3HA 4AQYE 1I94I 4DR7I 2UUCE 3J80Q 1X48A 3K17A 1T4NA 2L2MA 1N0VC 1N34I 3J81Q 2JVAA 3HTXA 4PRVA 2WW4A 1OJ4A 2ZITA 2VQEI 1N0UA 2IHR1 1A6FA 4NXME 2DEIA 4FN5A 4DV5I 4LFBI 4JI4I 3PYFA 2UUAE 3CWVA 3C4TA 4DV7E 4DPYA 3ZKBA 1WUUA 2E5LI 2L3CA 3GONA 4OOGC 1FJGI 2VQFE 4X65I 4X66I 1Z0TA 4YY3I 2NUFA 2HFUA 1EI1A 1K47A 4LF7I 2LBSB 1H74A 2UXDI 3V2UC 5FLXC 2HFSA 2ZM6I 2V2ZA 4DPXA 2UUAI 1XMQE 5CFFE 4GKKE 1HNWI 4DV6E 5A2QQ 4R1FA 1NHJA 4DV7I 1XNQE 4HACB 4P52A 2BM0A 4DR1E 4DV4E 2BV3A 3QT5A 1FI4A 4WFTA 1PVGA 3JAMQ 2LRSA 2L2KB 4LF5I 4XTJA 4KHPE 1Z0CA 1D6TA 1HR0E 3B78A 5IT9Q 3J80C 1FWLA 4FWHA 1KKHA 4EMDA 2X7IA 4DUYE 4DV1I 1Z5CA 3Q1QA 1Z59A 2RTXA 4FWGA 1PIEA 3F0NA 4YHHE 4URLA 1KVKA 3OTOE 3QT7A 4NXNE 4GKKI 1Z5AA 1I94E 4DR7E 4JI7I 4JG4A 4DV6I 2HK2A 1DI2A 2L2NA 1DARA 1N34E 2AJ4A 1S4EA 2DB2A 1Z0VA 4ED4A 5IWAI 4LFBE 1WHQA 1HNZE 1HR0I 4LF6E 4WUBA 2E1RA 3B82A 1ZM4A 4B3TE 4PU9A 4UTGA 1IBKE 2JY9A 1EA6A 2V2QA 5LL6R 2UUBE 4YHHI 1FJGE 3M6AA 4X65E 1MU5A 2X36A 1U2RA 4NXNI 2UXCI 4YY3E 2R42A 1QZRA 2UU9E 4LF7E 4K0KI 4DV0I 5A2QC 2UXDE 1VISA 1EKZA 1RREA 2VF3A 4LF4E 3LTOA 2OI2A 1FNMA 4DPWA 2ZM6E 3JAMC 5GMEA 1HNZI 4LF6I 4JI1E 2EZ6A 1HNWE 3T1HI 4B3TI 4DXLA 2B3TB 5IT9C 4DR5I 4JI6E 2NA2A 1ZM2A 4WUDA 1IBKI 3T1YE 4M30A 1KTVA 3ZM7A 4X62E 2UUBI 4FWDA 4LF5E 4B3MI 1T4LB 2HKEA 3ZZ0A 4DUZE 1N32I 1QU6A 5BR8I 2UU9I 1N36I 1FKAE 4B3SI 4JI0E 4DV1E 1S16A 4DKKA 4LF9E 1Z0BA 1MX0A 4LF4I 1Z0EA 3B8HA 2GS8A 4JI1I 4JI7E 3H4LA 4JI8I 3WU4A 2LJPA 4JI6I 3T1YI 1XNRI 4X62I 1UHZA 4LF8I 5IWAE 4DUZI 2NUGA 4GKJI 2RSMA 2HK3A 2B7VA 4JI0I 3ADLA 1UEKA 1NHIA 4WYQB 3J7Yp 5LMUI 1H72C 2EFGA 2KHXA 4LF9I 3ADGA 1UILA 4LFAI 3LLHA 4OX9I 1RQ0A 4JI3E 1YYOA 2UXCE 1H7UA 4DR3I 4M1KA 4Z7CA 3P1XA 1PKPA 1J26A 2HKJA 2LTSA 2UXBI 1Z0GA 4K0KE 4DV0E 5LMNE 1HNXI 3C4BA 4JV5E 4JI5I 2LUPB 1J5EI 1IBMI 2V8PA 2YT4A 3PYDA 2DMYA 3T1HE 2LTRA 1XMOE 4DR4I 1O0WA 4DR5E 2CZ9A 3ZZTA 4DU7A 3D4JA 2F4VI 4JI3I 4B3ME 1GQEA 3LNUA 1N32E 3ZZUA 4FW9A 1IBLI 5BR8E 1XHKA 1N36E 2V34A 2RS6A 4WUCA 4B3SE 5LMNI 1N33I 1Z5BA 1ZXMA 4DV3E 4JV5I 4HYMA 2ZBKB 1NHHA 1YYWA 3VYXA 2XEXA 4Z7YA 1FWKA 4MYUA 4B3RE 2CPNA 4JI8E 4DR6I 1XMOI 4JI2E 2MDRA 4P7AA 1MG7A 2L33A 1XNRE 1NZ0A 2B7TA 4LF8E 3J7AM 4GKJE 1KIJA 1X49A 2Q2EB
chains in the Genus database with same CATH superfamily
2O1WA 2ADRA 2JOBA 5KL2A 1HK7A 4X64I 1IMUA 4JYAI 1IQSA 3H09A 3ADJA 3M99B 5KL5A 2EMYA 4DV2E 5LMUE 4LFCI 4DV3I 1A1FA 2MC5A 1ZXNA 2C39B 4OO1C 4Q28A 4LFAE 2FTXB 5A6BA 2CVEA 1T4OA 2V86A 2LCEA 4OX9E 2PO2B 2HHHI 1QNTA 2CTDA 1X47A 4IFDD 4DR3E 3L7ZB 4B3RI 4AQYI 2UUCI 5C0XB 5IV8B 4JI2I 2HC5A 2UXBE 3QT6A 4KQVA 2EOJA 1STUA 1B63A 3QT8A 3ADIA 4DMIA 1HNXE 2M4IA 5K36B 2LUQA 2NUEA 2YTFA 2KONA 2EMCA 4JI5E 1RHYA 2BA0D 4DPTA 1J5EE 1A1LA 4HY1A 4KZSA 4GZNC 1IBME 1PJTA 2JEAB 4NXMI 2LJHA 1OYRA 5DRQA 3UHMA 1ZBTA 2DIXA 3WU5A 1ZM3A 2Z5CB 4DV2I 4DR4E 2A25A 2FGGA 5AC5A 4DPUA 2EOZA 2YTQA 4IFDA 2ELZA 2R3VA 4USKA 5EKWA 4R03A 4FW6A 3ZKDA 2V2VA 1ELOA 2F4VE 3K85A 2A2CA 4MU3A 5GMDA 2BM1A 1UDOA 4HXZA 2VQFI 1GTKA 3LMLA 2I13A 5A6KA 3J7AG 1H7SA 2DEJA 2F1DA 3LPSA 4RPFA 1IBLE 1WHNA 1X6FA 4KWYA 3HPSA 1BBGA 2LVHA 2RQLA 1RR9A 2PNZA 2K7IA 5DROA 5JEAB 2EPNA 4LCHA 4FW5A 2EWLA 1EH6A 3V5RA 1B62A 1N33E 1X6EA 4BA1B 2V87A 2JEBA 3K1JA 4P7DA 2EOMA 3HULA 2IOPA 5L3JA 4M9VC 4FW3A 2EPAA 2ODRD 3MSWA 4ZYGA 4OZEA 2DLQA 1Y5YA 1YZ9A 2LV2A 5DNYA 2N8XA 3J81C 1AAYA 2BA1D 1X6HA 4DR2E 3F6HA 2EN2A 2EPCA 3PYGA 2EPUA 2V89A 3C6KA 5DNXA 1XMQI 2EMLA 2VF1A 5AC4A 2L3JA 1YYKA 2RS7A 2A2DA 4DR6E 2NN6D 1P47A 3IWBA 4DU8A 1XNQI 1Z0WA 4IS9A 3U1KA 3PS2A 4IZKA 4DR1I 2EE8A 4DV4I 2YTNA 2IESA 2NPFA 3WU6A 4BHBA 3M85D 5FLXQ 4X8WA 1BKNA 5K36C 3DF6A 2JXPA 2KOUA 4USMA 2N3GA 4HACA 5C0XE 2YTPA 4MYTA 4R2PA 2VQEE 2MC6A 2J7JA 2WBSA 4KHPI 2GO3A 4PRXA 4DV5E 5ADZA 4IS1C 1H73A 5EL9A 3VYYA 4JI4E 4M2ZA 2EMWA 4OKGA 1RC7A 1UN6B 2V8QB 5F3WA 4M0VA 2RPCA 2EORA 3VK6A 4X64E 3PYEA 4JYAE 5A6JA 4MU0A 1ZM9A 4LFCE 3WU3A 4DUYI 4ZVIA 2N3HA 2E5LE 4UT4A 2YRHA 2LT7A 2NN6A 2EM4A 2J7KA 2HHHE 2EN4A 5T6JA 4DR2I 4RHBB 2R1FA 2NABA 4X66E 1R6LA 3OTOI 3ZOQB 3THOB 4I3HA 4O5GA 3HQ1A 4AQYE 1I94I 2UUCE 3J80Q 2WNRA 4DR7I 2EPRA 1X48A 3C6MA 3AV0A 4ZYHA 1UBDC 2EMFA 4FW4A 3K17A 1T4NA 2L2MA 4WSPA 4OO1D 2ENCA 1N0VC 5KL7A 2BR2A 1N34I 4J3DA 2JVAA 3HTXA 4PRVA 3J81Q 2WW4A 2E72A 1OJ4A 4O4KA 4F6NA 2ZITA 2VQEI 1N0UA 1A1HA 5JEAE 4AIDA 2IHR1 1A6FA 3KWRA 4NXME 3IWDA 2VRDA 2DEIA 4FN5A 4DV5I 4LFBI 2LMZA 4JI4I 2DGCA 2UUAE 3PYFA 2NN6F 3CWVA 3C4TA 2C37A 2CSHA 4DV7E 4DPYA 3ZKBA 3FIGA 2JT2A 1WUUA 2E5LI 2L3CA 4F2JC 3GONA 4LU9A 4OOGC 4F9AB 1DQ3A 2PO0A 1EH7A 1X5WA 3P3GA 1FJGI 2YTOA 2VQFE 4X65I 5IXMB 4BBYA 2YU8A 1Z0TA 3PRYA 5DRRA 4X66I 2F8BA 3M7ND 4IZJD 4OO1A 4RH8A 4YY3I 2EOIA 2YSOA 3BIDA 2NUFA 3JU0A 1E3PA 1EI1A 2HFUA 1K47A 2GO4A 4LF7I 2L6MA 1TN9A 2O1TA 2LBSB 2EPLX 2CT1A 1ZAAC 1H74A 2UXDI 5A2QQ 4WX9A 1R6MA 1LLMC 3V2UC 3QG5C 4BA2A 4AM3A 4IJDA 5FLXC 4GQUA 2YPNA 2HFSA 1BB8A 1P42A 2ZM6I 2V2ZA 4DPXA 2UUAI 1XMQE 5CFFE 1N3GA 4GKKE 1HNWI 4BHCA 4DV6E 2MKNA 2J65A 2EM2A 2G7HA 4HTGA 1NHJA 1Y4SA 1XNQE 4MDTA 4R1FA 4F9CB 4DV7I 4HACB 3RMPA 4P52A 2BM0A 3IWCA 2EQ1A 4DR1E 4DV4E 1OYSA 2EPPA 4IZJA 2BV3A 2E1MA 2EL4A 2EM7A 3QT5A 3P76A 1FI4A 4WFTA 5KL3A 2EMBA 1PVGA 2JP9A 3JAMQ 2LRSA 2L2KB 4LF5I 4XTJA 2EOOA 4KHPE 1Z0CA 1D6TA 2WZOA 1NCSA 1YPNA 2YTIA 1HR0E 3EPHA 3B78A 4LPFA 4NHRA 4Q35B 2C38B 3J80C 2NN6B 1FWLA 2WBUA 5IT9Q 4FWHA 1KKHA 4EMDA 2X7IA 2JOXA 4DUYE 3KRNA 4QNJA 4DV1I 5K36D 1Z5CA 2EMHA 2EN1A 3KZYA 1AH5A 1Z59A 3Q1QA 2RTXA 2LE2A 2R76A 3BBGA 2WNRB 4FWGA 2EPKX 1PIEA 3F0NA 4IFDE 4YHHE 4URLA 1KVKA 4IFDF 3OTOE 3QT7A 4NXNE 4GKKI 1Z5AA 1Y60A 1I94E 4DR7E 2C39A 3B4TA 4JG4A 4DV6I 2EN3A 4JI7I 1PJSA 5C0XC 2PO2A 5AASA 2ENAA 2EMKA 1ZU1A 2HK2A 1DI2A 1KYQA 2L2NA 5KL4A 1NEIA 4U3DA 3U1YA 2V85A 4ZYDA 1DARA 3P06A 2PNLA 2EOHA 1N34E 2JE6A 2EOYA 2AJ4A 2EPOA 2C37B 1S4EA 2BA0G 2DB2A 1MGTA 1Z0VA 4ED4A 1YFHA 5IWAI 2M7QA 4LFBE 4ISAA 5K36A 1WHQA 1KJKA 4WXDA 1HNZE 4LF6E 1HR0I 2MKDA 4WUBA 1A1JA 4NZVA 2E1RA 2WP8A 3B82A 4R2DA 1ZM4A 4B3TE 4PU9A 2YTGA 1YSAC 1USVA 2EOFA 1DGCA 3KZZA 2BB8A 4UTGA 2EMGA 2GPIA 1IBKE 1IQOA 3H1CA 1X3CA 2JY9A 2EM5A 5LL6R 1A1KA 1EA6A 2UUBE 2V2QA 2Z5CA 2YU5A 5A69A 1FJGE 5DNLA 4YHHI 3EPLA 4X65E 3M6AA 1MU5A 2X36A 3HXLA 1U2RA 4NXNI 2UXCI 2VESA 2H36X 4GEQB 4YY3E 4FW7A 2R42A 4BMJA 2EPXA 3BGHA 1QZRA 2V83A 2UU9E 1WJPA 4LF7E 5JEAC 4BA2B 2YRKA 4K0KI 4DV0I 2EN6A 5A2QC 1UDSA 2EJ4A 2YRMA 2ELYA 2UXDE 1UDQA 4P78A 4R2QA 4BC9A 1VISA 1EKZA 4R2CA 1RREA 2VF3A 4MQYA 2LJUA 2EM9A 4LF4E 4AIMA 3LTOA 2OI2A 1FNMA 2NN6E 4R2SA 2EPMX 3JTZA 2BA1G 2ZM6E 3JAMC 5GMEA 2YTDA 4DPWA 1HNZI 4LF6I 4JI1E 2EZ6A 4IFDB 4MLVA 4ZYEA 2YTEA 4TUGA 4IZJB 1HNWE 5JEAF 3T1HI 2DLKA 4FK5C 2O1VA 4B3TI 4DXLA 2I9IA 2B3TB 5IT9C 4DR5I 3F6GA 4JI6E 2NA2A 2AE8A 1ZM2A 2PRTA 3K6QA 4WUDA 3L00A 3Q6NA 1IBKI 5FWKA 3TQMA 3T1YE 1T39A 4M30A 1KTVA 3PS1A 3ZM7A 2EM8A 4X62E 4TUIA 3M85G 2PNZB 2UUBI 1T38A 1YUIA 4O43A 4FWDA 4LF5E 4R8OA 1T4LB 1JK1A 2HKEA 3ZZ0A 2B9DA 4B3MI 4X9JA 4DUZE 3EPJA 2JEBB 2O1UA 1N32I 1QU6A 2EOQA 2Z5BA 2D9HA 5BR8I 4QNKA 4WXCA 2UU9I 2PO1A 1PJQA 1N36I 1FKAE 4B3SI 4JI0E 4L5NC 1WRJA 2CGEA 4DV1E 1YH8A 1S16A 4DKKA 4WSGA 4LF9E 2JYAA 2RSIA 3THNA 1Z0BA 3GLLA 1SR9A 3ECRA 1Y6ZA 2GQ0A 1MX0A 4LF4I 1Z0EA 3B8HA 4U3BA 2EN7A 4MU4A 2GS8A 4IZKB 4I8OA 4JI1I 3HKMA 2HJJA 4F54A 4JI7E 2O3ZA 2EMIA 2JE6B 3H4LA 4JI8I 4OO1E 2L8TA 3WU4A 2LJPA 4JI6I 1ZBQA 5AE1A 4OO1F 2YTJA 3T1YI 3AUZA 1XXEA 4WPYA 1XNRI 1SFEA 3UK3C 2EN8A 4X62I 1USUA 1UHZA 1TF3A 4BC7A 1A1IA 2DSYA 2WP8B 4LF8I 4HEIA 2HGHA 5IWAE 2WCC3 4DUZI 3GMEA 2NUGA 2M9AA 4GKJI 3VHTB 2RSMA 5C0XD 2GHFA 1L4SA 2EL6A 2HK3A 4F6MA 4IFDC 5KL6A 2B7VA 4MLQA 4JI0I 3ADLA 1UEKA 5TSEA 4WYQB 3EPKA 1NHIA 3J7Yp 3DD6A 5LMUI 1H72C 2EFGA 2KHXA 4LF9I 3ADGA 2V88A 4L8NA 1A1GA 2YSPA 1UILA 4LFAI 3LLHA 4R2EA 4OX9I 1RQ0A 2EMXA 4N4RB 2PNMA 2FV4B 4LTYA 2EQ0A 2IOQA 4JI3E 1BBOA 1YYOA 2UXCE 1H7UA 4DR3I 4M1KA 2WBTA 3M7NG 3HPZA 2BR2B 4Z7CA 3P1XA 1PKPA 1J26A 1YHCA 2HKJA 2EM6A 3P3CA 2LTSA 2UXBI 1Z0GA 2EQ3A 1B69A 4K0KE 4DV0E 5AE2A 2JR1A 5LMNE 2VE7C 2EL5A 3L7ZA 1HNXI 2ENHA 2EM3A 3C4BA 4JV5E 5C0XA 1GZ6A 2EOEA 4JI5I 2LUPB 1J5EI 4R2AA 3GCMA 1IBMI 2V8PA 1WXRA 2GLIA 2YT4A 1E3HA 3PYDA 2EOSA 1ZR9A 5JEAD 2DMYA 3T1HE 2K4VA 2EPZA 2EMAA 3P3EA 2LTRA 2PO0B 2JEAA 1XMOE 4DR4I 3BF2A 1O0WA 4DR5E 1G2DC 2LO3A 2BBGA 4OO1B 2JWOA 2L92A 2Z5BB 2CZ9A 3ZZTA 3OMLA 3D4JA 4DU7A 1TF6A 2PO1B 2M1SA 2F4VI 2ODRC 1VI7A 4JI3I 1Y4UA 3MHSC 4B3ME 1GQEA 2Q8UA 3LNUA 1N32E 5A6AA 3ZZUA 4FW9A 1JK2A 5C0XF 1IBLI 5DRPA 5BR8E 3Q6MA 5K36E 1XHKA 1EH8A 1N36E 2V34A 2RS6A 4WUCA 4B3SE 2NN6C 5LMNI 3DJWA 1N33I 5K36F 4LCFA 4BS9A 1MEYC 1Z5BA 2EP3A 1ZXMA 4DV3E 2YZTA 1G2FC 4JV5I 1PDAA 4BCAA 4HYMA 1UDNA 2ZBKB 4LOMA 5AE3A 5JEAA 1NHHA 2C38A 4J8ZA 1YYWA 3VYXA 4BA1A 2XEXA 3CDIA 4Z7YA 1FWKA 4LCGA 4MYUA 3HJCA 2Z5EA 2MDGA 2EM0A 3PS3A 4B3RE 4R2RA 3NZKA 2CPNA 4JI8E 5A6BD 2CG9A 4NBQA 1XMOI 4DR6I 4JI2E 2MDRA 4P7AA 2JPAA 1MG7A 2IERA 2EOXA 4F9BB 2L33A 4N3OA 3MHHC 1XNRE 3EQ1A 1NZ0A 1Z1BA 2B7TA 1YUJA 2YWQA 1F2IG 4LF8E 4O24A 4MU1A 2EMZA 2DMIA 2DRPA 1OYPA 3J7AM 5ELWA 4GKJE 1KIJA 1X49A 1RMDA 5LLQA 3CDJA 2Q2EB
chains in the Genus database with same CATH topology
2O1WA 2JOBA 1HK7A 4X64I 4JYAI 3H09A 3ADJA 4DV2E 4LFCI 5LMUE 4DV3I 2MC5A 1ZXNA 4Q28A 4LFAE 2FTXB 2HHHI 1T4OA 2V86A 4OX9E 1X47A 4DR3E 4B3RI 4AQYI 2UUCI 4JI2I 2UXBE 3QT6A 4KQVA 1STUA 1B63A 3QT8A 3ADIA 4DMIA 1HNXE 2M4IA 2LUQA 2NUEA 2KONA 4JI5E 4DPTA 1J5EE 4HY1A 4KZSA 1IBME 4NXMI 2LJHA 1ZBTA 2DIXA 3WU5A 1ZM3A 2Z5CB 4DV2I 4DR4E 2FGGA 4DPUA 2R3VA 4USKA 4R03A 3ZKDA 2V2VA 1ELOA 2F4VE 3K85A 2A2CA 5GMDA 2BM1A 4HXZA 2VQFI 3LMLA 3J7AG 2DEJA 1H7SA 3LPSA 4RPFA 1IBLE 1WHNA 3HPSA 1RR9A 2EWLA 3V5RA 1B62A 1N33E 2V87A 3K1JA 4P7DA 3HULA 2IOPA 5L3JA 3MSWA 2ODRD 1YZ9A 5DNYA 3J81C 4DR2E 3F6HA 3PYGA 2V89A 1XMQI 2VF1A 2L3JA 1YYKA 2RS7A 2A2DA 4DR6E 1XNQI 3IWBA 4DU8A 1Z0WA 4IZKA 4DR1I 4DV4I 2NPFA 3WU6A 5FLXQ 4X8WA 1BKNA 3DF6A 2KOUA 4USMA 2N3GA 4HACA 4MYTA 2VQEE 2MC6A 4KHPI 4PRXA 4DV5E 5ADZA 1H73A 3VYYA 4JI4E 4M2ZA 1RC7A 2V8QB 5F3WA 4M0VA 3VK6A 4X64E 3PYEA 4JYAE 1ZM9A 4LFCE 3WU3A 4DUYI 4ZVIA 2N3HA 2E5LE 4UT4A 2J7KA 2HHHE 5T6JA 4DR2I 4X66E 3OTOI 3ZOQB 4I3HA 4AQYE 3HQ1A 1I94I 4DR7I 2UUCE 3J80Q 1X48A 3AV0A 3K17A 1T4NA 2L2MA 4WSPA 1N0VC 1N34I 3J81Q 2JVAA 3HTXA 4PRVA 2WW4A 1OJ4A 2ZITA 2VQEI 1N0UA 2IHR1 1A6FA 3KWRA 4NXME 3IWDA 2DEIA 4FN5A 4DV5I 4LFBI 2LMZA 4JI4I 3PYFA 2UUAE 3CWVA 3C4TA 4DV7E 4DPYA 3ZKBA 3FIGA 1WUUA 2E5LI 2L3CA 3GONA 4LU9A 4OOGC 4F9AB 1DQ3A 1FJGI 2VQFE 4X65I 3PRYA 4BBYA 4X66I 1Z0TA 2F8BA 4IZJD 4YY3I 2NUFA 3JU0A 1EI1A 2HFUA 1K47A 4LF7I 2L6MA 2O1TA 2LBSB 1H74A 2UXDI 3V2UC 5FLXC 2HFSA 2ZM6I 2V2ZA 4DPXA 2UUAI 1XMQE 5CFFE 4GKKE 1HNWI 4DV6E 5A2QQ 4R1FA 2G7HA 1NHJA 1Y4SA 4DV7I 1XNQE 4F9CB 4HACB 3RMPA 4P52A 2BM0A 3IWCA 4DR1E 4DV4E 4IZJA 2BV3A 2E1MA 3QT5A 1FI4A 4WFTA 1PVGA 3JAMQ 2LRSA 2L2KB 4LF5I 4XTJA 4KHPE 1Z0CA 1D6TA 2WZOA 1HR0E 3B78A 5IT9Q 3J80C 1FWLA 4FWHA 1KKHA 4EMDA 2X7IA 2JOXA 4DUYE 4DV1I 1Z5CA 3Q1QA 1Z59A 2RTXA 2LE2A 4FWGA 1PIEA 3F0NA 4YHHE 4URLA 1KVKA 3OTOE 3QT7A 4NXNE 4GKKI 1Z5AA 1I94E 4DR7E 4JI7I 4JG4A 4DV6I 5AASA 2HK2A 1DI2A 2L2NA 2V85A 1DARA 3P06A 2PNLA 1N34E 2AJ4A 1S4EA 2DB2A 1Z0VA 4ED4A 5IWAI 2M7QA 4LFBE 1WHQA 1HNZE 1HR0I 4LF6E 4WUBA 2E1RA 3B82A 1ZM4A 4B3TE 4PU9A 1USVA 4UTGA 1IBKE 2JY9A 1EA6A 5LL6R 2V2QA 2UUBE 2Z5CA 4YHHI 1FJGE 3M6AA 4X65E 1MU5A 2X36A 3HXLA 1U2RA 4NXNI 2UXCI 2H36X 4GEQB 4YY3E 2R42A 4BMJA 1QZRA 2V83A 2UU9E 4LF7E 4K0KI 4DV0I 5A2QC 2UXDE 4P78A 1VISA 4BC9A 1EKZA 1RREA 2VF3A 4LF4E 3LTOA 2OI2A 1FNMA 3JTZA 4DPWA 2ZM6E 3JAMC 5GMEA 1HNZI 4LF6I 4JI1E 2EZ6A 4TUGA 4IZJB 1HNWE 3T1HI 2O1VA 4B3TI 4DXLA 2B3TB 5IT9C 4DR5I 3F6GA 4JI6E 2NA2A 1ZM2A 4WUDA 3K6QA 3Q6NA 1IBKI 5FWKA 3T1YE 4M30A 1KTVA 3ZM7A 4X62E 4TUIA 2UUBI 4FWDA 4LF5E 4R8OA 1T4LB 4B3MI 2HKEA 3ZZ0A 2B9DA 4DUZE 1N32I 2O1UA 1QU6A 2Z5BA 5BR8I 2UU9I 1N36I 1FKAE 4B3SI 4JI0E 4L5NC 2CGEA 4DV1E 1S16A 4DKKA 4LF9E 1Z0BA 1SR9A 2GQ0A 1Y6ZA 1MX0A 4LF4I 1Z0EA 3B8HA 2GS8A 4IZKB 4I8OA 4JI1I 4F54A 4JI7E 3H4LA 4JI8I 2L8TA 3WU4A 2LJPA 4JI6I 1ZBQA 5AE1A 3T1YI 3AUZA 4WPYA 1XNRI 4X62I 1USUA 1UHZA 4BC7A 2DSYA 4LF8I 5IWAE 4DUZI 2NUGA 4GKJI 2RSMA 2HK3A 2B7VA 4JI0I 3ADLA 1UEKA 1NHIA 4WYQB 3J7Yp 5LMUI 1H72C 2EFGA 2KHXA 4LF9I 3ADGA 2V88A 4L8NA 1UILA 4LFAI 3LLHA 4OX9I 1RQ0A 2PNMA 2FV4B 4LTYA 2IOQA 4JI3E 1YYOA 2UXCE 1H7UA 4DR3I 4M1KA 3HPZA 4Z7CA 3P1XA 1PKPA 1J26A 2HKJA 2LTSA 2UXBI 1Z0GA 4K0KE 4DV0E 5AE2A 2JR1A 5LMNE 2VE7C 1HNXI 3C4BA 4JV5E 1GZ6A 4JI5I 2LUPB 1J5EI 1IBMI 2V8PA 1WXRA 2YT4A 3PYDA 2DMYA 3T1HE 2K4VA 2LTRA 1XMOE 4DR4I 1O0WA 4DR5E 2JWOA 2L92A 2Z5BB 2CZ9A 3ZZTA 3OMLA 3D4JA 4DU7A 2M1SA 2F4VI 2ODRC 4JI3I 1Y4UA 4B3ME 1GQEA 3LNUA 1N32E 3ZZUA 4FW9A 1IBLI 5BR8E 3Q6MA 1XHKA 1N36E 2V34A 2RS6A 4WUCA 4B3SE 5LMNI 3DJWA 1N33I 4BS9A 1Z5BA 1ZXMA 4DV3E 2YZTA 4JV5I 4HYMA 4BCAA 2ZBKB 5AE3A 1NHHA 4J8ZA 1YYWA 3VYXA 2XEXA 4Z7YA 1FWKA 4MYUA 3HJCA 2Z5EA 4B3RE 2CPNA 4JI8E 2CG9A 4DR6I 1XMOI 4JI2E 2MDRA 4P7AA 1MG7A 4F9BB 2L33A 4N3OA 1XNRE 1NZ0A 2B7TA 4LF8E 3J7AM 4GKJE 1KIJA 1X49A 2Q2EB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X64 I;  4JYA I;  3ADJ A;  4DV2 E;  4LFC I;  5LMU E;  4DV3 I;  1ZXN A;  4LFA E;  2HHH I;  1T4O A;  4OX9 E;  1X47 A;  4DR3 E;  4B3R I;  4AQY I;  2UUC I;  4JI2 I;  2UXB E;  3QT6 A;  4KQV A;  1STU A;  1B63 A;  3QT8 A;  3ADI A;  1HNX E;  2LUQ A;  2NUE A;  4JI5 E;  4DPT A;  1J5E E;  4HY1 A;  1IBM E;  4NXM I;  2LJH A;  1ZBT A;  2DIX A;  3WU5 A;  1ZM3 A;  4DV2 I;  4DR4 E;  4DPU A;  2R3V A;  4USK A;  3ZKD A;  2V2V A;  1ELO A;  2F4V E;  2A2C A;  5GMD A;  2BM1 A;  4HXZ A;  2VQF I;  3LPS A;  2DEJ A;  1H7S A;  3J7A G;  4RPF A;  1IBL E;  1WHN A;  1RR9 A;  3V5R A;  1B62 A;  1N33 E;  3K1J A;  3HUL A;  5L3J A;  1YZ9 A;  3J81 C;  4DR2 E;  3PYG A;  1XMQ I;  2L3J A;  2A2D A;  1YYK A;  2RS7 A;  4DR6 E;  1XNQ I;  4DU8 A;  1Z0W A;  4DR1 I;  4DV4 I;  2NPF A;  3WU6 A;  5FLX Q;  4X8W A;  1BKN A;  4USM A;  2N3G A;  4HAC A;  4MYT A;  2VQE E;  4KHP I;  4PRX A;  4DV5 E;  1H73 A;  3VYY A;  4JI4 E;  4M2Z A;  1RC7 A;  3PYE A;  4X64 E;  4JYA E;  1ZM9 A;  4LFC E;  3WU3 A;  4DUY I;  4ZVI A;  2N3H A;  2E5L E;  4UT4 A;  2J7K A;  2HHH E;  4DR2 I;  4X66 E;  3OTO I;  4I3H A;  4AQY E;  1I94 I;  4DR7 I;  2UUC E;  3J80 Q;  1X48 A;  3K17 A;  1T4N A;  2L2M A;  1N0V C;  1N34 I;  3J81 Q;  2JVA A;  3HTX A;  4PRV A;  2WW4 A;  1OJ4 A;  2ZIT A;  2VQE I;  1N0U A;  2IHR 1;  1A6F A;  4NXM E;  2DEI A;  4FN5 A;  4DV5 I;  4LFB I;  4JI4 I;  3PYF A;  2UUA E;  3CWV A;  3C4T A;  4DV7 E;  4DPY A;  3ZKB A;  1WUU A;  2E5L I;  2L3C A;  3GON A;  4OOG C;  1FJG I;  2VQF E;  4X65 I;  4X66 I;  1Z0T A;  4YY3 I;  2NUF A;  2HFU A;  1EI1 A;  1K47 A;  4LF7 I;  2LBS B;  1H74 A;  2UXD I;  3V2U C;  5FLX C;  2HFS A;  2ZM6 I;  2V2Z A;  4DPX A;  2UUA I;  1XMQ E;  5CFF E;  4GKK E;  1HNW I;  4DV6 E;  5A2Q Q;  4R1F A;  1NHJ A;  4DV7 I;  1XNQ E;  4HAC B;  4P52 A;  2BM0 A;  4DR1 E;  4DV4 E;  2BV3 A;  3QT5 A;  1FI4 A;  4WFT A;  1PVG A;  3JAM Q;  2LRS A;  2L2K B;  4LF5 I;  4XTJ A;  4KHP E;  1Z0C A;  1D6T A;  1HR0 E;  3B78 A;  5IT9 Q;  3J80 C;  1FWL A;  4FWH A;  1KKH A;  4EMD A;  2X7I A;  4DUY E;  4DV1 I;  1Z5C A;  3Q1Q A;  1Z59 A;  2RTX A;  4FWG A;  1PIE A;  3F0N A;  4YHH E;  4URL A;  1KVK A;  3OTO E;  3QT7 A;  4NXN E;  4GKK I;  1Z5A A;  1I94 E;  4DR7 E;  4JI7 I;  4JG4 A;  4DV6 I;  2HK2 A;  1DI2 A;  2L2N A;  1DAR A;  1N34 E;  2AJ4 A;  1S4E A;  2DB2 A;  1Z0V A;  4ED4 A;  5IWA I;  4LFB E;  1WHQ A;  1HNZ E;  1HR0 I;  4LF6 E;  4WUB A;  2E1R A;  3B82 A;  1ZM4 A;  4B3T E;  4PU9 A;  4UTG A;  1IBK E;  2JY9 A;  1EA6 A;  2V2Q A;  5LL6 R;  2UUB E;  4YHH I;  1FJG E;  3M6A A;  4X65 E;  1MU5 A;  2X36 A;  1U2R A;  4NXN I;  2UXC I;  4YY3 E;  2R42 A;  1QZR A;  2UU9 E;  4LF7 E;  4K0K I;  4DV0 I;  5A2Q C;  2UXD E;  1VIS A;  1EKZ A;  1RRE A;  2VF3 A;  4LF4 E;  3LTO A;  2OI2 A;  1FNM A;  4DPW A;  2ZM6 E;  3JAM C;  5GME A;  1HNZ I;  4LF6 I;  4JI1 E;  2EZ6 A;  1HNW E;  3T1H I;  4B3T I;  4DXL A;  2B3T B;  5IT9 C;  4DR5 I;  4JI6 E;  2NA2 A;  1ZM2 A;  4WUD A;  1IBK I;  3T1Y E;  4M30 A;  1KTV A;  3ZM7 A;  4X62 E;  2UUB I;  4FWD A;  4LF5 E;  4B3M I;  1T4L B;  2HKE A;  3ZZ0 A;  4DUZ E;  1N32 I;  1QU6 A;  5BR8 I;  2UU9 I;  1N36 I;  1FKA E;  4B3S I;  4JI0 E;  4DV1 E;  1S16 A;  4DKK A;  4LF9 E;  1Z0B A;  1MX0 A;  4LF4 I;  1Z0E A;  3B8H A;  2GS8 A;  4JI1 I;  4JI7 E;  3H4L A;  4JI8 I;  3WU4 A;  2LJP A;  4JI6 I;  3T1Y I;  1XNR I;  4X62 I;  1UHZ A;  4LF8 I;  5IWA E;  4DUZ I;  2NUG A;  4GKJ I;  2RSM A;  2HK3 A;  2B7V A;  4JI0 I;  3ADL A;  1UEK A;  1NHI A;  4WYQ B;  3J7Y p;  5LMU I;  1H72 C;  2EFG A;  2KHX A;  4LF9 I;  3ADG A;  1UIL A;  4LFA I;  3LLH A;  4OX9 I;  1RQ0 A;  4JI3 E;  1YYO A;  2UXC E;  1H7U A;  4DR3 I;  4M1K A;  4Z7C A;  3P1X A;  1PKP A;  1J26 A;  2HKJ A;  2LTS A;  2UXB I;  1Z0G A;  4K0K E;  4DV0 E;  5LMN E;  1HNX I;  3C4B A;  4JV5 E;  4JI5 I;  2LUP B;  1J5E I;  1IBM I;  2V8P A;  2YT4 A;  3PYD A;  2DMY A;  3T1H E;  2LTR A;  1XMO E;  4DR4 I;  1O0W A;  4DR5 E;  2CZ9 A;  3ZZT A;  4DU7 A;  3D4J A;  2F4V I;  4JI3 I;  4B3M E;  1GQE A;  3LNU A;  1N32 E;  3ZZU A;  4FW9 A;  1IBL I;  5BR8 E;  1XHK A;  1N36 E;  2V34 A;  2RS6 A;  4WUC A;  4B3S E;  5LMN I;  1N33 I;  1Z5B A;  1ZXM A;  4DV3 E;  4JV5 I;  4HYM A;  2ZBK B;  1NHH A;  1YYW A;  3VYX A;  2XEX A;  4Z7Y A;  1FWK A;  4MYU A;  4B3R E;  2CPN A;  4JI8 E;  4DR6 I;  1XMO I;  4JI2 E;  2MDR A;  4P7A A;  1MG7 A;  2L33 A;  1XNR E;  1NZ0 A;  2B7T A;  4LF8 E;  3J7A M;  4GKJ E;  1KIJ A;  1X49 A;  2Q2E B; 
#chains in the Genus database with same CATH topology
 2O1W A;  2ADR A;  2JOB A;  5KL2 A;  1HK7 A;  4X64 I;  1IMU A;  4JYA I;  1IQS A;  3H09 A;  3ADJ A;  3M99 B;  5KL5 A;  2EMY A;  4DV2 E;  5LMU E;  4LFC I;  4DV3 I;  1A1F A;  2MC5 A;  1ZXN A;  2C39 B;  4OO1 C;  4Q28 A;  4LFA E;  2FTX B;  5A6B A;  2CVE A;  1T4O A;  2V86 A;  2LCE A;  4OX9 E;  2PO2 B;  2HHH I;  1QNT A;  2CTD A;  1X47 A;  4IFD D;  4DR3 E;  3L7Z B;  4B3R I;  4AQY I;  2UUC I;  5C0X B;  5IV8 B;  4JI2 I;  2HC5 A;  2UXB E;  3QT6 A;  4KQV A;  2EOJ A;  1STU A;  1B63 A;  3QT8 A;  3ADI A;  4DMI A;  1HNX E;  2M4I A;  5K36 B;  2LUQ A;  2NUE A;  2YTF A;  2KON A;  2EMC A;  4JI5 E;  1RHY A;  2BA0 D;  4DPT A;  1J5E E;  1A1L A;  4HY1 A;  4KZS A;  4GZN C;  1IBM E;  1PJT A;  2JEA B;  4NXM I;  2LJH A;  1OYR A;  5DRQ A;  3UHM A;  1ZBT A;  2DIX A;  3WU5 A;  1ZM3 A;  2Z5C B;  4DV2 I;  4DR4 E;  2A25 A;  2FGG A;  5AC5 A;  4DPU A;  2EOZ A;  2YTQ A;  4IFD A;  2ELZ A;  2R3V A;  4USK A;  5EKW A;  4R03 A;  4FW6 A;  3ZKD A;  2V2V A;  1ELO A;  2F4V E;  3K85 A;  2A2C A;  4MU3 A;  5GMD A;  2BM1 A;  1UDO A;  4HXZ A;  2VQF I;  1GTK A;  3LML A;  2I13 A;  5A6K A;  3J7A G;  1H7S A;  2DEJ A;  2F1D A;  3LPS A;  4RPF A;  1IBL E;  1WHN A;  1X6F A;  4KWY A;  3HPS A;  1BBG A;  2LVH A;  2RQL A;  1RR9 A;  2PNZ A;  2K7I A;  5DRO A;  5JEA B;  2EPN A;  4LCH A;  4FW5 A;  2EWL A;  1EH6 A;  3V5R A;  1B62 A;  1N33 E;  1X6E A;  4BA1 B;  2V87 A;  2JEB A;  3K1J A;  4P7D A;  2EOM A;  3HUL A;  2IOP A;  5L3J A;  4M9V C;  4FW3 A;  2EPA A;  2ODR D;  3MSW A;  4ZYG A;  4OZE A;  2DLQ A;  1Y5Y A;  1YZ9 A;  2LV2 A;  5DNY A;  2N8X A;  3J81 C;  1AAY A;  2BA1 D;  1X6H A;  4DR2 E;  3F6H A;  2EN2 A;  2EPC A;  3PYG A;  2EPU A;  2V89 A;  3C6K A;  5DNX A;  1XMQ I;  2EML A;  2VF1 A;  5AC4 A;  2L3J A;  1YYK A;  2RS7 A;  2A2D A;  4DR6 E;  2NN6 D;  1P47 A;  3IWB A;  4DU8 A;  1XNQ I;  1Z0W A;  4IS9 A;  3U1K A;  3PS2 A;  4IZK A;  4DR1 I;  2EE8 A;  4DV4 I;  2YTN A;  2IES A;  2NPF A;  3WU6 A;  4BHB A;  3M85 D;  5FLX Q;  4X8W A;  1BKN A;  5K36 C;  3DF6 A;  2JXP A;  2KOU A;  4USM A;  2N3G A;  4HAC A;  5C0X E;  2YTP A;  4MYT A;  4R2P A;  2VQE E;  2MC6 A;  2J7J A;  2WBS A;  4KHP I;  2GO3 A;  4PRX A;  4DV5 E;  5ADZ A;  4IS1 C;  1H73 A;  5EL9 A;  3VYY A;  4JI4 E;  4M2Z A;  2EMW A;  4OKG A;  1RC7 A;  1UN6 B;  2V8Q B;  5F3W A;  4M0V A;  2RPC A;  2EOR A;  3VK6 A;  4X64 E;  3PYE A;  4JYA E;  5A6J A;  4MU0 A;  1ZM9 A;  4LFC E;  3WU3 A;  4DUY I;  4ZVI A;  2N3H A;  2E5L E;  4UT4 A;  2YRH A;  2LT7 A;  2NN6 A;  2EM4 A;  2J7K A;  2HHH E;  2EN4 A;  5T6J A;  4DR2 I;  4RHB B;  2R1F A;  2NAB A;  4X66 E;  1R6L A;  3OTO I;  3ZOQ B;  3THO B;  4I3H A;  4O5G A;  3HQ1 A;  4AQY E;  1I94 I;  2UUC E;  3J80 Q;  2WNR A;  4DR7 I;  2EPR A;  1X48 A;  3C6M A;  3AV0 A;  4ZYH A;  1UBD C;  2EMF A;  4FW4 A;  3K17 A;  1T4N A;  2L2M A;  4WSP A;  4OO1 D;  2ENC A;  1N0V C;  5KL7 A;  2BR2 A;  1N34 I;  4J3D A;  2JVA A;  3HTX A;  4PRV A;  3J81 Q;  2WW4 A;  2E72 A;  1OJ4 A;  4O4K A;  4F6N A;  2ZIT A;  2VQE I;  1N0U A;  1A1H A;  5JEA E;  4AID A;  2IHR 1;  1A6F A;  3KWR A;  4NXM E;  3IWD A;  2VRD A;  2DEI A;  4FN5 A;  4DV5 I;  4LFB I;  2LMZ A;  4JI4 I;  2DGC A;  2UUA E;  3PYF A;  2NN6 F;  3CWV A;  3C4T A;  2C37 A;  2CSH A;  4DV7 E;  4DPY A;  3ZKB A;  3FIG A;  2JT2 A;  1WUU A;  2E5L I;  2L3C A;  4F2J C;  3GON A;  4LU9 A;  4OOG C;  4F9A B;  1DQ3 A;  2PO0 A;  1EH7 A;  1X5W A;  3P3G A;  1FJG I;  2YTO A;  2VQF E;  4X65 I;  5IXM B;  4BBY A;  2YU8 A;  1Z0T A;  3PRY A;  5DRR A;  4X66 I;  2F8B A;  3M7N D;  4IZJ D;  4OO1 A;  4RH8 A;  4YY3 I;  2EOI A;  2YSO A;  3BID A;  2NUF A;  3JU0 A;  1E3P A;  1EI1 A;  2HFU A;  1K47 A;  2GO4 A;  4LF7 I;  2L6M A;  1TN9 A;  2O1T A;  2LBS B;  2EPL X;  2CT1 A;  1ZAA C;  1H74 A;  2UXD I;  5A2Q Q;  4WX9 A;  1R6M A;  1LLM C;  3V2U C;  3QG5 C;  4BA2 A;  4AM3 A;  4IJD A;  5FLX C;  4GQU A;  2YPN A;  2HFS A;  1BB8 A;  1P42 A;  2ZM6 I;  2V2Z A;  4DPX A;  2UUA I;  1XMQ E;  5CFF E;  1N3G A;  4GKK E;  1HNW I;  4BHC A;  4DV6 E;  2MKN A;  2J65 A;  2EM2 A;  2G7H A;  4HTG A;  1NHJ A;  1Y4S A;  1XNQ E;  4MDT A;  4R1F A;  4F9C B;  4DV7 I;  4HAC B;  3RMP A;  4P52 A;  2BM0 A;  3IWC A;  2EQ1 A;  4DR1 E;  4DV4 E;  1OYS A;  2EPP A;  4IZJ A;  2BV3 A;  2E1M A;  2EL4 A;  2EM7 A;  3QT5 A;  3P76 A;  1FI4 A;  4WFT A;  5KL3 A;  2EMB A;  1PVG A;  2JP9 A;  3JAM Q;  2LRS A;  2L2K B;  4LF5 I;  4XTJ A;  2EOO A;  4KHP E;  1Z0C A;  1D6T A;  2WZO A;  1NCS A;  1YPN A;  2YTI A;  1HR0 E;  3EPH A;  3B78 A;  4LPF A;  4NHR A;  4Q35 B;  2C38 B;  3J80 C;  2NN6 B;  1FWL A;  2WBU A;  5IT9 Q;  4FWH A;  1KKH A;  4EMD A;  2X7I A;  2JOX A;  4DUY E;  3KRN A;  4QNJ A;  4DV1 I;  5K36 D;  1Z5C A;  2EMH A;  2EN1 A;  3KZY A;  1AH5 A;  1Z59 A;  3Q1Q A;  2RTX A;  2LE2 A;  2R76 A;  3BBG A;  2WNR B;  4FWG A;  2EPK X;  1PIE A;  3F0N A;  4IFD E;  4YHH E;  4URL A;  1KVK A;  4IFD F;  3OTO E;  3QT7 A;  4NXN E;  4GKK I;  1Z5A A;  1Y60 A;  1I94 E;  4DR7 E;  2C39 A;  3B4T A;  4JG4 A;  4DV6 I;  2EN3 A;  4JI7 I;  1PJS A;  5C0X C;  2PO2 A;  5AAS A;  2ENA A;  2EMK A;  1ZU1 A;  2HK2 A;  1DI2 A;  1KYQ A;  2L2N A;  5KL4 A;  1NEI A;  4U3D A;  3U1Y A;  2V85 A;  4ZYD A;  1DAR A;  3P06 A;  2PNL A;  2EOH A;  1N34 E;  2JE6 A;  2EOY A;  2AJ4 A;  2EPO A;  2C37 B;  1S4E A;  2BA0 G;  2DB2 A;  1MGT A;  1Z0V A;  4ED4 A;  1YFH A;  5IWA I;  2M7Q A;  4LFB E;  4ISA A;  5K36 A;  1WHQ A;  1KJK A;  4WXD A;  1HNZ E;  4LF6 E;  1HR0 I;  2MKD A;  4WUB A;  1A1J A;  4NZV A;  2E1R A;  2WP8 A;  3B82 A;  4R2D A;  1ZM4 A;  4B3T E;  4PU9 A;  2YTG A;  1YSA C;  1USV A;  2EOF A;  1DGC A;  3KZZ A;  2BB8 A;  4UTG A;  2EMG A;  2GPI A;  1IBK E;  1IQO A;  3H1C A;  1X3C A;  2JY9 A;  2EM5 A;  5LL6 R;  1A1K A;  1EA6 A;  2UUB E;  2V2Q A;  2Z5C A;  2YU5 A;  5A69 A;  1FJG E;  5DNL A;  4YHH I;  3EPL A;  4X65 E;  3M6A A;  1MU5 A;  2X36 A;  3HXL A;  1U2R A;  4NXN I;  2UXC I;  2VES A;  2H36 X;  4GEQ B;  4YY3 E;  4FW7 A;  2R42 A;  4BMJ A;  2EPX A;  3BGH A;  1QZR A;  2V83 A;  2UU9 E;  1WJP A;  4LF7 E;  5JEA C;  4BA2 B;  2YRK A;  4K0K I;  4DV0 I;  2EN6 A;  5A2Q C;  1UDS A;  2EJ4 A;  2YRM A;  2ELY A;  2UXD E;  1UDQ A;  4P78 A;  4R2Q A;  4BC9 A;  1VIS A;  1EKZ A;  4R2C A;  1RRE A;  2VF3 A;  4MQY A;  2LJU A;  2EM9 A;  4LF4 E;  4AIM A;  3LTO A;  2OI2 A;  1FNM A;  2NN6 E;  4R2S A;  2EPM X;  3JTZ A;  2BA1 G;  2ZM6 E;  3JAM C;  5GME A;  2YTD A;  4DPW A;  1HNZ I;  4LF6 I;  4JI1 E;  2EZ6 A;  4IFD B;  4MLV A;  4ZYE A;  2YTE A;  4TUG A;  4IZJ B;  1HNW E;  5JEA F;  3T1H I;  2DLK A;  4FK5 C;  2O1V A;  4B3T I;  4DXL A;  2I9I A;  2B3T B;  5IT9 C;  4DR5 I;  3F6G A;  4JI6 E;  2NA2 A;  2AE8 A;  1ZM2 A;  2PRT A;  3K6Q A;  4WUD A;  3L00 A;  3Q6N A;  1IBK I;  5FWK A;  3TQM A;  3T1Y E;  1T39 A;  4M30 A;  1KTV A;  3PS1 A;  3ZM7 A;  2EM8 A;  4X62 E;  4TUI A;  3M85 G;  2PNZ B;  2UUB I;  1T38 A;  1YUI A;  4O43 A;  4FWD A;  4LF5 E;  4R8O A;  1T4L B;  1JK1 A;  2HKE A;  3ZZ0 A;  2B9D A;  4B3M I;  4X9J A;  4DUZ E;  3EPJ A;  2JEB B;  2O1U A;  1N32 I;  1QU6 A;  2EOQ A;  2Z5B A;  2D9H A;  5BR8 I;  4QNK A;  4WXC A;  2UU9 I;  2PO1 A;  1PJQ A;  1N36 I;  1FKA E;  4B3S I;  4JI0 E;  4L5N C;  1WRJ A;  2CGE A;  4DV1 E;  1YH8 A;  1S16 A;  4DKK A;  4WSG A;  4LF9 E;  2JYA A;  2RSI A;  3THN A;  1Z0B A;  3GLL A;  1SR9 A;  3ECR A;  1Y6Z A;  2GQ0 A;  1MX0 A;  4LF4 I;  1Z0E A;  3B8H A;  4U3B A;  2EN7 A;  4MU4 A;  2GS8 A;  4IZK B;  4I8O A;  4JI1 I;  3HKM A;  2HJJ A;  4F54 A;  4JI7 E;  2O3Z A;  2EMI A;  2JE6 B;  3H4L A;  4JI8 I;  4OO1 E;  2L8T A;  3WU4 A;  2LJP A;  4JI6 I;  1ZBQ A;  5AE1 A;  4OO1 F;  2YTJ A;  3T1Y I;  3AUZ A;  1XXE A;  4WPY A;  1XNR I;  1SFE A;  3UK3 C;  2EN8 A;  4X62 I;  1USU A;  1UHZ A;  1TF3 A;  4BC7 A;  1A1I A;  2DSY A;  2WP8 B;  4LF8 I;  4HEI A;  2HGH A;  5IWA E;  2WCC 3;  4DUZ I;  3GME A;  2NUG A;  2M9A A;  4GKJ I;  3VHT B;  2RSM A;  5C0X D;  2GHF A;  1L4S A;  2EL6 A;  2HK3 A;  4F6M A;  4IFD C;  5KL6 A;  2B7V A;  4MLQ A;  4JI0 I;  3ADL A;  1UEK A;  5TSE A;  4WYQ B;  3EPK A;  1NHI A;  3J7Y p;  3DD6 A;  5LMU I;  1H72 C;  2EFG A;  2KHX A;  4LF9 I;  3ADG A;  2V88 A;  4L8N A;  1A1G A;  2YSP A;  1UIL A;  4LFA I;  3LLH A;  4R2E A;  4OX9 I;  1RQ0 A;  2EMX A;  4N4R B;  2PNM A;  2FV4 B;  4LTY A;  2EQ0 A;  2IOQ A;  4JI3 E;  1BBO A;  1YYO A;  2UXC E;  1H7U A;  4DR3 I;  4M1K A;  2WBT A;  3M7N G;  3HPZ A;  2BR2 B;  4Z7C A;  3P1X A;  1PKP A;  1J26 A;  1YHC A;  2HKJ A;  2EM6 A;  3P3C A;  2LTS A;  2UXB I;  1Z0G A;  2EQ3 A;  1B69 A;  4K0K E;  4DV0 E;  5AE2 A;  2JR1 A;  5LMN E;  2VE7 C;  2EL5 A;  3L7Z A;  1HNX I;  2ENH A;  2EM3 A;  3C4B A;  4JV5 E;  5C0X A;  1GZ6 A;  2EOE A;  4JI5 I;  2LUP B;  1J5E I;  4R2A A;  3GCM A;  1IBM I;  2V8P A;  1WXR A;  2GLI A;  2YT4 A;  1E3H A;  3PYD A;  2EOS A;  1ZR9 A;  5JEA D;  2DMY A;  3T1H E;  2K4V A;  2EPZ A;  2EMA A;  3P3E A;  2LTR A;  2PO0 B;  2JEA A;  1XMO E;  4DR4 I;  3BF2 A;  1O0W A;  4DR5 E;  1G2D C;  2LO3 A;  2BBG A;  4OO1 B;  2JWO A;  2L92 A;  2Z5B B;  2CZ9 A;  3ZZT A;  3OML A;  3D4J A;  4DU7 A;  1TF6 A;  2PO1 B;  2M1S A;  2F4V I;  2ODR C;  1VI7 A;  4JI3 I;  1Y4U A;  3MHS C;  4B3M E;  1GQE A;  2Q8U A;  3LNU A;  1N32 E;  5A6A A;  3ZZU A;  4FW9 A;  1JK2 A;  5C0X F;  1IBL I;  5DRP A;  5BR8 E;  3Q6M A;  5K36 E;  1XHK A;  1EH8 A;  1N36 E;  2V34 A;  2RS6 A;  4WUC A;  4B3S E;  2NN6 C;  5LMN I;  3DJW A;  1N33 I;  5K36 F;  4LCF A;  4BS9 A;  1MEY C;  1Z5B A;  2EP3 A;  1ZXM A;  4DV3 E;  2YZT A;  1G2F C;  4JV5 I;  1PDA A;  4BCA A;  4HYM A;  1UDN A;  2ZBK B;  4LOM A;  5AE3 A;  5JEA A;  1NHH A;  2C38 A;  4J8Z A;  1YYW A;  3VYX A;  4BA1 A;  2XEX A;  3CDI A;  4Z7Y A;  1FWK A;  4LCG A;  4MYU A;  3HJC A;  2Z5E A;  2MDG A;  2EM0 A;  3PS3 A;  4B3R E;  4R2R A;  3NZK A;  2CPN A;  4JI8 E;  5A6B D;  2CG9 A;  4NBQ A;  1XMO I;  4DR6 I;  4JI2 E;  2MDR A;  4P7A A;  2JPA A;  1MG7 A;  2IER A;  2EOX A;  4F9B B;  2L33 A;  4N3O A;  3MHH C;  1XNR E;  3EQ1 A;  1NZ0 A;  1Z1B A;  2B7T A;  1YUJ A;  2YWQ A;  1F2I G;  4LF8 E;  4O24 A;  4MU1 A;  2EMZ A;  2DMI A;  2DRP A;  1OYP A;  3J7A M;  5ELW A;  4GKJ E;  1KIJ A;  1X49 A;  1RMD A;  5LLQ A;  3CDJ A;  2Q2E B; 
#chains in the Genus database with same CATH homology
 2O1W A;  2JOB A;  1HK7 A;  4X64 I;  4JYA I;  3H09 A;  3ADJ A;  4DV2 E;  4LFC I;  5LMU E;  4DV3 I;  2MC5 A;  1ZXN A;  4Q28 A;  4LFA E;  2FTX B;  2HHH I;  1T4O A;  2V86 A;  4OX9 E;  1X47 A;  4DR3 E;  4B3R I;  4AQY I;  2UUC I;  4JI2 I;  2UXB E;  3QT6 A;  4KQV A;  1STU A;  1B63 A;  3QT8 A;  3ADI A;  4DMI A;  1HNX E;  2M4I A;  2LUQ A;  2NUE A;  2KON A;  4JI5 E;  4DPT A;  1J5E E;  4HY1 A;  4KZS A;  1IBM E;  4NXM I;  2LJH A;  1ZBT A;  2DIX A;  3WU5 A;  1ZM3 A;  2Z5C B;  4DV2 I;  4DR4 E;  2FGG A;  4DPU A;  2R3V A;  4USK A;  4R03 A;  3ZKD A;  2V2V A;  1ELO A;  2F4V E;  3K85 A;  2A2C A;  5GMD A;  2BM1 A;  4HXZ A;  2VQF I;  3LML A;  3J7A G;  2DEJ A;  1H7S A;  3LPS A;  4RPF A;  1IBL E;  1WHN A;  3HPS A;  1RR9 A;  2EWL A;  3V5R A;  1B62 A;  1N33 E;  2V87 A;  3K1J A;  4P7D A;  3HUL A;  2IOP A;  5L3J A;  3MSW A;  2ODR D;  1YZ9 A;  5DNY A;  3J81 C;  4DR2 E;  3F6H A;  3PYG A;  2V89 A;  1XMQ I;  2VF1 A;  2L3J A;  1YYK A;  2RS7 A;  2A2D A;  4DR6 E;  1XNQ I;  3IWB A;  4DU8 A;  1Z0W A;  4IZK A;  4DR1 I;  4DV4 I;  2NPF A;  3WU6 A;  5FLX Q;  4X8W A;  1BKN A;  3DF6 A;  2KOU A;  4USM A;  2N3G A;  4HAC A;  4MYT A;  2VQE E;  2MC6 A;  4KHP I;  4PRX A;  4DV5 E;  5ADZ A;  1H73 A;  3VYY A;  4JI4 E;  4M2Z A;  1RC7 A;  2V8Q B;  5F3W A;  4M0V A;  3VK6 A;  4X64 E;  3PYE A;  4JYA E;  1ZM9 A;  4LFC E;  3WU3 A;  4DUY I;  4ZVI A;  2N3H A;  2E5L E;  4UT4 A;  2J7K A;  2HHH E;  5T6J A;  4DR2 I;  4X66 E;  3OTO I;  3ZOQ B;  4I3H A;  4AQY E;  3HQ1 A;  1I94 I;  4DR7 I;  2UUC E;  3J80 Q;  1X48 A;  3AV0 A;  3K17 A;  1T4N A;  2L2M A;  4WSP A;  1N0V C;  1N34 I;  3J81 Q;  2JVA A;  3HTX A;  4PRV A;  2WW4 A;  1OJ4 A;  2ZIT A;  2VQE I;  1N0U A;  2IHR 1;  1A6F A;  3KWR A;  4NXM E;  3IWD A;  2DEI A;  4FN5 A;  4DV5 I;  4LFB I;  2LMZ A;  4JI4 I;  3PYF A;  2UUA E;  3CWV A;  3C4T A;  4DV7 E;  4DPY A;  3ZKB A;  3FIG A;  1WUU A;  2E5L I;  2L3C A;  3GON A;  4LU9 A;  4OOG C;  4F9A B;  1DQ3 A;  1FJG I;  2VQF E;  4X65 I;  3PRY A;  4BBY A;  4X66 I;  1Z0T A;  2F8B A;  4IZJ D;  4YY3 I;  2NUF A;  3JU0 A;  1EI1 A;  2HFU A;  1K47 A;  4LF7 I;  2L6M A;  2O1T A;  2LBS B;  1H74 A;  2UXD I;  3V2U C;  5FLX C;  2HFS A;  2ZM6 I;  2V2Z A;  4DPX A;  2UUA I;  1XMQ E;  5CFF E;  4GKK E;  1HNW I;  4DV6 E;  5A2Q Q;  4R1F A;  2G7H A;  1NHJ A;  1Y4S A;  4DV7 I;  1XNQ E;  4F9C B;  4HAC B;  3RMP A;  4P52 A;  2BM0 A;  3IWC A;  4DR1 E;  4DV4 E;  4IZJ A;  2BV3 A;  2E1M A;  3QT5 A;  1FI4 A;  4WFT A;  1PVG A;  3JAM Q;  2LRS A;  2L2K B;  4LF5 I;  4XTJ A;  4KHP E;  1Z0C A;  1D6T A;  2WZO A;  1HR0 E;  3B78 A;  5IT9 Q;  3J80 C;  1FWL A;  4FWH A;  1KKH A;  4EMD A;  2X7I A;  2JOX A;  4DUY E;  4DV1 I;  1Z5C A;  3Q1Q A;  1Z59 A;  2RTX A;  2LE2 A;  4FWG A;  1PIE A;  3F0N A;  4YHH E;  4URL A;  1KVK A;  3OTO E;  3QT7 A;  4NXN E;  4GKK I;  1Z5A A;  1I94 E;  4DR7 E;  4JI7 I;  4JG4 A;  4DV6 I;  5AAS A;  2HK2 A;  1DI2 A;  2L2N A;  2V85 A;  1DAR A;  3P06 A;  2PNL A;  1N34 E;  2AJ4 A;  1S4E A;  2DB2 A;  1Z0V A;  4ED4 A;  5IWA I;  2M7Q A;  4LFB E;  1WHQ A;  1HNZ E;  1HR0 I;  4LF6 E;  4WUB A;  2E1R A;  3B82 A;  1ZM4 A;  4B3T E;  4PU9 A;  1USV A;  4UTG A;  1IBK E;  2JY9 A;  1EA6 A;  5LL6 R;  2V2Q A;  2UUB E;  2Z5C A;  4YHH I;  1FJG E;  3M6A A;  4X65 E;  1MU5 A;  2X36 A;  3HXL A;  1U2R A;  4NXN I;  2UXC I;  2H36 X;  4GEQ B;  4YY3 E;  2R42 A;  4BMJ A;  1QZR A;  2V83 A;  2UU9 E;  4LF7 E;  4K0K I;  4DV0 I;  5A2Q C;  2UXD E;  4P78 A;  1VIS A;  4BC9 A;  1EKZ A;  1RRE A;  2VF3 A;  4LF4 E;  3LTO A;  2OI2 A;  1FNM A;  3JTZ A;  4DPW A;  2ZM6 E;  3JAM C;  5GME A;  1HNZ I;  4LF6 I;  4JI1 E;  2EZ6 A;  4TUG A;  4IZJ B;  1HNW E;  3T1H I;  2O1V A;  4B3T I;  4DXL A;  2B3T B;  5IT9 C;  4DR5 I;  3F6G A;  4JI6 E;  2NA2 A;  1ZM2 A;  4WUD A;  3K6Q A;  3Q6N A;  1IBK I;  5FWK A;  3T1Y E;  4M30 A;  1KTV A;  3ZM7 A;  4X62 E;  4TUI A;  2UUB I;  4FWD A;  4LF5 E;  4R8O A;  1T4L B;  4B3M I;  2HKE A;  3ZZ0 A;  2B9D A;  4DUZ E;  1N32 I;  2O1U A;  1QU6 A;  2Z5B A;  5BR8 I;  2UU9 I;  1N36 I;  1FKA E;  4B3S I;  4JI0 E;  4L5N C;  2CGE A;  4DV1 E;  1S16 A;  4DKK A;  4LF9 E;  1Z0B A;  1SR9 A;  2GQ0 A;  1Y6Z A;  1MX0 A;  4LF4 I;  1Z0E A;  3B8H A;  2GS8 A;  4IZK B;  4I8O A;  4JI1 I;  4F54 A;  4JI7 E;  3H4L A;  4JI8 I;  2L8T A;  3WU4 A;  2LJP A;  4JI6 I;  1ZBQ A;  5AE1 A;  3T1Y I;  3AUZ A;  4WPY A;  1XNR I;  4X62 I;  1USU A;  1UHZ A;  4BC7 A;  2DSY A;  4LF8 I;  5IWA E;  4DUZ I;  2NUG A;  4GKJ I;  2RSM A;  2HK3 A;  2B7V A;  4JI0 I;  3ADL A;  1UEK A;  1NHI A;  4WYQ B;  3J7Y p;  5LMU I;  1H72 C;  2EFG A;  2KHX A;  4LF9 I;  3ADG A;  2V88 A;  4L8N A;  1UIL A;  4LFA I;  3LLH A;  4OX9 I;  1RQ0 A;  2PNM A;  2FV4 B;  4LTY A;  2IOQ A;  4JI3 E;  1YYO A;  2UXC E;  1H7U A;  4DR3 I;  4M1K A;  3HPZ A;  4Z7C A;  3P1X A;  1PKP A;  1J26 A;  2HKJ A;  2LTS A;  2UXB I;  1Z0G A;  4K0K E;  4DV0 E;  5AE2 A;  2JR1 A;  5LMN E;  2VE7 C;  1HNX I;  3C4B A;  4JV5 E;  1GZ6 A;  4JI5 I;  2LUP B;  1J5E I;  1IBM I;  2V8P A;  1WXR A;  2YT4 A;  3PYD A;  2DMY A;  3T1H E;  2K4V A;  2LTR A;  1XMO E;  4DR4 I;  1O0W A;  4DR5 E;  2JWO A;  2L92 A;  2Z5B B;  2CZ9 A;  3ZZT A;  3OML A;  3D4J A;  4DU7 A;  2M1S A;  2F4V I;  2ODR C;  4JI3 I;  1Y4U A;  4B3M E;  1GQE A;  3LNU A;  1N32 E;  3ZZU A;  4FW9 A;  1IBL I;  5BR8 E;  3Q6M A;  1XHK A;  1N36 E;  2V34 A;  2RS6 A;  4WUC A;  4B3S E;  5LMN I;  3DJW A;  1N33 I;  4BS9 A;  1Z5B A;  1ZXM A;  4DV3 E;  2YZT A;  4JV5 I;  4HYM A;  4BCA A;  2ZBK B;  5AE3 A;  1NHH A;  4J8Z A;  1YYW A;  3VYX A;  2XEX A;  4Z7Y A;  1FWK A;  4MYU A;  3HJC A;  2Z5E A;  4B3R E;  2CPN A;  4JI8 E;  2CG9 A;  4DR6 I;  1XMO I;  4JI2 E;  2MDR A;  4P7A A;  1MG7 A;  4F9B B;  2L33 A;  4N3O A;  1XNR E;  1NZ0 A;  2B7T A;  4LF8 E;  3J7A M;  4GKJ E;  1KIJ A;  1X49 A;  2Q2E B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...