1HR0E

Crystal structure of initiation factor if1 bound to the 30s ribosomal subunit
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
150
structure length
150
Chain Sequence
b'DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Crystal structure of an initiation factor bound to the 30S ribosomal subunit.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ribosome
total genus 34
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2000-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1hr0E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1hr0E02
1X47A 4USMA 4JI1E 5CFFE 1D6TA 4JG4A 4Z7YA 3C4TA 4DR5I 2HFUA 3T1YE 2LRSA 1N33E 4DV1I 1DI2A 1PKPA 4JI0E 2RS6A 3VYXA 1U2RA 4HYMA 1N36I 4DU8A 1ZBTA 2VQFI 4JI7I 4LF8E 2UXDI 2LJHA 3Q1QA 3HTXA 1RR9A 1WUUA 2DIXA 3QT6A 2L2KB 1EA6A 4FWGA 1KTVA 3J7AM 5A2QQ 2NUEA 4GKKE 2VQEI 4DPUA 1IBLE 4JYAI 4JI3E 3V2UC 2E5LE 1NHHA 4JV5E 2UXBI 1XNRI 2R3VA 1XHKA 4LFBI 2LUQA 2E1RA 4LF7E 2ZITA 2F4VI 1I94E 4DV3I 1ZM2A 4X66I 3P1XA 4OOGC 4HACA 1N0UA 5IWAI 2A2CA 1N34I 2Q2EB 1QU6A 1KVKA 2EZ6A 1KKHA 3J7AG 4P7AA 1ZM3A 4NXMI 3PYDA 4B3SI 3WU6A 1N36E 4B3MI 2KHXA 4FWDA 1J5EI 3JAMC 1N0VC 4FWHA 1ELOA 4WUCA 1UHZA 1Z0CA 2NA2A 3D4JA 1HNZI 1ZXMA 1FJGE 3H4LA 3OTOE 5LMNI 3V5RA 2BM0A 4YHHE 4WUBA 1BKNA 4DV7I 4DV6I 1WHQA 2UXBE 1HNWI 4LFAE 4ED4A 1GQEA 1PIEA 1YYKA 1YZ9A 4DR4I 3QT5A 4LFCI 1T4NA 4YY3I 1DARA 1NZ0A 4URLA 1IBME 1XMQI 1ZM4A 4MYTA 2YT4A 2JY9A 3VYYA 1IBKI 4LF5I 1WHNA 1NHIA 1OJ4A 3K17A 3J80Q 4DR2I 4JI8E 4P52A 4DR7I 4LF6I 4GKJE 2HK3A 4DUZI 2UUCE 3J81Q 1Z5CA 1Z0TA 1S16A 1Z59A 1UEKA 1NHJA 5FLXQ 4K0KI 2L3CA 3B82A 1RQ0A 1HNZE 5BR8I 1HNXE 4JI4I 5LMNE 1QZRA 4USKA 4B3RE 4DV6E 3B8HA 2X7IA 2B7TA 4DUYI 4OX9I 1HNWE 1XNQI 2UUBE 3WU4A 4JI5I 3PYGA 1EKZA 5GMEA 4LFCE 2RSMA 4WFTA 3HULA 4YY3E 4LF4E 5LL6R 1YYOA 4HY1A 4DV5I 5IT9C 2UXCE 1B62A 3ZZTA 2ZBKB 4DR3I 2B7VA 2N3HA 3C4BA 2ZM6I 4M1KA 1XMOI 2L3JA 4DR1E 1HR0I 3T1HI 2MDRA 2HKEA 2WW4A 4B3TI 4KHPE 2GS8A 2LTSA 4DUZE 1UILA 2UUAE 1KIJA 1J26A 1RREA 4DR6I 4UTGA 4X64I 4K0KE 3WU3A 4ZVIA 2B3TB 4RPFA 1Z0BA 5BR8E 4DU7A 4JI4E 3PYFA 2CPNA 4XTJA 4AQYI 4DR5E 2V2VA 3ZZUA 1FWLA 4DV1E 2V34A 4DV0I 3ZKBA 1FKAE 4HXZA 3ADGA 2DEJA 2VQFE 4JI7E 2UXDE 1Z0VA 4LF9I 1PVGA 3ZM7A 4DPWA 4X65I 4DR3E 2ZM6E 1MU5A 2XEXA 4X62I 2IHR1 2VQEE 4JYAE 2HHHI 1N32I 3T1HE 2HFSA 4DKKA 3LTOA 1ZM9A 4NXNI 1XNRE 4DV2I 5FLXC 2DEIA 4LFBE 2V2ZA 4DV4I 4DR6E 2F4VE 3GONA 4DV3E 1MX0A 3ADLA 4X66E 2R42A 4JI1I 4DPTA 2LJPA 5IWAE 2V8PA 1S4EA 1N34E 4PRVA 4AQYE 3PYEA 4JI6I 4DXLA 4WUDA 3T1YI 4NXME 4HACB 1N33I 2RS7A 2RTXA 1STUA 4B3SE 2NUGA 4B3ME 2HK2A 1J5EE 4LF8I 4LF9E 2CZ9A 5A2QC 1ZXNA 3JAMQ 4UT4A 2BV3A 4X62E 2HHHE 1N32E 4GKKI 1T4OA 2L2MA 1IBLI 4DV7E 3ADIA 1H73A 2E5LI 4JV5I 2DMYA 2NPFA 3K1JA 2LBSB 4DR4E 4DV4E 4LF7I 2A2DA 1I94I 2OI2A 3LNUA 1XMQE 3LLHA 3F0NA 4JI6E 1IBKE 1H72C 3QT7A 4LF5E 2LUPB 4DR2E 1RC7A 4DR7E 4LF6E 3ZKDA 1O0WA 4DPYA 4PU9A 1H7SA 3M6AA 1X48A 1A6FA 1YYWA 2L2NA 4MYUA 2NUFA 3QT8A 2BM1A 1FJGI 3OTOI 5LMUI 4YHHI 5L3JA 1MG7A 1FNMA 4OX9E 4DUYE 1XNQE 4JI5E 4LFAI 5GMDA 1T4LB 4Z7CA 1X49A 4DV5E 2EFGA 1IBMI 1K47A 4M2ZA 5IT9Q 1XMOE 2X36A 3LPSA 4X8WA 1Z0EA 1HR0E 3CWVA 3J80C 3ZZ0A 2UU9I 1Z0GA 4B3TE 3J81C 4JI8I 2J7KA 1Z0WA 4GKJI 2UUCI 4WYQB 4X64E 4JI2I 2V2QA 1Z5BA 2AJ4A 4KQVA 4M30A 2DB2A 5LMUE 4FN5A 4EMDA 1H7UA 1HNXI 1FI4A 4PRXA 2JVAA 4FW9A 4B3RI 1H74A 2UUBI 2N3GA 3J7Yp 4DV0E 4JI0I 1VISA 2LTRA 1B63A 4DPXA 4LF4I 4X65E 1EI1A 1FWKA 2UXCI 3B78A 4R1FA 3WU5A 2L33A 4DR1I 4JI3I 2VF3A 2UU9E 4NXNE 4KHPI 4DV2E 4I3HA 2HKJA 2UUAI 3ADJA 4JI2E 1Z5AA
chains in the Genus database with same CATH superfamily
1X47A 4USMA 1Z1BA 4JI1E 2YRMA 4Q35B 5CFFE 1D6TA 4JG4A 2Z5CA 4WX9A 2EPCA 4MLVA 1Y60A 2JT2A 4Z7YA 1JK2A 2C38A 1TF6A 2CTDA 3C4TA 4DR5I 2WNRB 3PRYA 2HFUA 3T1YE 2LRSA 1N33E 4DV1I 2EN2A 1DI2A 1PKPA 4JI0E 5KL6A 2EPLX 2RS6A 4F6NA 2GPIA 4IFDD 4BA2A 3VYXA 2K4VA 1U2RA 4HYMA 1N36I 4DU8A 2M7QA 1ZBTA 2VQFI 2FGGA 4JI7I 2YTIA 4LF8E 1DQ3A 2UXDI 4LOMA 1X3CA 3BGHA 4IZKA 2K7IA 1UDQA 2ADRA 2LJHA 3Q1QA 1ZU1A 3HTXA 3ECRA 2EOXA 1RR9A 2DIXA 1WUUA 3BIDA 3QT6A 2EN6A 2L2KB 1EA6A 2D9HA 2YTEA 2MKNA 4FWGA 4AM3A 3HQ1A 1KTVA 3J7AM 5A2QQ 2LT7A 2L6MA 1RHYA 3HXLA 2NUEA 1A1HA 4GKKE 3M85G 2VQEI 4MU1A 1IBLE 4DPUA 4JYAI 4OO1C 4JI3E 3V2UC 1P42A 4O24A 1X6EA 2E5LE 2EOOA 1NHHA 4JV5E 3EQ1A 1UDNA 2LCEA 3KZZA 3KRNA 2UXBI 2EN3A 2EN4A 1XNRI 5TSEA 2LV2A 3LMLA 1XHKA 2NN6D 2R3VA 3MSWA 3UHMA 4LFBI 3C6KA 2LUQA 2E1RA 2R1FA 3GLLA 3U1YA 4BHCA 4LF7E 2ZITA 2F4VI 1I94E 4DV3I 3M7NG 2M1SA 2V8QB 4R2SA 1ZM2A 1GZ6A 4X66I 4R2QA 3P1XA 5AE2A 2VRDA 1Y4SA 1HK7A 5A6AA 3UK3C 4OOGC 4HACA 1N0UA 5IWAI 4MU4A 4R2CA 2A2CA 5JEAE 1N34I 2ODRC 2BA1D 2Q2EB 2DRPA 1QU6A 1KVKA 2EZ6A 3J7AG 2E72A 2EORA 1KKHA 1R6MA 4P7AA 1ZM3A 4NXMI 2FTXB 2E1MA 3PYDA 4I8OA 1QNTA 4B3SI 3WU6A 4ZYDA 2ENHA 1N36E 4F9BB 4B3MI 2KHXA 4FWDA 5DNYA 1P47A 1J5EI 3JAMC 4O4KA 1LLMC 1N0VC 4FWHA 1G2DC 1ELOA 4WUCA 3EPHA 4OX9I 4WXDA 1UHZA 5DROA 2KONA 4DMIA 1Z0CA 2NA2A 3D4JA 2EOSA 2MC6A 2MKDA 5KL7A 2EL4A 3ZOQB 1Y5YA 2EWLA 1HNZI 2JWOA 1ZXMA 1FJGE 3H4LA 3OTOE 2EMZA 3AUZA 2EOIA 5LMNI 3V5RA 2JEAA 1BB8A 2BM0A 3DF6A 4YHHE 3L7ZA 3THOB 4WUBA 1BKNA 2PO2B 4DV7I 2EMXA 1OYPA 1OYRA 4DV6I 1GTKA 1WHQA 2EOEA 2UXBE 1HNWI 4LFAE 2DGCA 4U3BA 1A1IA 4ED4A 2VF1A 1GQEA 2DLKA 1PIEA 4IZJB 4U3DA 1YYKA 1YZ9A 4DR4I 2YTQA 3QT5A 3PS2A 4LFCI 1T4NA 4BMJA 1USVA 5C0XD 3GCMA 4LCGA 1YPNA 4YY3I 2EMGA 1F2IG 1DARA 1A1FA 2YTGA 4ZYGA 4R2AA 1NZ0A 4URLA 1IBME 2LE2A 1XMQI 2F1DA 2C37B 4IFDE 1ZM4A 1ZR9A 2V89A 2YSPA 2JEBA 4MYTA 2JE6B 2YT4A 2JY9A 3HKMA 5DNXA 4OO1F 3VYYA 2EOMA 2ODRD 1IBKI 1UDSA 5K36A 4LF5I 1WHNA 2WCC3 2EMBA 1NHIA 1OJ4A 2EPUA 3K17A 5DRQA 3J80Q 4DR2I 4MU3A 4JI8E 1JK1A 4P52A 4BA1A 4DR7I 4LF6I 4GKJE 2HK3A 4DUZI 2UUCE 3J81Q 3L00A 1Z5CA 1TF3A 1Z0TA 1S16A 5IV8B 4NHRA 3EPLA 2M9AA 3P3EA 2R76A 3DD6A 1Z59A 2EOHA 1UEKA 4TUGA 1NHJA 2WP8A 5FLXQ 4K0KI 2L3CA 3B82A 1RQ0A 4F9CB 1HNZE 2H36X 4WSPA 2DMIA 5BR8I 2NN6E 1HNXE 4JI4I 5LMNE 2V85A 2YWQA 1QZRA 4USKA 2EM9A 4B3RE 2PO0B 4DV6E 5KL5A 3B8HA 4IFDA 2X7IA 1IMUA 2B7TA 1YH8A 4DUYI 4IS1C 1HNWE 1RMDA 2EQ3A 2UUBE 3WU4A 3PYGA 5JEAF 4JI5I 1XNQI 4ZYEA 1EKZA 2PO1A 1T38A 2ELYA 2EOQA 5GMEA 2EPOA 1MGTA 4LFCE 5JEAB 4J3DA 1A1JA 2Z5BB 2RSMA 4WFTA 3HULA 1ZBQA 2FV4B 5LL6R 2WZOA 4YY3E 1YYOA 4BCAA 3KWRA 5AE3A 4LF4E 5IT9C 4HY1A 2EPRA 4DV5I 2BA0D 1IQSA 3P06A 2UXCE 2EM4A 1B62A 1PJSA 1L4SA 3ZZTA 2VE7C 4J8ZA 4RHBB 2ZBKB 4DR3I 2B7VA 3M99B 2N3HA 3C4BA 3EPJA 1YFHA 1E3PA 2ZM6I 4M1KA 1XMOI 2L3JA 1PJTA 4R2EA 4DR1E 1HR0I 3T1HI 1YHCA 2EM3A 2MDRA 2EMHA 2BR2A 3F6GA 2HKEA 2NN6A 4BC9A 2WW4A 2V87A 4B3TI 2EMIA 5DRRA 4KHPE 3IWDA 2GS8A 3Q6MA 2LTSA 4DUZE 2PNZA 3GMEA 2EMKA 4BHBA 1IQOA 4FW3A 1UILA 1YUJA 2YTDA 2UUAE 5AE1A 1J26A 1KIJA 1RREA 4R2DA 3DJWA 5A6KA 3BBGA 3U1KA 4UTGA 4X64I 2ENAA 4K0KE 4DR6I 3WU3A 4ZVIA 2YRKA 1UDOA 2B3TB 4N4RB 4RPFA 1Z0BA 5BR8E 4DU7A 4LPFA 4JI4E 5AC5A 3PYFA 2CPNA 5A6BD 4XTJA 4AQYI 1E3HA 4DR5E 4FK5C 1KJKA 2V86A 5T6JA 2V2VA 3ZZUA 5C0XE 1FWLA 2YU8A 2Z5CB 4RH8A 4DV1E 2V34A 1EH8A 1A1GA 4IZJD 2C38B 2GO3A 5JEAC 4DV0I 3ZKBA 1X6HA 1FKAE 4HXZA 4HEIA 3ADGA 1EH7A 2MC5A 1R6LA 2EN8A 2DEJA 4JI7E 2VQFE 3H09A 4WXCA 1AH5A 4LU9A 2UXDE 1Z0VA 4LF9I 1PVGA 4BA2B 3ZM7A 4DPWA 2RPCA 4X65I 4IFDC 2YZTA 2LVHA 2C39A 2CG9A 2BB8A 4GEQB 4DR3E 3JTZA 2EMYA 2ZM6E 4BS9A 1MU5A 4IZKB 2XEXA 3KZYA 5K36E 4OO1A 4X62I 2IHR1 2VQEE 4LTYA 4JYAE 2HHHI 1N32I 3T1HE 1ZAAC 3Q6NA 4N3OA 2M4IA 2B9DA 2HFSA 4ISAA 5K36C 4DKKA 5ELWA 4OO1D 3M85D 2YTPA 3LTOA 4QNJA 3PS1A 1ZM9A 1VI7A 4NXNI 1XNRE 4DV2I 5FLXC 5C0XA 2DEIA 4F9AB 2EM0A 4LFBE 2IERA 4R8OA 2CGEA 2V2ZA 4DV4I 4DR6E 5ADZA 2F4VE 3B4TA 3GONA 2DLQA 4DV3E 1MX0A 2DSYA 2EM8A 3ADLA 4X66E 2R42A 5KL3A 4JI1I 4DPTA 4M0VA 2WNRA 2LJPA 2RSIA 5IWAE 2Q8UA 1X5WA 3VK6A 2V8PA 4FW4A 1S4EA 1N34E 4PRVA 4AQYE 3TQMA 3IWCA 3PYEA 2WBTA 4JI6I 5A6JA 4DXLA 3HJCA 3JU0A 4WUDA 2EE8A 2YU5A 4NXME 4HACB 4AIDA 4WPYA 2RS7A 5DNLA 3T1YI 2RTXA 1STUA 1N33I 4ZYHA 2CVEA 4FW5A 4B3SE 2O1WA 2PNLA 2NUGA 2GQ0A 3CDIA 4B3ME 3HPSA 3C6MA 2HK2A 1J5EE 1YUIA 4WSGA 4LF8I 5AASA 4LF9E 2CZ9A 2KOUA 1NCSA 5A2QC 1ZXNA 2BBGA 3JAMQ 4UT4A 3VHTB 4TUIA 2BV3A 3BF2A 2AE8A 1Y6ZA 3NZKA 4X62E 2GHFA 2HHHE 2V83A 1N32E 1OYSA 2IOPA 1T4OA 2EMCA 2EMWA 2L2MA 4BBYA 1IBLI 4GKKI 4MQYA 2YSOA 1N3GA 4DV7E 1TN9A 2EQ1A 1KYQA 3QG5C 3ADIA 1H73A 4MDTA 2E5LI 5LLQA 2EPXA 2HJJA 3IWBA 4QNKA 2NN6C 4JV5I 2DMYA 3EPKA 2NPFA 2HC5A 2JEAB 3L7ZB 4KWYA 1B69A 3K1JA 2LBSB 2EMLA 4DR4E 4FW7A 1XXEA 4DV4E 2LJUA 4LF7I 1DGCA 2EM7A 2A2DA 5C0XB 1WRJA 1I94I 2EOFA 2OI2A 3LNUA 2BA1G 1XMQE 2EN1A 2NABA 3PS3A 3LLHA 3OMLA 3F0NA 4GZNC 2EN7A 2YTFA 3THNA 4JI6E 2EM6A 1IBKE 1H72C 3QT7A 5K36F 4LF5E 2JEBB 2LUPB 1X6FA 1SR9A 2G7HA 4DR2E 5A69A 1RC7A 2JPAA 2IESA 4LCFA 2EP3A 2ENCA 4R2PA 4LF6E 2EM5A 1O0WA 4DR7E 3ZKDA 5K36B 4DPYA 2O1VA 4IJDA 4P7DA 2EPNA 4PU9A 2L8TA 2F8BA 2GO4A 4BA1B 3CDJA 5IXMB 4OO1E 1H7SA 5A6BA 1X48A 1A6FA 3M6AA 2PO2A 1YYWA 2LO3A 2EQ0A 2JXPA 1BBGA 2L2NA 4L5NC 4MYUA 2NUFA 5EKWA 3QT8A 4O43A 2BM1A 1FJGI 2PRTA 2WP8B 2IOQA 3OTOI 5LMUI 2GLIA 1A1KA 5AC4A 4IZJA 2JYAA 5DRPA 4YHHI 5L3JA 1MG7A 1PJQA 3F6HA 1FNMA 2J7JA 3MHHC 2J65A 4IFDF 1PDAA 4DUYE 4OX9E 2EMAA 1XNQE 4MU0A 4JI5E 2JOXA 4LFAI 3P3CA 4MLQA 4OZEA 1T4LB 5GMDA 2O1UA 4NBQA 5C0XC 4IFDB 4R03A 4OKGA 1X49A 5KL2A 4Z7CA 4R2RA 4F54A 2C37A 2EL6A 4DV5E 2PO1B 4M9VC 2EFGA 3AV0A 2JE6A 3P76A 5FWKA 3HPZA 2HGHA 2EPKX 1K47A 4M2ZA 1IBMI 2EJ4A 3FIGA 5IT9Q 2EOYA 3MHSC 1XMOE 3J80C 4F2JC 4X8WA 1Z0EA 1HR0E 2X36A 2YTOA 3CWVA 3LPSA 3P3GA 3H1CA 3ZZ0A 2EPAA 2A25A 1UBDC 4KZSA 4LCHA 1AAYA 2UU9I 3RMPA 2NN6F 3J81C 4B3TE 1Z0GA 1YSAC 4JI8I 2EPZA 1WJPA 2EL5A 2YPNA 2J7KA 2YTNA 5F3WA 1Z0WA 4GKJI 2BR2B 2UUCI 2NN6B 4Q28A 4WYQB 4X64E 4JI2I 2V2QA 1Z5BA 1SFEA 2PNZB 2AJ4A 2CT1A 4KQVA 5EL9A 4X9JA 2PO0A 4BC7A 4IS9A 4M30A 2N8XA 3M7ND 2DB2A 5LMUE 2CSHA 1NEIA 1MEYC 2JR1A 1H7UA 4FN5A 4EMDA 1HNXI 1FI4A 4PRXA 2EPMX 2JVAA 5KL4A 2VESA 4FW9A 4B3RI 1H74A 4FW6A 2EPPA 5JEAA 2UUBI 2Z5BA 2N3GA 2YRHA 3J7Yp 4DV0E 2WBUA 4JI0I 4NZVA 4F6MA 1T39A 2YTJA 5JEAD 2BA0G 1VISA 2LTRA 1B63A 2L92A 2RQLA 1WXRA 4AIMA 4DPXA 2EOZA 4LF4I 2JOBA 2LMZA 4X65E 2PNMA 4P78A 2I9IA 1EI1A 1FWKA 2UXCI 2O3ZA 1BBOA 3B78A 4R1FA 2ELZA 3WU5A 1UN6B 4GQUA 2JP9A 1Y4UA 2I13A 2O1TA 4O5GA 2MDGA 2L33A 2EOJA 2C39B 4DR1I 4JI3I 2VF3A 1USUA 2UU9E 4L8NA 1G2FC 4OO1B 2WBSA 4NXNE 4KHPI 5K36D 2EM2A 4DV2E 4I3HA 2HKJA 2EMFA 5C0XF 4HTGA 2UUAI 1EH6A 3K6QA 3K85A 3ADJA 4JI2E 2Z5EA 1A1LA 2V88A 1Z5AA
chains in the Genus database with same CATH topology
1X47A 4USMA 4JI1E 5CFFE 1D6TA 4JG4A 2Z5CA 4Z7YA 3C4TA 4DR5I 3PRYA 2HFUA 3T1YE 2LRSA 1N33E 4DV1I 1DI2A 1PKPA 4JI0E 2RS6A 3VYXA 2K4VA 1U2RA 4HYMA 1N36I 4DU8A 2M7QA 1ZBTA 2VQFI 2FGGA 4JI7I 4LF8E 1DQ3A 2UXDI 4IZKA 2LJHA 3Q1QA 3HTXA 1RR9A 1WUUA 2DIXA 3QT6A 2L2KB 1EA6A 4FWGA 3HQ1A 1KTVA 3J7AM 5A2QQ 2L6MA 3HXLA 2NUEA 4GKKE 2VQEI 4DPUA 1IBLE 4JYAI 4JI3E 3V2UC 2E5LE 1NHHA 4JV5E 2UXBI 1XNRI 3LMLA 1XHKA 2R3VA 3MSWA 4LFBI 2LUQA 2E1RA 4LF7E 2ZITA 2F4VI 1I94E 4DV3I 2M1SA 2V8QB 1ZM2A 1GZ6A 4X66I 3P1XA 5AE2A 1Y4SA 1HK7A 4OOGC 4HACA 1N0UA 5IWAI 2A2CA 1N34I 2ODRC 2Q2EB 1QU6A 1KVKA 2EZ6A 3J7AG 1KKHA 4P7AA 1ZM3A 4NXMI 2FTXB 2E1MA 3PYDA 4I8OA 4B3SI 3WU6A 1N36E 4F9BB 4B3MI 2KHXA 4FWDA 5DNYA 1J5EI 3JAMC 1N0VC 4FWHA 1ELOA 4WUCA 1UHZA 2KONA 4DMIA 1Z0CA 2NA2A 3D4JA 2MC6A 3ZOQB 2EWLA 1HNZI 2JWOA 1ZXMA 1FJGE 3H4LA 3OTOE 3AUZA 5LMNI 3V5RA 2BM0A 3DF6A 4YHHE 4WUBA 1BKNA 4DV7I 4DV6I 1WHQA 2UXBE 1HNWI 4LFAE 4ED4A 2VF1A 1GQEA 1PIEA 4IZJB 1YYKA 1YZ9A 4DR4I 3QT5A 4LFCI 1T4NA 4BMJA 1USVA 4YY3I 1DARA 1NZ0A 4URLA 1IBME 2LE2A 1XMQI 1ZM4A 2V89A 4MYTA 2YT4A 2JY9A 3VYYA 2ODRD 1IBKI 4LF5I 1WHNA 1NHIA 1OJ4A 3K17A 3J80Q 4DR2I 4JI8E 4P52A 4DR7I 4LF6I 4GKJE 2HK3A 4DUZI 2UUCE 3J81Q 1Z5CA 1Z0TA 1S16A 1Z59A 1UEKA 4TUGA 1NHJA 5FLXQ 4K0KI 2L3CA 3B82A 1RQ0A 4F9CB 1HNZE 2H36X 4WSPA 5BR8I 1HNXE 4JI4I 5LMNE 2V85A 1QZRA 4USKA 4B3RE 4DV6E 3B8HA 2X7IA 2B7TA 4DUYI 4OX9I 1HNWE 1XNQI 2UUBE 3WU4A 4JI5I 3PYGA 1EKZA 5GMEA 4LFCE 2Z5BB 2RSMA 4WFTA 3HULA 1ZBQA 4LF4E 2FV4B 5LL6R 2WZOA 4YY3E 1YYOA 4BCAA 3KWRA 5AE3A 5IT9C 4HY1A 4DV5I 3P06A 2UXCE 1B62A 3ZZTA 2VE7C 4J8ZA 2ZBKB 4DR3I 2B7VA 2N3HA 3C4BA 2ZM6I 4M1KA 1XMOI 2L3JA 4DR1E 1HR0I 3T1HI 2MDRA 2HKEA 3F6GA 4BC9A 2WW4A 2V87A 4B3TI 4KHPE 3IWDA 2GS8A 3Q6MA 2LTSA 4DUZE 1UILA 2UUAE 1KIJA 5AE1A 1J26A 1RREA 3DJWA 4DR6I 4UTGA 4X64I 4K0KE 3WU3A 4ZVIA 2B3TB 4RPFA 1Z0BA 5BR8E 4DU7A 4JI4E 3PYFA 2CPNA 4XTJA 4AQYI 4DR5E 2V2VA 3ZZUA 2V86A 5T6JA 1FWLA 2Z5CB 4DV1E 2V34A 4IZJD 4DV0I 3ZKBA 1FKAE 4HXZA 3ADGA 2MC5A 2DEJA 4JI7E 2VQFE 3H09A 4LU9A 2UXDE 1Z0VA 4LF9I 1PVGA 3ZM7A 4DPWA 4X65I 2YZTA 2CG9A 4GEQB 4DR3E 3JTZA 2ZM6E 4BS9A 1MU5A 4IZKB 2XEXA 4X62I 2IHR1 2VQEE 4LTYA 4JYAE 2HHHI 1N32I 3T1HE 3Q6NA 4N3OA 2M4IA 2B9DA 2HFSA 4DKKA 3LTOA 1ZM9A 4NXNI 1XNRE 4DV2I 5FLXC 2DEIA 4F9AB 4LFBE 4R8OA 2CGEA 2V2ZA 4DV4I 4DR6E 5ADZA 2F4VE 3GONA 4DV3E 1MX0A 2DSYA 3ADLA 4X66E 2R42A 4JI1I 4DPTA 4M0VA 2LJPA 5IWAE 3VK6A 2V8PA 1S4EA 1N34E 4PRVA 4AQYE 3IWCA 3PYEA 4JI6I 4DXLA 3HJCA 3JU0A 4WUDA 3T1YI 4NXME 4HACB 1N33I 4WPYA 2RS7A 2RTXA 1STUA 4B3SE 2O1WA 2PNLA 2NUGA 2GQ0A 4B3ME 3HPSA 2HK2A 1J5EE 4LF8I 5AASA 4LF9E 2CZ9A 2KOUA 5A2QC 1ZXNA 3JAMQ 4UT4A 4TUIA 2BV3A 1Y6ZA 4X62E 2HHHE 2V83A 1N32E 2IOPA 4GKKI 1T4OA 2L2MA 4BBYA 1IBLI 4DV7E 3ADIA 1H73A 2E5LI 3IWBA 4JV5I 2DMYA 2NPFA 3K1JA 2LBSB 4DR4E 4DV4E 4LF7I 2A2DA 1I94I 2OI2A 3LNUA 1XMQE 3LLHA 3OMLA 3F0NA 4JI6E 1IBKE 1H72C 3QT7A 4LF5E 2LUPB 1SR9A 2G7HA 4DR2E 1RC7A 4DR7E 4LF6E 3ZKDA 1O0WA 4DPYA 2O1VA 4P7DA 4PU9A 2L8TA 2F8BA 1H7SA 3M6AA 1X48A 1A6FA 1YYWA 2L2NA 4L5NC 4MYUA 2NUFA 3QT8A 2BM1A 1FJGI 2IOQA 3OTOI 5LMUI 4IZJA 4YHHI 5L3JA 1MG7A 3F6HA 1FNMA 4OX9E 4DUYE 1XNQE 4JI5E 2JOXA 4LFAI 5GMDA 1T4LB 2O1UA 4R03A 4Z7CA 1X49A 4F54A 4DV5E 2EFGA 3AV0A 5FWKA 3HPZA 1IBMI 1K47A 4M2ZA 3FIGA 5IT9Q 1XMOE 3J80C 2X36A 4X8WA 1Z0EA 1HR0E 3CWVA 3LPSA 3ZZ0A 4KZSA 2UU9I 3RMPA 3J81C 4B3TE 1Z0GA 4JI8I 2J7KA 5F3WA 1Z0WA 4GKJI 2UUCI 4Q28A 4WYQB 4X64E 4JI2I 2V2QA 1Z5BA 2AJ4A 4KQVA 4BC7A 4M30A 2DB2A 5LMUE 4FN5A 4EMDA 1H7UA 2JR1A 1HNXI 1FI4A 4PRXA 2JVAA 4FW9A 4B3RI 1H74A 2UUBI 2Z5BA 2N3GA 3J7Yp 4DV0E 4JI0I 1VISA 2LTRA 1B63A 2L92A 1WXRA 4DPXA 4LF4I 2JOBA 2LMZA 4X65E 2PNMA 4P78A 1EI1A 1FWKA 2UXCI 3B78A 4R1FA 3WU5A 1Y4UA 2O1TA 2L33A 4DR1I 4JI3I 2VF3A 1USUA 2UU9E 4L8NA 4NXNE 4KHPI 4DV2E 4I3HA 2HKJA 2UUAI 3K6QA 3K85A 3ADJA 4JI2E 2Z5EA 2V88A 1Z5AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X47 A;  4USM A;  4JI1 E;  5CFF E;  1D6T A;  4JG4 A;  4Z7Y A;  3C4T A;  4DR5 I;  2HFU A;  3T1Y E;  2LRS A;  1N33 E;  4DV1 I;  1DI2 A;  1PKP A;  4JI0 E;  2RS6 A;  3VYX A;  1U2R A;  4HYM A;  1N36 I;  4DU8 A;  1ZBT A;  2VQF I;  4JI7 I;  4LF8 E;  2UXD I;  2LJH A;  3Q1Q A;  3HTX A;  1RR9 A;  1WUU A;  2DIX A;  3QT6 A;  2L2K B;  1EA6 A;  4FWG A;  1KTV A;  3J7A M;  5A2Q Q;  2NUE A;  4GKK E;  2VQE I;  4DPU A;  1IBL E;  4JYA I;  4JI3 E;  3V2U C;  2E5L E;  1NHH A;  4JV5 E;  2UXB I;  1XNR I;  2R3V A;  1XHK A;  4LFB I;  2LUQ A;  2E1R A;  4LF7 E;  2ZIT A;  2F4V I;  1I94 E;  4DV3 I;  1ZM2 A;  4X66 I;  3P1X A;  4OOG C;  4HAC A;  1N0U A;  5IWA I;  2A2C A;  1N34 I;  2Q2E B;  1QU6 A;  1KVK A;  2EZ6 A;  1KKH A;  3J7A G;  4P7A A;  1ZM3 A;  4NXM I;  3PYD A;  4B3S I;  3WU6 A;  1N36 E;  4B3M I;  2KHX A;  4FWD A;  1J5E I;  3JAM C;  1N0V C;  4FWH A;  1ELO A;  4WUC A;  1UHZ A;  1Z0C A;  2NA2 A;  3D4J A;  1HNZ I;  1ZXM A;  1FJG E;  3H4L A;  3OTO E;  5LMN I;  3V5R A;  2BM0 A;  4YHH E;  4WUB A;  1BKN A;  4DV7 I;  4DV6 I;  1WHQ A;  2UXB E;  1HNW I;  4LFA E;  4ED4 A;  1GQE A;  1PIE A;  1YYK A;  1YZ9 A;  4DR4 I;  3QT5 A;  4LFC I;  1T4N A;  4YY3 I;  1DAR A;  1NZ0 A;  4URL A;  1IBM E;  1XMQ I;  1ZM4 A;  4MYT A;  2YT4 A;  2JY9 A;  3VYY A;  1IBK I;  4LF5 I;  1WHN A;  1NHI A;  1OJ4 A;  3K17 A;  3J80 Q;  4DR2 I;  4JI8 E;  4P52 A;  4DR7 I;  4LF6 I;  4GKJ E;  2HK3 A;  4DUZ I;  2UUC E;  3J81 Q;  1Z5C A;  1Z0T A;  1S16 A;  1Z59 A;  1UEK A;  1NHJ A;  5FLX Q;  4K0K I;  2L3C A;  3B82 A;  1RQ0 A;  1HNZ E;  5BR8 I;  1HNX E;  4JI4 I;  5LMN E;  1QZR A;  4USK A;  4B3R E;  4DV6 E;  3B8H A;  2X7I A;  2B7T A;  4DUY I;  4OX9 I;  1HNW E;  1XNQ I;  2UUB E;  3WU4 A;  4JI5 I;  3PYG A;  1EKZ A;  5GME A;  4LFC E;  2RSM A;  4WFT A;  3HUL A;  4YY3 E;  4LF4 E;  5LL6 R;  1YYO A;  4HY1 A;  4DV5 I;  5IT9 C;  2UXC E;  1B62 A;  3ZZT A;  2ZBK B;  4DR3 I;  2B7V A;  2N3H A;  3C4B A;  2ZM6 I;  4M1K A;  1XMO I;  2L3J A;  4DR1 E;  1HR0 I;  3T1H I;  2MDR A;  2HKE A;  2WW4 A;  4B3T I;  4KHP E;  2GS8 A;  2LTS A;  4DUZ E;  1UIL A;  2UUA E;  1KIJ A;  1J26 A;  1RRE A;  4DR6 I;  4UTG A;  4X64 I;  4K0K E;  3WU3 A;  4ZVI A;  2B3T B;  4RPF A;  1Z0B A;  5BR8 E;  4DU7 A;  4JI4 E;  3PYF A;  2CPN A;  4XTJ A;  4AQY I;  4DR5 E;  2V2V A;  3ZZU A;  1FWL A;  4DV1 E;  2V34 A;  4DV0 I;  3ZKB A;  1FKA E;  4HXZ A;  3ADG A;  2DEJ A;  2VQF E;  4JI7 E;  2UXD E;  1Z0V A;  4LF9 I;  1PVG A;  3ZM7 A;  4DPW A;  4X65 I;  4DR3 E;  2ZM6 E;  1MU5 A;  2XEX A;  4X62 I;  2IHR 1;  2VQE E;  4JYA E;  2HHH I;  1N32 I;  3T1H E;  2HFS A;  4DKK A;  3LTO A;  1ZM9 A;  4NXN I;  1XNR E;  4DV2 I;  5FLX C;  2DEI A;  4LFB E;  2V2Z A;  4DV4 I;  4DR6 E;  2F4V E;  3GON A;  4DV3 E;  1MX0 A;  3ADL A;  4X66 E;  2R42 A;  4JI1 I;  4DPT A;  2LJP A;  5IWA E;  2V8P A;  1S4E A;  1N34 E;  4PRV A;  4AQY E;  3PYE A;  4JI6 I;  4DXL A;  4WUD A;  3T1Y I;  4NXM E;  4HAC B;  1N33 I;  2RS7 A;  2RTX A;  1STU A;  4B3S E;  2NUG A;  4B3M E;  2HK2 A;  1J5E E;  4LF8 I;  4LF9 E;  2CZ9 A;  5A2Q C;  1ZXN A;  3JAM Q;  4UT4 A;  2BV3 A;  4X62 E;  2HHH E;  1N32 E;  4GKK I;  1T4O A;  2L2M A;  1IBL I;  4DV7 E;  3ADI A;  1H73 A;  2E5L I;  4JV5 I;  2DMY A;  2NPF A;  3K1J A;  2LBS B;  4DR4 E;  4DV4 E;  4LF7 I;  2A2D A;  1I94 I;  2OI2 A;  3LNU A;  1XMQ E;  3LLH A;  3F0N A;  4JI6 E;  1IBK E;  1H72 C;  3QT7 A;  4LF5 E;  2LUP B;  4DR2 E;  1RC7 A;  4DR7 E;  4LF6 E;  3ZKD A;  1O0W A;  4DPY A;  4PU9 A;  1H7S A;  3M6A A;  1X48 A;  1A6F A;  1YYW A;  2L2N A;  4MYU A;  2NUF A;  3QT8 A;  2BM1 A;  1FJG I;  3OTO I;  5LMU I;  4YHH I;  5L3J A;  1MG7 A;  1FNM A;  4OX9 E;  4DUY E;  1XNQ E;  4JI5 E;  4LFA I;  5GMD A;  1T4L B;  4Z7C A;  1X49 A;  4DV5 E;  2EFG A;  1IBM I;  1K47 A;  4M2Z A;  5IT9 Q;  1XMO E;  2X36 A;  3LPS A;  4X8W A;  1Z0E A;  1HR0 E;  3CWV A;  3J80 C;  3ZZ0 A;  2UU9 I;  1Z0G A;  4B3T E;  3J81 C;  4JI8 I;  2J7K A;  1Z0W A;  4GKJ I;  2UUC I;  4WYQ B;  4X64 E;  4JI2 I;  2V2Q A;  1Z5B A;  2AJ4 A;  4KQV A;  4M30 A;  2DB2 A;  5LMU E;  4FN5 A;  4EMD A;  1H7U A;  1HNX I;  1FI4 A;  4PRX A;  2JVA A;  4FW9 A;  4B3R I;  1H74 A;  2UUB I;  2N3G A;  3J7Y p;  4DV0 E;  4JI0 I;  1VIS A;  2LTR A;  1B63 A;  4DPX A;  4LF4 I;  4X65 E;  1EI1 A;  1FWK A;  2UXC I;  3B78 A;  4R1F A;  3WU5 A;  2L33 A;  4DR1 I;  4JI3 I;  2VF3 A;  2UU9 E;  4NXN E;  4KHP I;  4DV2 E;  4I3H A;  2HKJ A;  2UUA I;  3ADJ A;  4JI2 E;  1Z5A A; 
#chains in the Genus database with same CATH topology
 1X47 A;  4USM A;  1Z1B A;  4JI1 E;  2YRM A;  4Q35 B;  5CFF E;  1D6T A;  4JG4 A;  2Z5C A;  4WX9 A;  2EPC A;  4MLV A;  1Y60 A;  2JT2 A;  4Z7Y A;  1JK2 A;  2C38 A;  1TF6 A;  2CTD A;  3C4T A;  4DR5 I;  2WNR B;  3PRY A;  2HFU A;  3T1Y E;  2LRS A;  1N33 E;  4DV1 I;  2EN2 A;  1DI2 A;  1PKP A;  4JI0 E;  5KL6 A;  2EPL X;  2RS6 A;  4F6N A;  2GPI A;  4IFD D;  4BA2 A;  3VYX A;  2K4V A;  1U2R A;  4HYM A;  1N36 I;  4DU8 A;  2M7Q A;  1ZBT A;  2VQF I;  2FGG A;  4JI7 I;  2YTI A;  4LF8 E;  1DQ3 A;  2UXD I;  4LOM A;  1X3C A;  3BGH A;  4IZK A;  2K7I A;  1UDQ A;  2ADR A;  2LJH A;  3Q1Q A;  1ZU1 A;  3HTX A;  3ECR A;  2EOX A;  1RR9 A;  2DIX A;  1WUU A;  3BID A;  3QT6 A;  2EN6 A;  2L2K B;  1EA6 A;  2D9H A;  2YTE A;  2MKN A;  4FWG A;  4AM3 A;  3HQ1 A;  1KTV A;  3J7A M;  5A2Q Q;  2LT7 A;  2L6M A;  1RHY A;  3HXL A;  2NUE A;  1A1H A;  4GKK E;  3M85 G;  2VQE I;  4MU1 A;  1IBL E;  4DPU A;  4JYA I;  4OO1 C;  4JI3 E;  3V2U C;  1P42 A;  4O24 A;  1X6E A;  2E5L E;  2EOO A;  1NHH A;  4JV5 E;  3EQ1 A;  1UDN A;  2LCE A;  3KZZ A;  3KRN A;  2UXB I;  2EN3 A;  2EN4 A;  1XNR I;  5TSE A;  2LV2 A;  3LML A;  1XHK A;  2NN6 D;  2R3V A;  3MSW A;  3UHM A;  4LFB I;  3C6K A;  2LUQ A;  2E1R A;  2R1F A;  3GLL A;  3U1Y A;  4BHC A;  4LF7 E;  2ZIT A;  2F4V I;  1I94 E;  4DV3 I;  3M7N G;  2M1S A;  2V8Q B;  4R2S A;  1ZM2 A;  1GZ6 A;  4X66 I;  4R2Q A;  3P1X A;  5AE2 A;  2VRD A;  1Y4S A;  1HK7 A;  5A6A A;  3UK3 C;  4OOG C;  4HAC A;  1N0U A;  5IWA I;  4MU4 A;  4R2C A;  2A2C A;  5JEA E;  1N34 I;  2ODR C;  2BA1 D;  2Q2E B;  2DRP A;  1QU6 A;  1KVK A;  2EZ6 A;  3J7A G;  2E72 A;  2EOR A;  1KKH A;  1R6M A;  4P7A A;  1ZM3 A;  4NXM I;  2FTX B;  2E1M A;  3PYD A;  4I8O A;  1QNT A;  4B3S I;  3WU6 A;  4ZYD A;  2ENH A;  1N36 E;  4F9B B;  4B3M I;  2KHX A;  4FWD A;  5DNY A;  1P47 A;  1J5E I;  3JAM C;  4O4K A;  1LLM C;  1N0V C;  4FWH A;  1G2D C;  1ELO A;  4WUC A;  3EPH A;  4OX9 I;  4WXD A;  1UHZ A;  5DRO A;  2KON A;  4DMI A;  1Z0C A;  2NA2 A;  3D4J A;  2EOS A;  2MC6 A;  2MKD A;  5KL7 A;  2EL4 A;  3ZOQ B;  1Y5Y A;  2EWL A;  1HNZ I;  2JWO A;  1ZXM A;  1FJG E;  3H4L A;  3OTO E;  2EMZ A;  3AUZ A;  2EOI A;  5LMN I;  3V5R A;  2JEA A;  1BB8 A;  2BM0 A;  3DF6 A;  4YHH E;  3L7Z A;  3THO B;  4WUB A;  1BKN A;  2PO2 B;  4DV7 I;  2EMX A;  1OYP A;  1OYR A;  4DV6 I;  1GTK A;  1WHQ A;  2EOE A;  2UXB E;  1HNW I;  4LFA E;  2DGC A;  4U3B A;  1A1I A;  4ED4 A;  2VF1 A;  1GQE A;  2DLK A;  1PIE A;  4IZJ B;  4U3D A;  1YYK A;  1YZ9 A;  4DR4 I;  2YTQ A;  3QT5 A;  3PS2 A;  4LFC I;  1T4N A;  4BMJ A;  1USV A;  5C0X D;  3GCM A;  4LCG A;  1YPN A;  4YY3 I;  2EMG A;  1F2I G;  1DAR A;  1A1F A;  2YTG A;  4ZYG A;  4R2A A;  1NZ0 A;  4URL A;  1IBM E;  2LE2 A;  1XMQ I;  2F1D A;  2C37 B;  4IFD E;  1ZM4 A;  1ZR9 A;  2V89 A;  2YSP A;  2JEB A;  4MYT A;  2JE6 B;  2YT4 A;  2JY9 A;  3HKM A;  5DNX A;  4OO1 F;  3VYY A;  2EOM A;  2ODR D;  1IBK I;  1UDS A;  5K36 A;  4LF5 I;  1WHN A;  2WCC 3;  2EMB A;  1NHI A;  1OJ4 A;  2EPU A;  3K17 A;  5DRQ A;  3J80 Q;  4DR2 I;  4MU3 A;  4JI8 E;  1JK1 A;  4P52 A;  4BA1 A;  4DR7 I;  4LF6 I;  4GKJ E;  2HK3 A;  4DUZ I;  2UUC E;  3J81 Q;  3L00 A;  1Z5C A;  1TF3 A;  1Z0T A;  1S16 A;  5IV8 B;  4NHR A;  3EPL A;  2M9A A;  3P3E A;  2R76 A;  3DD6 A;  1Z59 A;  2EOH A;  1UEK A;  4TUG A;  1NHJ A;  2WP8 A;  5FLX Q;  4K0K I;  2L3C A;  3B82 A;  1RQ0 A;  4F9C B;  1HNZ E;  2H36 X;  4WSP A;  2DMI A;  5BR8 I;  2NN6 E;  1HNX E;  4JI4 I;  5LMN E;  2V85 A;  2YWQ A;  1QZR A;  4USK A;  2EM9 A;  4B3R E;  2PO0 B;  4DV6 E;  5KL5 A;  3B8H A;  4IFD A;  2X7I A;  1IMU A;  2B7T A;  1YH8 A;  4DUY I;  4IS1 C;  1HNW E;  1RMD A;  2EQ3 A;  2UUB E;  3WU4 A;  3PYG A;  5JEA F;  4JI5 I;  1XNQ I;  4ZYE A;  1EKZ A;  2PO1 A;  1T38 A;  2ELY A;  2EOQ A;  5GME A;  2EPO A;  1MGT A;  4LFC E;  5JEA B;  4J3D A;  1A1J A;  2Z5B B;  2RSM A;  4WFT A;  3HUL A;  1ZBQ A;  2FV4 B;  5LL6 R;  2WZO A;  4YY3 E;  1YYO A;  4BCA A;  3KWR A;  5AE3 A;  4LF4 E;  5IT9 C;  4HY1 A;  2EPR A;  4DV5 I;  2BA0 D;  1IQS A;  3P06 A;  2UXC E;  2EM4 A;  1B62 A;  1PJS A;  1L4S A;  3ZZT A;  2VE7 C;  4J8Z A;  4RHB B;  2ZBK B;  4DR3 I;  2B7V A;  3M99 B;  2N3H A;  3C4B A;  3EPJ A;  1YFH A;  1E3P A;  2ZM6 I;  4M1K A;  1XMO I;  2L3J A;  1PJT A;  4R2E A;  4DR1 E;  1HR0 I;  3T1H I;  1YHC A;  2EM3 A;  2MDR A;  2EMH A;  2BR2 A;  3F6G A;  2HKE A;  2NN6 A;  4BC9 A;  2WW4 A;  2V87 A;  4B3T I;  2EMI A;  5DRR A;  4KHP E;  3IWD A;  2GS8 A;  3Q6M A;  2LTS A;  4DUZ E;  2PNZ A;  3GME A;  2EMK A;  4BHB A;  1IQO A;  4FW3 A;  1UIL A;  1YUJ A;  2YTD A;  2UUA E;  5AE1 A;  1J26 A;  1KIJ A;  1RRE A;  4R2D A;  3DJW A;  5A6K A;  3BBG A;  3U1K A;  4UTG A;  4X64 I;  2ENA A;  4K0K E;  4DR6 I;  3WU3 A;  4ZVI A;  2YRK A;  1UDO A;  2B3T B;  4N4R B;  4RPF A;  1Z0B A;  5BR8 E;  4DU7 A;  4LPF A;  4JI4 E;  5AC5 A;  3PYF A;  2CPN A;  5A6B D;  4XTJ A;  4AQY I;  1E3H A;  4DR5 E;  4FK5 C;  1KJK A;  2V86 A;  5T6J A;  2V2V A;  3ZZU A;  5C0X E;  1FWL A;  2YU8 A;  2Z5C B;  4RH8 A;  4DV1 E;  2V34 A;  1EH8 A;  1A1G A;  4IZJ D;  2C38 B;  2GO3 A;  5JEA C;  4DV0 I;  3ZKB A;  1X6H A;  1FKA E;  4HXZ A;  4HEI A;  3ADG A;  1EH7 A;  2MC5 A;  1R6L A;  2EN8 A;  2DEJ A;  4JI7 E;  2VQF E;  3H09 A;  4WXC A;  1AH5 A;  4LU9 A;  2UXD E;  1Z0V A;  4LF9 I;  1PVG A;  4BA2 B;  3ZM7 A;  4DPW A;  2RPC A;  4X65 I;  4IFD C;  2YZT A;  2LVH A;  2C39 A;  2CG9 A;  2BB8 A;  4GEQ B;  4DR3 E;  3JTZ A;  2EMY A;  2ZM6 E;  4BS9 A;  1MU5 A;  4IZK B;  2XEX A;  3KZY A;  5K36 E;  4OO1 A;  4X62 I;  2IHR 1;  2VQE E;  4LTY A;  4JYA E;  2HHH I;  1N32 I;  3T1H E;  1ZAA C;  3Q6N A;  4N3O A;  2M4I A;  2B9D A;  2HFS A;  4ISA A;  5K36 C;  4DKK A;  5ELW A;  4OO1 D;  3M85 D;  2YTP A;  3LTO A;  4QNJ A;  3PS1 A;  1ZM9 A;  1VI7 A;  4NXN I;  1XNR E;  4DV2 I;  5FLX C;  5C0X A;  2DEI A;  4F9A B;  2EM0 A;  4LFB E;  2IER A;  4R8O A;  2CGE A;  2V2Z A;  4DV4 I;  4DR6 E;  5ADZ A;  2F4V E;  3B4T A;  3GON A;  2DLQ A;  4DV3 E;  1MX0 A;  2DSY A;  2EM8 A;  3ADL A;  4X66 E;  2R42 A;  5KL3 A;  4JI1 I;  4DPT A;  4M0V A;  2WNR A;  2LJP A;  2RSI A;  5IWA E;  2Q8U A;  1X5W A;  3VK6 A;  2V8P A;  4FW4 A;  1S4E A;  1N34 E;  4PRV A;  4AQY E;  3TQM A;  3IWC A;  3PYE A;  2WBT A;  4JI6 I;  5A6J A;  4DXL A;  3HJC A;  3JU0 A;  4WUD A;  2EE8 A;  2YU5 A;  4NXM E;  4HAC B;  4AID A;  4WPY A;  2RS7 A;  5DNL A;  3T1Y I;  2RTX A;  1STU A;  1N33 I;  4ZYH A;  2CVE A;  4FW5 A;  4B3S E;  2O1W A;  2PNL A;  2NUG A;  2GQ0 A;  3CDI A;  4B3M E;  3HPS A;  3C6M A;  2HK2 A;  1J5E E;  1YUI A;  4WSG A;  4LF8 I;  5AAS A;  4LF9 E;  2CZ9 A;  2KOU A;  1NCS A;  5A2Q C;  1ZXN A;  2BBG A;  3JAM Q;  4UT4 A;  3VHT B;  4TUI A;  2BV3 A;  3BF2 A;  2AE8 A;  1Y6Z A;  3NZK A;  4X62 E;  2GHF A;  2HHH E;  2V83 A;  1N32 E;  1OYS A;  2IOP A;  1T4O A;  2EMC A;  2EMW A;  2L2M A;  4BBY A;  1IBL I;  4GKK I;  4MQY A;  2YSO A;  1N3G A;  4DV7 E;  1TN9 A;  2EQ1 A;  1KYQ A;  3QG5 C;  3ADI A;  1H73 A;  4MDT A;  2E5L I;  5LLQ A;  2EPX A;  2HJJ A;  3IWB A;  4QNK A;  2NN6 C;  4JV5 I;  2DMY A;  3EPK A;  2NPF A;  2HC5 A;  2JEA B;  3L7Z B;  4KWY A;  1B69 A;  3K1J A;  2LBS B;  2EML A;  4DR4 E;  4FW7 A;  1XXE A;  4DV4 E;  2LJU A;  4LF7 I;  1DGC A;  2EM7 A;  2A2D A;  5C0X B;  1WRJ A;  1I94 I;  2EOF A;  2OI2 A;  3LNU A;  2BA1 G;  1XMQ E;  2EN1 A;  2NAB A;  3PS3 A;  3LLH A;  3OML A;  3F0N A;  4GZN C;  2EN7 A;  2YTF A;  3THN A;  4JI6 E;  2EM6 A;  1IBK E;  1H72 C;  3QT7 A;  5K36 F;  4LF5 E;  2JEB B;  2LUP B;  1X6F A;  1SR9 A;  2G7H A;  4DR2 E;  5A69 A;  1RC7 A;  2JPA A;  2IES A;  4LCF A;  2EP3 A;  2ENC A;  4R2P A;  4LF6 E;  2EM5 A;  1O0W A;  4DR7 E;  3ZKD A;  5K36 B;  4DPY A;  2O1V A;  4IJD A;  4P7D A;  2EPN A;  4PU9 A;  2L8T A;  2F8B A;  2GO4 A;  4BA1 B;  3CDJ A;  5IXM B;  4OO1 E;  1H7S A;  5A6B A;  1X48 A;  1A6F A;  3M6A A;  2PO2 A;  1YYW A;  2LO3 A;  2EQ0 A;  2JXP A;  1BBG A;  2L2N A;  4L5N C;  4MYU A;  2NUF A;  5EKW A;  3QT8 A;  4O43 A;  2BM1 A;  1FJG I;  2PRT A;  2WP8 B;  2IOQ A;  3OTO I;  5LMU I;  2GLI A;  1A1K A;  5AC4 A;  4IZJ A;  2JYA A;  5DRP A;  4YHH I;  5L3J A;  1MG7 A;  1PJQ A;  3F6H A;  1FNM A;  2J7J A;  3MHH C;  2J65 A;  4IFD F;  1PDA A;  4DUY E;  4OX9 E;  2EMA A;  1XNQ E;  4MU0 A;  4JI5 E;  2JOX A;  4LFA I;  3P3C A;  4MLQ A;  4OZE A;  1T4L B;  5GMD A;  2O1U A;  4NBQ A;  5C0X C;  4IFD B;  4R03 A;  4OKG A;  1X49 A;  5KL2 A;  4Z7C A;  4R2R A;  4F54 A;  2C37 A;  2EL6 A;  4DV5 E;  2PO1 B;  4M9V C;  2EFG A;  3AV0 A;  2JE6 A;  3P76 A;  5FWK A;  3HPZ A;  2HGH A;  2EPK X;  1K47 A;  4M2Z A;  1IBM I;  2EJ4 A;  3FIG A;  5IT9 Q;  2EOY A;  3MHS C;  1XMO E;  3J80 C;  4F2J C;  4X8W A;  1Z0E A;  1HR0 E;  2X36 A;  2YTO A;  3CWV A;  3LPS A;  3P3G A;  3H1C A;  3ZZ0 A;  2EPA A;  2A25 A;  1UBD C;  4KZS A;  4LCH A;  1AAY A;  2UU9 I;  3RMP A;  2NN6 F;  3J81 C;  4B3T E;  1Z0G A;  1YSA C;  4JI8 I;  2EPZ A;  1WJP A;  2EL5 A;  2YPN A;  2J7K A;  2YTN A;  5F3W A;  1Z0W A;  4GKJ I;  2BR2 B;  2UUC I;  2NN6 B;  4Q28 A;  4WYQ B;  4X64 E;  4JI2 I;  2V2Q A;  1Z5B A;  1SFE A;  2PNZ B;  2AJ4 A;  2CT1 A;  4KQV A;  5EL9 A;  4X9J A;  2PO0 A;  4BC7 A;  4IS9 A;  4M30 A;  2N8X A;  3M7N D;  2DB2 A;  5LMU E;  2CSH A;  1NEI A;  1MEY C;  2JR1 A;  1H7U A;  4FN5 A;  4EMD A;  1HNX I;  1FI4 A;  4PRX A;  2EPM X;  2JVA A;  5KL4 A;  2VES A;  4FW9 A;  4B3R I;  1H74 A;  4FW6 A;  2EPP A;  5JEA A;  2UUB I;  2Z5B A;  2N3G A;  2YRH A;  3J7Y p;  4DV0 E;  2WBU A;  4JI0 I;  4NZV A;  4F6M A;  1T39 A;  2YTJ A;  5JEA D;  2BA0 G;  1VIS A;  2LTR A;  1B63 A;  2L92 A;  2RQL A;  1WXR A;  4AIM A;  4DPX A;  2EOZ A;  4LF4 I;  2JOB A;  2LMZ A;  4X65 E;  2PNM A;  4P78 A;  2I9I A;  1EI1 A;  1FWK A;  2UXC I;  2O3Z A;  1BBO A;  3B78 A;  4R1F A;  2ELZ A;  3WU5 A;  1UN6 B;  4GQU A;  2JP9 A;  1Y4U A;  2I13 A;  2O1T A;  4O5G A;  2MDG A;  2L33 A;  2EOJ A;  2C39 B;  4DR1 I;  4JI3 I;  2VF3 A;  1USU A;  2UU9 E;  4L8N A;  1G2F C;  4OO1 B;  2WBS A;  4NXN E;  4KHP I;  5K36 D;  2EM2 A;  4DV2 E;  4I3H A;  2HKJ A;  2EMF A;  5C0X F;  4HTG A;  2UUA I;  1EH6 A;  3K6Q A;  3K85 A;  3ADJ A;  4JI2 E;  2Z5E A;  1A1L A;  2V88 A;  1Z5A A; 
#chains in the Genus database with same CATH homology
 1X47 A;  4USM A;  4JI1 E;  5CFF E;  1D6T A;  4JG4 A;  2Z5C A;  4Z7Y A;  3C4T A;  4DR5 I;  3PRY A;  2HFU A;  3T1Y E;  2LRS A;  1N33 E;  4DV1 I;  1DI2 A;  1PKP A;  4JI0 E;  2RS6 A;  3VYX A;  2K4V A;  1U2R A;  4HYM A;  1N36 I;  4DU8 A;  2M7Q A;  1ZBT A;  2VQF I;  2FGG A;  4JI7 I;  4LF8 E;  1DQ3 A;  2UXD I;  4IZK A;  2LJH A;  3Q1Q A;  3HTX A;  1RR9 A;  1WUU A;  2DIX A;  3QT6 A;  2L2K B;  1EA6 A;  4FWG A;  3HQ1 A;  1KTV A;  3J7A M;  5A2Q Q;  2L6M A;  3HXL A;  2NUE A;  4GKK E;  2VQE I;  4DPU A;  1IBL E;  4JYA I;  4JI3 E;  3V2U C;  2E5L E;  1NHH A;  4JV5 E;  2UXB I;  1XNR I;  3LML A;  1XHK A;  2R3V A;  3MSW A;  4LFB I;  2LUQ A;  2E1R A;  4LF7 E;  2ZIT A;  2F4V I;  1I94 E;  4DV3 I;  2M1S A;  2V8Q B;  1ZM2 A;  1GZ6 A;  4X66 I;  3P1X A;  5AE2 A;  1Y4S A;  1HK7 A;  4OOG C;  4HAC A;  1N0U A;  5IWA I;  2A2C A;  1N34 I;  2ODR C;  2Q2E B;  1QU6 A;  1KVK A;  2EZ6 A;  3J7A G;  1KKH A;  4P7A A;  1ZM3 A;  4NXM I;  2FTX B;  2E1M A;  3PYD A;  4I8O A;  4B3S I;  3WU6 A;  1N36 E;  4F9B B;  4B3M I;  2KHX A;  4FWD A;  5DNY A;  1J5E I;  3JAM C;  1N0V C;  4FWH A;  1ELO A;  4WUC A;  1UHZ A;  2KON A;  4DMI A;  1Z0C A;  2NA2 A;  3D4J A;  2MC6 A;  3ZOQ B;  2EWL A;  1HNZ I;  2JWO A;  1ZXM A;  1FJG E;  3H4L A;  3OTO E;  3AUZ A;  5LMN I;  3V5R A;  2BM0 A;  3DF6 A;  4YHH E;  4WUB A;  1BKN A;  4DV7 I;  4DV6 I;  1WHQ A;  2UXB E;  1HNW I;  4LFA E;  4ED4 A;  2VF1 A;  1GQE A;  1PIE A;  4IZJ B;  1YYK A;  1YZ9 A;  4DR4 I;  3QT5 A;  4LFC I;  1T4N A;  4BMJ A;  1USV A;  4YY3 I;  1DAR A;  1NZ0 A;  4URL A;  1IBM E;  2LE2 A;  1XMQ I;  1ZM4 A;  2V89 A;  4MYT A;  2YT4 A;  2JY9 A;  3VYY A;  2ODR D;  1IBK I;  4LF5 I;  1WHN A;  1NHI A;  1OJ4 A;  3K17 A;  3J80 Q;  4DR2 I;  4JI8 E;  4P52 A;  4DR7 I;  4LF6 I;  4GKJ E;  2HK3 A;  4DUZ I;  2UUC E;  3J81 Q;  1Z5C A;  1Z0T A;  1S16 A;  1Z59 A;  1UEK A;  4TUG A;  1NHJ A;  5FLX Q;  4K0K I;  2L3C A;  3B82 A;  1RQ0 A;  4F9C B;  1HNZ E;  2H36 X;  4WSP A;  5BR8 I;  1HNX E;  4JI4 I;  5LMN E;  2V85 A;  1QZR A;  4USK A;  4B3R E;  4DV6 E;  3B8H A;  2X7I A;  2B7T A;  4DUY I;  4OX9 I;  1HNW E;  1XNQ I;  2UUB E;  3WU4 A;  4JI5 I;  3PYG A;  1EKZ A;  5GME A;  4LFC E;  2Z5B B;  2RSM A;  4WFT A;  3HUL A;  1ZBQ A;  4LF4 E;  2FV4 B;  5LL6 R;  2WZO A;  4YY3 E;  1YYO A;  4BCA A;  3KWR A;  5AE3 A;  5IT9 C;  4HY1 A;  4DV5 I;  3P06 A;  2UXC E;  1B62 A;  3ZZT A;  2VE7 C;  4J8Z A;  2ZBK B;  4DR3 I;  2B7V A;  2N3H A;  3C4B A;  2ZM6 I;  4M1K A;  1XMO I;  2L3J A;  4DR1 E;  1HR0 I;  3T1H I;  2MDR A;  2HKE A;  3F6G A;  4BC9 A;  2WW4 A;  2V87 A;  4B3T I;  4KHP E;  3IWD A;  2GS8 A;  3Q6M A;  2LTS A;  4DUZ E;  1UIL A;  2UUA E;  1KIJ A;  5AE1 A;  1J26 A;  1RRE A;  3DJW A;  4DR6 I;  4UTG A;  4X64 I;  4K0K E;  3WU3 A;  4ZVI A;  2B3T B;  4RPF A;  1Z0B A;  5BR8 E;  4DU7 A;  4JI4 E;  3PYF A;  2CPN A;  4XTJ A;  4AQY I;  4DR5 E;  2V2V A;  3ZZU A;  2V86 A;  5T6J A;  1FWL A;  2Z5C B;  4DV1 E;  2V34 A;  4IZJ D;  4DV0 I;  3ZKB A;  1FKA E;  4HXZ A;  3ADG A;  2MC5 A;  2DEJ A;  4JI7 E;  2VQF E;  3H09 A;  4LU9 A;  2UXD E;  1Z0V A;  4LF9 I;  1PVG A;  3ZM7 A;  4DPW A;  4X65 I;  2YZT A;  2CG9 A;  4GEQ B;  4DR3 E;  3JTZ A;  2ZM6 E;  4BS9 A;  1MU5 A;  4IZK B;  2XEX A;  4X62 I;  2IHR 1;  2VQE E;  4LTY A;  4JYA E;  2HHH I;  1N32 I;  3T1H E;  3Q6N A;  4N3O A;  2M4I A;  2B9D A;  2HFS A;  4DKK A;  3LTO A;  1ZM9 A;  4NXN I;  1XNR E;  4DV2 I;  5FLX C;  2DEI A;  4F9A B;  4LFB E;  4R8O A;  2CGE A;  2V2Z A;  4DV4 I;  4DR6 E;  5ADZ A;  2F4V E;  3GON A;  4DV3 E;  1MX0 A;  2DSY A;  3ADL A;  4X66 E;  2R42 A;  4JI1 I;  4DPT A;  4M0V A;  2LJP A;  5IWA E;  3VK6 A;  2V8P A;  1S4E A;  1N34 E;  4PRV A;  4AQY E;  3IWC A;  3PYE A;  4JI6 I;  4DXL A;  3HJC A;  3JU0 A;  4WUD A;  3T1Y I;  4NXM E;  4HAC B;  1N33 I;  4WPY A;  2RS7 A;  2RTX A;  1STU A;  4B3S E;  2O1W A;  2PNL A;  2NUG A;  2GQ0 A;  4B3M E;  3HPS A;  2HK2 A;  1J5E E;  4LF8 I;  5AAS A;  4LF9 E;  2CZ9 A;  2KOU A;  5A2Q C;  1ZXN A;  3JAM Q;  4UT4 A;  4TUI A;  2BV3 A;  1Y6Z A;  4X62 E;  2HHH E;  2V83 A;  1N32 E;  2IOP A;  4GKK I;  1T4O A;  2L2M A;  4BBY A;  1IBL I;  4DV7 E;  3ADI A;  1H73 A;  2E5L I;  3IWB A;  4JV5 I;  2DMY A;  2NPF A;  3K1J A;  2LBS B;  4DR4 E;  4DV4 E;  4LF7 I;  2A2D A;  1I94 I;  2OI2 A;  3LNU A;  1XMQ E;  3LLH A;  3OML A;  3F0N A;  4JI6 E;  1IBK E;  1H72 C;  3QT7 A;  4LF5 E;  2LUP B;  1SR9 A;  2G7H A;  4DR2 E;  1RC7 A;  4DR7 E;  4LF6 E;  3ZKD A;  1O0W A;  4DPY A;  2O1V A;  4P7D A;  4PU9 A;  2L8T A;  2F8B A;  1H7S A;  3M6A A;  1X48 A;  1A6F A;  1YYW A;  2L2N A;  4L5N C;  4MYU A;  2NUF A;  3QT8 A;  2BM1 A;  1FJG I;  2IOQ A;  3OTO I;  5LMU I;  4IZJ A;  4YHH I;  5L3J A;  1MG7 A;  3F6H A;  1FNM A;  4OX9 E;  4DUY E;  1XNQ E;  4JI5 E;  2JOX A;  4LFA I;  5GMD A;  1T4L B;  2O1U A;  4R03 A;  4Z7C A;  1X49 A;  4F54 A;  4DV5 E;  2EFG A;  3AV0 A;  5FWK A;  3HPZ A;  1IBM I;  1K47 A;  4M2Z A;  3FIG A;  5IT9 Q;  1XMO E;  3J80 C;  2X36 A;  4X8W A;  1Z0E A;  1HR0 E;  3CWV A;  3LPS A;  3ZZ0 A;  4KZS A;  2UU9 I;  3RMP A;  3J81 C;  4B3T E;  1Z0G A;  4JI8 I;  2J7K A;  5F3W A;  1Z0W A;  4GKJ I;  2UUC I;  4Q28 A;  4WYQ B;  4X64 E;  4JI2 I;  2V2Q A;  1Z5B A;  2AJ4 A;  4KQV A;  4BC7 A;  4M30 A;  2DB2 A;  5LMU E;  4FN5 A;  4EMD A;  1H7U A;  2JR1 A;  1HNX I;  1FI4 A;  4PRX A;  2JVA A;  4FW9 A;  4B3R I;  1H74 A;  2UUB I;  2Z5B A;  2N3G A;  3J7Y p;  4DV0 E;  4JI0 I;  1VIS A;  2LTR A;  1B63 A;  2L92 A;  1WXR A;  4DPX A;  4LF4 I;  2JOB A;  2LMZ A;  4X65 E;  2PNM A;  4P78 A;  1EI1 A;  1FWK A;  2UXC I;  3B78 A;  4R1F A;  3WU5 A;  1Y4U A;  2O1T A;  2L33 A;  4DR1 I;  4JI3 I;  2VF3 A;  1USU A;  2UU9 E;  4L8N A;  4NXN E;  4KHP I;  4DV2 E;  4I3H A;  2HKJ A;  2UUA I;  3K6Q A;  3K85 A;  3ADJ A;  4JI2 E;  2Z5E A;  2V88 A;  1Z5A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...