1HR0E

Crystal structure of initiation factor if1 bound to the 30s ribosomal subunit
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of an initiation factor bound to the 30S ribosomal subunit.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 34
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2000-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1hr0E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1hr0E02
2A2CA 2R42A 4JI7E 2JY9A 3ADJA 1ZM2A 4JI1I 4DR2I 4JI2E 4DV0I 1ZXNA 1H73A 1RREA 1EI1A 4DV7E 1ZM3A 4R1FA 4X8WA 1YYWA 1I94E 1O0WA 1N32E 2YT4A 2V2QA 1T4NA 4DPUA 2L3CA 4ZVIA 1H7UA 3OTOI 1RR9A 1MU5A 3PYFA 4DUZI 4PRXA 2A2DA 1N0UA 3GONA 4DR4I 4YHHE 4LF7I 2F4VI 1Z0TA 4MYTA 2ZM6I 5A2QC 1NZ0A 1FJGE 4DV2E 2UXDE 4X66E 1J5EE 3D4JA 4DV5E 2L2MA 4LF9E 2UXDI 4DPWA 1Z0CA 4LF9I 4LFBE 4JV5E 4DR1I 1FWLA 3PYEA 3ZZUA 1UHZA 4JYAI 1STUA 3J7Yp 4DR7I 3HULA 5LMNI 2LJPA 1N33I 4DR7E 2UXCI 3J81C 2UXCE 2HHHE 4RPFA 1KVKA 2HHHI 1IBLI 1XHKA 1X49A 1FNMA 4OX9E 2LTRA 4M30A 5IWAE 3ZZ0A 1QU6A 4DV1E 2HFSA 1ZBTA 2RS7A 1U2RA 2BM0A 3QT5A 1I94I 1UEKA 4HXZA 4JI4I 3ADGA 1XNRI 3K17A 2EFGA 5IT9C 4YY3I 4DUZE 1D6TA 1Z5AA 4NXNI 2CZ9A 1T4OA 1PVGA 4DR5I 3VYYA 2NA2A 4NXMI 2E5LE 3WU5A 1BKNA 2NUFA 2E1RA 4DV5I 3ZKBA 2HFUA 4DPTA 1NHHA 4JV5I 4Z7YA 1YYKA 3WU6A 1IBME 4JI8I 3WU3A 4Z7CA 4JI3I 1IBKE 4K0KI 4JI3E 4JI5I 1WUUA 1ELOA 4DV3E 2R3VA 4K0KE 1N36I 2UXBE 2RS6A 4AQYI 4X65E 1ZM4A 2J7KA 4AQYE 1IBLE 1NHIA 4OX9I 4LF8I 2HKEA 1S4EA 4JI0I 1Z0EA 2KHXA 2NPFA 4PU9A 4JI4E 4HACB 4DR6I 3PYDA 3B8HA 2LRSA 1MG7A 1S16A 3Q1QA 1XMQE 2RTXA 2DIXA 5LMUE 2VF3A 1FI4A 3LLHA 2L2NA 1KIJA 2JVAA 3ADLA 4KHPE 2BV3A 1XMQI 3LNUA 1HR0E 3J81Q 4HACA 2VQFE 3LTOA 4URLA 3T1HI 2HK2A 4FWDA 1PKPA 5GMDA 1X48A 4JG4A 2NUEA 1HNXI 2VQEE 2RSMA 4LFCE 2AJ4A 4FW9A 2NUGA 4DR2E 3QT6A 4YHHI 1K47A 2UUBE 4B3SE 4DV3I 4DU8A 4MYUA 1H74A 1DARA 4UTGA 4LFAE 4LF5I 2MDRA 2UUCI 3T1YI 2OI2A 4X64E 4LF4E 1N32I 2XEXA 1HNZE 1Z0GA 2UU9E 4JYAE 4HY1A 5L3JA 3WU4A 2UU9I 3C4BA 2B7VA 4JI1E 4DV4E 4LF6I 4USMA 3P1XA 1H72C 2DB2A 4X62E 4DU7A 1EKZA 4LF6E 4DV0E 2HKJA 4DV4I 4X62I 4DR4E 3ZKDA 4KHPI 1T4LB 2L3JA 1Z5BA 1ZXMA 1Z5CA 4DV2I 1NHJA 1KTVA 2VQFI 4USKA 4PRVA 4DV1I 4JI6I 4DKKA 5FLXC 4B3TE 4P52A 1FKAE 2N3GA 3OTOE 2UUAE 3ZM7A 4M2ZA 1J26A 1KKHA 3B82A 4JI2I 4DV6I 1GQEA 4DPYA 2ZM6E 1VISA 3F0NA 4DV6E 4EMDA 1N34I 5CFFE 2V2VA 4DV7I 2L33A 1N34E 3V2UC 1J5EI 4DR3I 2E5LI 1DI2A 3J80C 3JAMQ 2X36A 4DR3E 3V5RA 2BM1A 4LF5E 4LFAI 5LL6R 4X64I 4LF4I 1IBMI 4GKKE 4HYMA 1WHQA 4JI8E 2LTSA 4GKKI 1FWKA 3LPSA 4KQVA 4XTJA 4FWGA 2HK3A 5GMEA 4LF7E 2F4VE 2V2ZA 4NXNE 1N0VC 2Q2EB 2L2KB 5IWAI 5IT9Q 3VYXA 4LF8E 2LUQA 1YZ9A 2LBSB 4JI0E 3B78A 4WUDA 3K1JA 2EZ6A 2LUPB 4DR6E 3J7AG 5LMNE 1N33E 3M6AA 2IHR1 5LMUI 1UILA 4B3RI 2V34A 2LJHA 3J7AM 2UXBI 1XMOE 1HNWE 3QT8A 1XNQE 4FN5A 1Z0BA 1HNWI 1Z59A 1ZM9A 4WFTA 3ADIA 5BR8E 3T1HE 1B62A 1EA6A 4M1KA 5A2QQ 5BR8I 3C4TA 2WW4A 1RC7A 4WYQB 2V8PA 4ED4A 1XNRE 1IBKI 2CPNA 1Z0VA 1A6FA 1Z0WA 4YY3E 1N36E 3CWVA 2B7TA 1B63A 4B3SI 3ZZTA 4I3HA 4DR5E 4DPXA 4DUYI 4B3MI 2GS8A 2ZITA 4NXME 4WUBA 4GKJE 4DUYE 4B3ME 2UUCE 4GKJI 3J80Q 3PYGA 2B3TB 1HNZI 3HTXA 1X47A 4LFCI 4FWHA 4OOGC 4P7AA 1OJ4A 2DMYA 4WUCA 4DXLA 4JI5E 2UUBI 3QT7A 4B3RE 1FJGI 1PIEA 4X65I 3H4LA 1MX0A 4X66I 2ZBKB 1HR0I 1YYOA 1XMOI 1XNQI 4LFBI 4DR1E 5FLXQ 4JI6E 2DEIA 2X7IA 3T1YE 3JAMC 2DEJA 1H7SA 1HNXE 1WHNA 2N3HA 4B3TI 1QZRA 4UT4A 2VQEI 4JI7I 2UUAI 1RQ0A
chains in the Genus database with same CATH superfamily
3BBGA 2A2CA 4R2RA 2E72A 2CVEA 2O3ZA 2R42A 4JI7E 2JY9A 3ADJA 1ZM2A 4OO1D 2PO2B 4JI1I 1IMUA 3CDJA 1PJSA 4DR2I 2EQ1A 4JI2E 1RHYA 4DV0I 1ZXNA 2EN4A 1H73A 2CGEA 2YTOA 1X6EA 4LCHA 2EL6A 5IV8B 1RREA 1EI1A 4DV7E 1ZM3A 3M85G 5ELWA 5JEAC 2EOEA 4L8NA 4F2JC 4R1FA 3ECRA 4BA2B 4X8WA 2WNRA 5DNXA 1YYWA 4F9AB 2J7JA 4R2QA 2EPXA 2Z5CB 2PO2A 3P3EA 3P3GA 1I94E 5JEAE 1O0WA 5DNYA 1N32E 3H1CA 4MQYA 2YT4A 2RQLA 2MKNA 1AAYA 1T4NA 2V2QA 1EH7A 1X3CA 4DPUA 2L3CA 4ZVIA 1Y6ZA 3KZYA 1H7UA 4IZJD 1RR9A 3OTOI 1MU5A 2JE6A 4O24A 2JOBA 3PYFA 2BR2B 4DUZI 4PRXA 4KWYA 2A2DA 2EMLA 1N0UA 1X5WA 3GONA 4DR4I 4YHHE 2JP9A 4LF7I 2Z5BA 1Z0TA 2F4VI 2EOQA 4MYTA 2ZM6I 2N8XA 3THNA 4USMA 5A2QC 1NZ0A 2FV4B 2MDGA 4AIMA 2K7IA 2M9AA 2NABA 3OMLA 4DV2E 1FJGE 4X66E 1J5EE 2UXDE 3D4JA 3NZKA 4RHBB 2EN1A 4DV5E 2L2MA 4LF9E 4MU1A 2WBTA 1JK2A 2KOUA 2UXDI 4DPWA 1VI7A 2DLKA 1TF6A 1Z0CA 5F3WA 2JT2A 4LFBE 4JV5E 4DR1I 4LF9I 2PO1A 2JXPA 1FWLA 3PYEA 2Z5BB 3ZZUA 4F54A 5C0XB 1UHZA 2YTGA 4FK5C 2R1FA 4JYAI 2EQ0A 5KL4A 1STUA 5AC4A 3J7Yp 4DR7I 5AE1A 4MU4A 2EM5A 2ENHA 1ZBQA 4WPYA 1TF3A 3HULA 5LMNI 2LJPA 1N33I 4DR7E 2UXCI 3ZOQB 5KL5A 1ZAAC 5KL6A 4FW4A 2ADRA 3J81C 2HHHE 2UXCE 1PJTA 4WSPA 4R2EA 4RPFA 2C39B 2DSYA 1GZ6A 1G2DC 1KVKA 5ADZA 1UDQA 1XHKA 1IBLI 1OYRA 2HHHI 4X9JA 2PNMA 1X49A 2M4IA 3AV0A 4P78A 4OX9E 1FNMA 2LTRA 1YH8A 4M30A 5IWAE 2GQ0A 3VHTB 2DMIA 4BCAA 3ZZ0A 5KL2A 1WRJA 2EOFA 1QU6A 1KYQA 2EPOA 4DV1E 2EMCA 2M1SA 5AE3A 4OO1B 3MHHC 2EMFA 1ZBTA 2HFSA 2RS7A 2YRHA 1U2RA 2BM0A 3QT5A 1I94I 1UEKA 4HXZA 4JI4I 5K36C 3ADGA 4O43A 1PDAA 1XNRI 4U3DA 3K17A 2NN6F 1T38A 4R2DA 2EFGA 3EPJA 2ODRC 2JOXA 2EORA 2EPNA 2EPRA 5IT9C 4YY3I 2LVHA 4DUZE 5C0XC 4TUIA 1D6TA 1KJKA 1XXEA 2L92A 1Z5AA 2JR1A 4NXNI 1YPNA 2CZ9A 1T4OA 1PVGA 2DRPA 4DR5I 4R2CA 3VYYA 2YZTA 2BA0G 4WXDA 2EN7A 2NN6D 2NA2A 2EOHA 2E5LE 4NXMI 3WU5A 3EQ1A 1BKNA 2CT1A 1UDOA 2BA0D 2L8TA 2NUFA 5KL7A 1E3PA 4IZJA 1Y4SA 2E1RA 3IWCA 3ZKBA 4DV5I 5AASA 2HFUA 4DPTA 2HJJA 1NHHA 4JV5I 4Z7YA 3AUZA 1YYKA 3L00A 5AC5A 1IBME 3WU6A 1WXRA 4JI8I 3WU3A 4Z7CA 4JI3I 1Y5YA 1IBKE 4K0KI 2EL4A 4R03A 1DGCA 4JI3E 4OKGA 4JI5I 2VE7C 1WUUA 1ELOA 4DV3E 2R3VA 4K0KE 2JEAB 2BB8A 1N36I 2JYAA 2UXBE 2EOJA 2YTFA 3K6QA 2RS6A 4AQYI 4X65E 1ZM4A 2J7KA 1YUIA 2CSHA 4AQYE 1IBLE 3PS3A 2ELYA 2ELZA 1Y60A 3MHSC 1NHIA 4QNKA 2MC5A 5A6JA 1EH8A 2LT7A 3K85A 5C0XD 2BBGA 4LF8I 4OX9I 2HKEA 1S4EA 1P47A 1Z0EA 2EMWA 4JI0I 2EN6A 4J8ZA 2KHXA 5K36A 4IJDA 2NPFA 4AIDA 2V89A 4LPFA 4KZSA 4PU9A 2NN6C 2DGCA 2EOYA 1IQSA 3B4TA 4JI4E 4HACB 4DR6I 3PYDA 2WP8A 3B8HA 2EOXA 2LRSA 1MG7A 1S16A 2C37A 3Q1QA 1XMQE 2RTXA 2DIXA 2YPNA 2EPCA 4O5GA 2FGGA 5LMUE 2VF3A 4R2PA 3L7ZA 1FI4A 3LLHA 5K36B 2L2NA 1KIJA 2JVAA 3C6MA 3ADLA 4HEIA 4KHPE 2BV3A 3LNUA 4LCFA 1XMQI 2GPIA 2JEBB 5T6JA 2EQ3A 4I8OA 2DLQA 3H09A 1HR0E 1USUA 2GHFA 4FW3A 5JEAF 3J81Q 4HACA 2VQFE 3LTOA 1SR9A 4URLA 4OO1E 4GEQB 3T1HI 2HK2A 2EJ4A 4R2SA 4FWDA 1MEYC 1PKPA 2BA1D 2WP8B 1B69A 3HQ1A 5GMDA 1X48A 2JEAA 4JG4A 1YUJA 4IFDD 2NUEA 1HNXI 1T39A 1AH5A 4IFDE 4BBYA 2V8QB 4LTYA 2VQEE 2RSMA 2EPZA 3HPSA 4BA1B 4LFCE 1A1FA 2AJ4A 4FW9A 3DJWA 4FW6A 4ZYDA 2NUGA 1WJPA 5TSEA 4MLQA 4DR2E 3QT6A 2VF1A 1A1GA 2YTNA 5DNLA 4YHHI 1K47A 4IFDB 2UUBE 4LU9A 2V87A 4B3SE 4IZJB 5K36F 4DV3I 2EM0A 4AM3A 2EPKX 1BBOA 4DU8A 4F6NA 4MYUA 2EMXA 4R8OA 3KRNA 4ISAA 1H74A 3M85D 3DD6A 1DARA 2RSIA 4UTGA 4LFAE 4LF5I 2MDRA 2UUCI 3T1YI 2OI2A 4X64E 4LF4E 2EM4A 1N32I 2EP3A 2EOOA 1P42A 3EPKA 3F6GA 2XEXA 1HNZE 1Z0GA 2UU9E 1DQ3A 4JYAE 1N3GA 2EE8A 2WNRB 4HY1A 5IXMB 5C0XE 4GQUA 5L3JA 1JK1A 3WU4A 2UU9I 2I9IA 3C4BA 2B7VA 4JI1E 4LOMA 5DRRA 2EM7A 4DV4E 1NCSA 2KONA 3P1XA 2DB2A 2ENAA 4X62E 1H72C 1IQOA 5DRQA 1BB8A 4DU7A 2WBUA 1EKZA 4LF6E 4DV0E 2HKJA 4DV4I 4X62I 2YWQA 4DR4E 2EPPA 5A69A 4RH8A 4J3DA 3ZKDA 3DF6A 3BF2A 1L4SA 3HXLA 4KHPI 3UHMA 1T4LB 2L3JA 4R2AA 1Z5BA 1ZXMA 2PNZB 5DRPA 1Z5CA 4DV2I 1NHJA 2PNLA 2EMAA 3GCMA 2YTDA 1KTVA 2MKDA 2B9DA 4PRVA 4USKA 3BGHA 2VQFI 4DV1I 4JI6I 2H36X 1RMDA 3M99B 4L5NC 4BS9A 4DKKA 5FLXC 4GZNC 2EN8A 1UBDC 1USVA 4B3TE 2C37B 1Z1BA 2EN3A 1Y4UA 4P52A 1FKAE 4M0VA 2PO0A 2N3GA 3OTOE 1A1HA 2UUAE 3GMEA 3ZM7A 4M2ZA 1ZR9A 2C38A 5K36D 1J26A 1KKHA 5C0XF 4HTGA 2EMBA 2Q8UA 2MC6A 3C6KA 3P76A 5AE2A 3B82A 4IFDF 4TUGA 4DMIA 4JI2I 4IS1C 3HPZA 4DV6I 5EKWA 1GQEA 4DPYA 2PO0B 2ZM6E 1VISA 3F0NA 4DV6E 4EMDA 1N34I 5EL9A 5CFFE 1QNTA 1UN6B 2V2VA 2L33A 1N34E 4DV7I 3V2UC 2V88A 1J5EI 4MLVA 4DR3I 2E5LI 1EH6A 2EPUA 1DI2A 2BR2A 2HC5A 3J80C 3L7ZB 3JAMQ 5C0XA 1A1IA 3EPLA 1MGTA 1HK7A 2VRDA 4DR3E 1R6MA 2X36A 3V5RA 3PRYA 2EPMX 2I13A 2JPAA 2BM1A 3TQMA 2JE6B 4BHCA 4LF5E 4LFAI 5LL6R 4ZYGA 4FW7A 4F9CB 2O1TA 4O4KA 4X64I 4LF4I 2GO4A 1IBMI 4GKKE 4HYMA 3M7NG 1WHQA 5A6BD 4JI8E 2L6MA 2M7QA 3BIDA 2EOSA 4FW5A 2LTSA 4GKKI 2A25A 3THOB 4BC9A 4BA2A 4BC7A 2YRKA 4WXCA 2YU5A 4WSGA 2NN6E 1FWKA 3LPSA 4KQVA 2EWLA 1F2IG 4MU0A 4XTJA 4FWGA 2HK3A 5GMEA 2YTQA 2EMIA 4LF7E 4NXNE 4M9VC 2F4VE 2V2ZA 2Z5CA 1N0VC 2EM8A 1UDSA 3HKMA 4LCGA 2Q2EB 2L2KB 1A1JA 5FWKA 4NZVA 1PJQA 3KZZA 5IWAI 4F9BB 2YTIA 5IT9Q 2EMHA 3VYXA 2LUQA 4LF8E 1YZ9A 2LBSB 4JI0E 1X6HA 2BA1G 3P06A 3B78A 2EMYA 1OYPA 2JWOA 1A1KA 1HR0I 4WUDA 2EOZA 5JEAA 3K1JA 1GTKA 2EZ6A 3IWBA 2LUPB 4DR6E 4NBQA 2EOMA 3J7AG 2YRMA 5LMNE 1N33E 3M6AA 2LMZA 4Q28A 2EMZA 2IHR1 5LMUI 1UILA 4MU3A 3KWRA 3QG5C 5A6BA 4BA1A 4B3RI 3HJCA 2V34A 2LJHA 2F1DA 3J7AM 2UXBI 2E1MA 4OO1C 2YU8A 2EOIA 1XMOE 1HNWE 3QT8A 3GLLA 2LV2A 1G2FC 2GO3A 1XNQE 4FN5A 1Z0BA 4IS9A 1Z59A 1HNWI 1ZM9A 2EMGA 2NN6A 4WFTA 2V86A 2HGHA 3ADIA 5BR8E 3T1HE 4OO1F 1B62A 1EA6A 2YTPA 2D9HA 2CG9A 3PS2A 4Q35B 2YSPA 2LCEA 2EL5A 4M1KA 1E3HA 4N3OA 5A2QQ 5BR8I 3Q6MA 3C4TA 2JEBA 2WW4A 4P7DA 4WYQB 1RC7A 4IZKB 3U1KA 4IFDC 2V8PA 3RMPA 5A6AA 4ED4A 1XNRE 4F6MA 4MDTA 4IFDA 4OO1A 3VK6A 1IBKI 2CPNA 4N4RB 1OYSA 1Z0VA 3M7ND 2EM2A 1A6FA 3FIGA 4YY3E 1Z0WA 1TN9A 2O1UA 2GLIA 1N36E 3CWVA 2B7TA 1A1LA 1B63A 3CDIA 1YFHA 4B3SI 3P3CA 3JTZA 3ZZTA 4I3HA 4DR5E 4DPXA 2YSOA 4ZYHA 2C38B 2R76A 2PO1B 4NHRA 4DUYI 4WX9A 4B3MI 2GS8A 2ZITA 4NXME 2O1VA 4WUBA 4GKJE 4DUYE 4B3ME 4ZYEA 2CTDA 2UUCE 2C39A 2LE2A 4GKJI 2IOQA 2IESA 2F8BA 4BMJA 2Z5EA 3J80Q 1X6FA 3PYGA 2B3TB 1YSAC 1HNZI 2O1WA 3HTXA 1X47A 2PNZA 4OZEA 2YTJA 4QNJA 4LFCI 2V85A 4FWHA 1SFEA 4OOGC 4P7AA 2IOPA 1OJ4A 2WCC3 2DMYA 1NEIA 4WUCA 2LO3A 4BHBA 4IZKA 1LLMC 2IERA 2NN6B 3Q6NA 4DXLA 5JEAD 2EM6A 4JI5E 5LLQA 2EMKA 2V83A 2WZOA 2FTXB 2J65A 2ODRD 2AE8A 2UUBI 3PS1A 3QT7A 4B3RE 2EM9A 2EN2A 1ZU1A 2LJUA 3F6HA 1FJGI 1PIEA 2YTEA 2RPCA 2PRTA 1MX0A 2EPLX 2ZBKB 1YYOA 2WBSA 3H4LA 4X65I 4X66I 1XMOI 2VESA 3MSWA 1BBGA 2K4VA 1XNQI 1YHCA 2ENCA 5JEAB 4DR1E 4LFBI 3EPHA 5FLXQ 4JI6E 3IWDA 2DEIA 5KL3A 3T1YE 2X7IA 3JAMC 4LF6I 5DROA 2DEJA 1H7SA 3JU0A 1HNXE 1WHNA 5A6KA 2N3HA 2G7HA 1UDNA 4B3TI 1R6LA 5K36E 4U3BA 2EM3A 3UK3C 1QZRA 3LMLA 4UT4A 3U1YA 2VQEI 4JI7I 2EPAA 2UUAI 1RQ0A
chains in the Genus database with same CATH topology
2A2CA 2R42A 4JI7E 2JY9A 3ADJA 1ZM2A 4JI1I 4DR2I 4JI2E 4DV0I 1ZXNA 1H73A 2CGEA 1RREA 1EI1A 4DV7E 1ZM3A 4R1FA 4L8NA 4X8WA 1YYWA 4F9AB 2Z5CB 1I94E 1O0WA 5DNYA 1N32E 2YT4A 2V2QA 1T4NA 4DPUA 2L3CA 4ZVIA 1Y6ZA 1H7UA 4IZJD 3OTOI 1RR9A 1MU5A 2JOBA 3PYFA 4DUZI 4PRXA 2A2DA 1N0UA 3GONA 4DR4I 4YHHE 4LF7I 2F4VI 2Z5BA 1Z0TA 4MYTA 2ZM6I 5A2QC 1NZ0A 2FV4B 1FJGE 4DV2E 3OMLA 2UXDE 4X66E 1J5EE 3D4JA 4DV5E 2L2MA 4LF9E 2UXDI 2KOUA 4DPWA 1Z0CA 5F3WA 4LF9I 4LFBE 4JV5E 4DR1I 1FWLA 3PYEA 2Z5BB 3ZZUA 4F54A 1UHZA 4JYAI 1STUA 3J7Yp 4DR7I 5AE1A 1ZBQA 4WPYA 3HULA 5LMNI 2LJPA 1N33I 4DR7E 2UXCI 3ZOQB 3J81C 2UXCE 2HHHE 4WSPA 4RPFA 2DSYA 1GZ6A 1KVKA 2HHHI 5ADZA 1IBLI 1XHKA 2PNMA 1X49A 2M4IA 3AV0A 4P78A 1FNMA 4OX9E 2LTRA 4M30A 5IWAE 2GQ0A 4BCAA 3ZZ0A 1QU6A 4DV1E 2M1SA 5AE3A 2HFSA 1ZBTA 2RS7A 1U2RA 2BM0A 3QT5A 1I94I 1UEKA 4HXZA 4JI4I 3ADGA 1XNRI 3K17A 2EFGA 5IT9C 2ODRC 2JOXA 4YY3I 4DUZE 4TUIA 1D6TA 2L92A 1Z5AA 2JR1A 4NXNI 2CZ9A 1T4OA 1PVGA 4DR5I 3VYYA 2YZTA 2NA2A 4NXMI 2E5LE 3WU5A 1BKNA 2L8TA 2NUFA 4IZJA 1Y4SA 2E1RA 3IWCA 3ZKBA 4DV5I 5AASA 2HFUA 4DPTA 1NHHA 4JV5I 4Z7YA 3AUZA 1YYKA 3WU6A 1IBME 1WXRA 4JI8I 3WU3A 4Z7CA 4JI3I 1IBKE 4K0KI 4R03A 4JI3E 4JI5I 2VE7C 1WUUA 1ELOA 4DV3E 2R3VA 4K0KE 1N36I 2UXBE 3K6QA 2RS6A 4AQYI 4X65E 1ZM4A 2J7KA 4AQYE 1IBLE 1NHIA 2MC5A 3K85A 4OX9I 4LF8I 2HKEA 1S4EA 4JI0I 1Z0EA 4J8ZA 2KHXA 2NPFA 2V89A 4KZSA 4PU9A 4JI4E 4HACB 4DR6I 3PYDA 3B8HA 2LRSA 1MG7A 1S16A 3Q1QA 1XMQE 2RTXA 2DIXA 2FGGA 5LMUE 2VF3A 1FI4A 3LLHA 2L2NA 1KIJA 2JVAA 3ADLA 4KHPE 2BV3A 1XMQI 3LNUA 5T6JA 4I8OA 1USUA 3H09A 1HR0E 3J81Q 4HACA 2VQFE 3LTOA 1SR9A 4URLA 4GEQB 3T1HI 2HK2A 4FWDA 1PKPA 3HQ1A 5GMDA 1X48A 4JG4A 2NUEA 1HNXI 4BBYA 2V8QB 4LTYA 2VQEE 2RSMA 3HPSA 4LFCE 2AJ4A 4FW9A 3DJWA 2NUGA 4DR2E 3QT6A 2VF1A 4YHHI 1K47A 2UUBE 4LU9A 2V87A 4B3SE 4IZJB 4DV3I 4DU8A 4MYUA 4R8OA 1H74A 1DARA 4UTGA 4LFAE 4LF5I 2MDRA 2UUCI 3T1YI 2OI2A 4X64E 4LF4E 1N32I 3F6GA 2XEXA 1HNZE 1Z0GA 2UU9E 1DQ3A 4JYAE 4HY1A 5L3JA 3WU4A 2UU9I 3C4BA 2B7VA 4JI1E 4DV4E 4LF6I 4USMA 2KONA 3P1XA 2DB2A 4X62E 1H72C 4DU7A 1EKZA 4LF6E 4DV0E 2HKJA 4DV4I 4X62I 4DR4E 3ZKDA 3DF6A 3HXLA 4KHPI 1T4LB 2L3JA 1Z5BA 1ZXMA 1Z5CA 4DV2I 1NHJA 2PNLA 1KTVA 2VQFI 2B9DA 4PRVA 4USKA 4DV1I 4JI6I 2H36X 4DKKA 4L5NC 4BS9A 5FLXC 1USVA 4B3TE 1Y4UA 4P52A 1FKAE 4M0VA 2N3GA 3OTOE 2UUAE 3ZM7A 4M2ZA 1J26A 1KKHA 2MC6A 5AE2A 3B82A 4TUGA 4DMIA 4JI2I 3HPZA 4DV6I 1GQEA 4DPYA 2ZM6E 1VISA 3F0NA 4DV6E 4EMDA 1N34I 5CFFE 2V2VA 4DV7I 2L33A 1N34E 3V2UC 2V88A 1J5EI 4DR3I 2E5LI 1DI2A 3J80C 3JAMQ 2X36A 1HK7A 4DR3E 3V5RA 3PRYA 2BM1A 4LF5E 4LFAI 5LL6R 4F9CB 2O1TA 4X64I 4LF4I 1IBMI 4GKKE 4HYMA 1WHQA 4JI8E 2L6MA 2M7QA 2LTSA 4GKKI 4BC9A 4BC7A 1FWKA 3LPSA 4KQVA 2EWLA 4XTJA 4FWGA 2HK3A 5GMEA 4LF7E 2F4VE 2V2ZA 4NXNE 2Z5CA 1N0VC 5FWKA 2Q2EB 2L2KB 5IWAI 4F9BB 5IT9Q 3VYXA 4LF8E 2LUQA 1YZ9A 2LBSB 4JI0E 3P06A 3B78A 2JWOA 4WUDA 3K1JA 2EZ6A 3IWBA 2LUPB 4DR6E 3J7AG 5LMNE 1N33E 3M6AA 2LMZA 4Q28A 2IHR1 5LMUI 1UILA 3KWRA 4B3RI 3HJCA 2V34A 2LJHA 3J7AM 2UXBI 2E1MA 1XMOE 1HNWE 3QT8A 1XNQE 4FN5A 1Z0BA 1HNWI 1Z59A 1ZM9A 4WFTA 2V86A 3ADIA 5BR8E 3T1HE 1B62A 1EA6A 2CG9A 4N3OA 4M1KA 5A2QQ 5BR8I 3Q6MA 3C4TA 2WW4A 4P7DA 4WYQB 1RC7A 4IZKB 2V8PA 3RMPA 4ED4A 1XNRE 3VK6A 1IBKI 2CPNA 1Z0VA 1A6FA 3FIGA 4YY3E 1Z0WA 2O1UA 1N36E 3CWVA 2B7TA 1B63A 4B3SI 3JTZA 3ZZTA 4I3HA 4DR5E 4DPXA 4DUYI 4B3MI 2GS8A 2ZITA 4NXME 2O1VA 4WUBA 4GKJE 4DUYE 4B3ME 2UUCE 2LE2A 4GKJI 2IOQA 2F8BA 4BMJA 2Z5EA 3J80Q 3PYGA 2B3TB 1HNZI 2O1WA 3HTXA 1X47A 4LFCI 2V85A 4FWHA 4OOGC 4P7AA 2IOPA 1OJ4A 2DMYA 4WUCA 4IZKA 3Q6NA 4DXLA 4JI5E 2V83A 2WZOA 2FTXB 2ODRD 2UUBI 3QT7A 4B3RE 3F6HA 1FJGI 1PIEA 4X65I 3H4LA 1MX0A 4X66I 2ZBKB 1HR0I 1YYOA 1XMOI 3MSWA 2K4VA 1XNQI 4LFBI 4DR1E 5FLXQ 4JI6E 3IWDA 2DEIA 2X7IA 3T1YE 3JAMC 2DEJA 1H7SA 3JU0A 1HNXE 1WHNA 2N3HA 2G7HA 4B3TI 1QZRA 4UT4A 3LMLA 2VQEI 4JI7I 2UUAI 1RQ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A2C A;  2R42 A;  4JI7 E;  2JY9 A;  3ADJ A;  1ZM2 A;  4JI1 I;  4DR2 I;  4JI2 E;  4DV0 I;  1ZXN A;  1H73 A;  1RRE A;  1EI1 A;  4DV7 E;  1ZM3 A;  4R1F A;  4X8W A;  1YYW A;  1I94 E;  1O0W A;  1N32 E;  2YT4 A;  2V2Q A;  1T4N A;  4DPU A;  2L3C A;  4ZVI A;  1H7U A;  3OTO I;  1RR9 A;  1MU5 A;  3PYF A;  4DUZ I;  4PRX A;  2A2D A;  1N0U A;  3GON A;  4DR4 I;  4YHH E;  4LF7 I;  2F4V I;  1Z0T A;  4MYT A;  2ZM6 I;  5A2Q C;  1NZ0 A;  1FJG E;  4DV2 E;  2UXD E;  4X66 E;  1J5E E;  3D4J A;  4DV5 E;  2L2M A;  4LF9 E;  2UXD I;  4DPW A;  1Z0C A;  4LF9 I;  4LFB E;  4JV5 E;  4DR1 I;  1FWL A;  3PYE A;  3ZZU A;  1UHZ A;  4JYA I;  1STU A;  3J7Y p;  4DR7 I;  3HUL A;  5LMN I;  2LJP A;  1N33 I;  4DR7 E;  2UXC I;  3J81 C;  2UXC E;  2HHH E;  4RPF A;  1KVK A;  2HHH I;  1IBL I;  1XHK A;  1X49 A;  1FNM A;  4OX9 E;  2LTR A;  4M30 A;  5IWA E;  3ZZ0 A;  1QU6 A;  4DV1 E;  2HFS A;  1ZBT A;  2RS7 A;  1U2R A;  2BM0 A;  3QT5 A;  1I94 I;  1UEK A;  4HXZ A;  4JI4 I;  3ADG A;  1XNR I;  3K17 A;  2EFG A;  5IT9 C;  4YY3 I;  4DUZ E;  1D6T A;  1Z5A A;  4NXN I;  2CZ9 A;  1T4O A;  1PVG A;  4DR5 I;  3VYY A;  2NA2 A;  4NXM I;  2E5L E;  3WU5 A;  1BKN A;  2NUF A;  2E1R A;  4DV5 I;  3ZKB A;  2HFU A;  4DPT A;  1NHH A;  4JV5 I;  4Z7Y A;  1YYK A;  3WU6 A;  1IBM E;  4JI8 I;  3WU3 A;  4Z7C A;  4JI3 I;  1IBK E;  4K0K I;  4JI3 E;  4JI5 I;  1WUU A;  1ELO A;  4DV3 E;  2R3V A;  4K0K E;  1N36 I;  2UXB E;  2RS6 A;  4AQY I;  4X65 E;  1ZM4 A;  2J7K A;  4AQY E;  1IBL E;  1NHI A;  4OX9 I;  4LF8 I;  2HKE A;  1S4E A;  4JI0 I;  1Z0E A;  2KHX A;  2NPF A;  4PU9 A;  4JI4 E;  4HAC B;  4DR6 I;  3PYD A;  3B8H A;  2LRS A;  1MG7 A;  1S16 A;  3Q1Q A;  1XMQ E;  2RTX A;  2DIX A;  5LMU E;  2VF3 A;  1FI4 A;  3LLH A;  2L2N A;  1KIJ A;  2JVA A;  3ADL A;  4KHP E;  2BV3 A;  1XMQ I;  3LNU A;  1HR0 E;  3J81 Q;  4HAC A;  2VQF E;  3LTO A;  4URL A;  3T1H I;  2HK2 A;  4FWD A;  1PKP A;  5GMD A;  1X48 A;  4JG4 A;  2NUE A;  1HNX I;  2VQE E;  2RSM A;  4LFC E;  2AJ4 A;  4FW9 A;  2NUG A;  4DR2 E;  3QT6 A;  4YHH I;  1K47 A;  2UUB E;  4B3S E;  4DV3 I;  4DU8 A;  4MYU A;  1H74 A;  1DAR A;  4UTG A;  4LFA E;  4LF5 I;  2MDR A;  2UUC I;  3T1Y I;  2OI2 A;  4X64 E;  4LF4 E;  1N32 I;  2XEX A;  1HNZ E;  1Z0G A;  2UU9 E;  4JYA E;  4HY1 A;  5L3J A;  3WU4 A;  2UU9 I;  3C4B A;  2B7V A;  4JI1 E;  4DV4 E;  4LF6 I;  4USM A;  3P1X A;  1H72 C;  2DB2 A;  4X62 E;  4DU7 A;  1EKZ A;  4LF6 E;  4DV0 E;  2HKJ A;  4DV4 I;  4X62 I;  4DR4 E;  3ZKD A;  4KHP I;  1T4L B;  2L3J A;  1Z5B A;  1ZXM A;  1Z5C A;  4DV2 I;  1NHJ A;  1KTV A;  2VQF I;  4USK A;  4PRV A;  4DV1 I;  4JI6 I;  4DKK A;  5FLX C;  4B3T E;  4P52 A;  1FKA E;  2N3G A;  3OTO E;  2UUA E;  3ZM7 A;  4M2Z A;  1J26 A;  1KKH A;  3B82 A;  4JI2 I;  4DV6 I;  1GQE A;  4DPY A;  2ZM6 E;  1VIS A;  3F0N A;  4DV6 E;  4EMD A;  1N34 I;  5CFF E;  2V2V A;  4DV7 I;  2L33 A;  1N34 E;  3V2U C;  1J5E I;  4DR3 I;  2E5L I;  1DI2 A;  3J80 C;  3JAM Q;  2X36 A;  4DR3 E;  3V5R A;  2BM1 A;  4LF5 E;  4LFA I;  5LL6 R;  4X64 I;  4LF4 I;  1IBM I;  4GKK E;  4HYM A;  1WHQ A;  4JI8 E;  2LTS A;  4GKK I;  1FWK A;  3LPS A;  4KQV A;  4XTJ A;  4FWG A;  2HK3 A;  5GME A;  4LF7 E;  2F4V E;  2V2Z A;  4NXN E;  1N0V C;  2Q2E B;  2L2K B;  5IWA I;  5IT9 Q;  3VYX A;  4LF8 E;  2LUQ A;  1YZ9 A;  2LBS B;  4JI0 E;  3B78 A;  4WUD A;  3K1J A;  2EZ6 A;  2LUP B;  4DR6 E;  3J7A G;  5LMN E;  1N33 E;  3M6A A;  2IHR 1;  5LMU I;  1UIL A;  4B3R I;  2V34 A;  2LJH A;  3J7A M;  2UXB I;  1XMO E;  1HNW E;  3QT8 A;  1XNQ E;  4FN5 A;  1Z0B A;  1HNW I;  1Z59 A;  1ZM9 A;  4WFT A;  3ADI A;  5BR8 E;  3T1H E;  1B62 A;  1EA6 A;  4M1K A;  5A2Q Q;  5BR8 I;  3C4T A;  2WW4 A;  1RC7 A;  4WYQ B;  2V8P A;  4ED4 A;  1XNR E;  1IBK I;  2CPN A;  1Z0V A;  1A6F A;  1Z0W A;  4YY3 E;  1N36 E;  3CWV A;  2B7T A;  1B63 A;  4B3S I;  3ZZT A;  4I3H A;  4DR5 E;  4DPX A;  4DUY I;  4B3M I;  2GS8 A;  2ZIT A;  4NXM E;  4WUB A;  4GKJ E;  4DUY E;  4B3M E;  2UUC E;  4GKJ I;  3J80 Q;  3PYG A;  2B3T B;  1HNZ I;  3HTX A;  1X47 A;  4LFC I;  4FWH A;  4OOG C;  4P7A A;  1OJ4 A;  2DMY A;  4WUC A;  4DXL A;  4JI5 E;  2UUB I;  3QT7 A;  4B3R E;  1FJG I;  1PIE A;  4X65 I;  3H4L A;  1MX0 A;  4X66 I;  2ZBK B;  1HR0 I;  1YYO A;  1XMO I;  1XNQ I;  4LFB I;  4DR1 E;  5FLX Q;  4JI6 E;  2DEI A;  2X7I A;  3T1Y E;  3JAM C;  2DEJ A;  1H7S A;  1HNX E;  1WHN A;  2N3H A;  4B3T I;  1QZR A;  4UT4 A;  2VQE I;  4JI7 I;  2UUA I;  1RQ0 A; 
#chains in the Genus database with same CATH topology
 3BBG A;  2A2C A;  4R2R A;  2E72 A;  2CVE A;  2O3Z A;  2R42 A;  4JI7 E;  2JY9 A;  3ADJ A;  1ZM2 A;  4OO1 D;  2PO2 B;  4JI1 I;  1IMU A;  3CDJ A;  1PJS A;  4DR2 I;  2EQ1 A;  4JI2 E;  1RHY A;  4DV0 I;  1ZXN A;  2EN4 A;  1H73 A;  2CGE A;  2YTO A;  1X6E A;  4LCH A;  2EL6 A;  5IV8 B;  1RRE A;  1EI1 A;  4DV7 E;  1ZM3 A;  3M85 G;  5ELW A;  5JEA C;  2EOE A;  4L8N A;  4F2J C;  4R1F A;  3ECR A;  4BA2 B;  4X8W A;  2WNR A;  5DNX A;  1YYW A;  4F9A B;  2J7J A;  4R2Q A;  2EPX A;  2Z5C B;  2PO2 A;  3P3E A;  3P3G A;  1I94 E;  5JEA E;  1O0W A;  5DNY A;  1N32 E;  3H1C A;  4MQY A;  2YT4 A;  2RQL A;  2MKN A;  1AAY A;  1T4N A;  2V2Q A;  1EH7 A;  1X3C A;  4DPU A;  2L3C A;  4ZVI A;  1Y6Z A;  3KZY A;  1H7U A;  4IZJ D;  1RR9 A;  3OTO I;  1MU5 A;  2JE6 A;  4O24 A;  2JOB A;  3PYF A;  2BR2 B;  4DUZ I;  4PRX A;  4KWY A;  2A2D A;  2EML A;  1N0U A;  1X5W A;  3GON A;  4DR4 I;  4YHH E;  2JP9 A;  4LF7 I;  2Z5B A;  1Z0T A;  2F4V I;  2EOQ A;  4MYT A;  2ZM6 I;  2N8X A;  3THN A;  4USM A;  5A2Q C;  1NZ0 A;  2FV4 B;  2MDG A;  4AIM A;  2K7I A;  2M9A A;  2NAB A;  3OML A;  4DV2 E;  1FJG E;  4X66 E;  1J5E E;  2UXD E;  3D4J A;  3NZK A;  4RHB B;  2EN1 A;  4DV5 E;  2L2M A;  4LF9 E;  4MU1 A;  2WBT A;  1JK2 A;  2KOU A;  2UXD I;  4DPW A;  1VI7 A;  2DLK A;  1TF6 A;  1Z0C A;  5F3W A;  2JT2 A;  4LFB E;  4JV5 E;  4DR1 I;  4LF9 I;  2PO1 A;  2JXP A;  1FWL A;  3PYE A;  2Z5B B;  3ZZU A;  4F54 A;  5C0X B;  1UHZ A;  2YTG A;  4FK5 C;  2R1F A;  4JYA I;  2EQ0 A;  5KL4 A;  1STU A;  5AC4 A;  3J7Y p;  4DR7 I;  5AE1 A;  4MU4 A;  2EM5 A;  2ENH A;  1ZBQ A;  4WPY A;  1TF3 A;  3HUL A;  5LMN I;  2LJP A;  1N33 I;  4DR7 E;  2UXC I;  3ZOQ B;  5KL5 A;  1ZAA C;  5KL6 A;  4FW4 A;  2ADR A;  3J81 C;  2HHH E;  2UXC E;  1PJT A;  4WSP A;  4R2E A;  4RPF A;  2C39 B;  2DSY A;  1GZ6 A;  1G2D C;  1KVK A;  5ADZ A;  1UDQ A;  1XHK A;  1IBL I;  1OYR A;  2HHH I;  4X9J A;  2PNM A;  1X49 A;  2M4I A;  3AV0 A;  4P78 A;  4OX9 E;  1FNM A;  2LTR A;  1YH8 A;  4M30 A;  5IWA E;  2GQ0 A;  3VHT B;  2DMI A;  4BCA A;  3ZZ0 A;  5KL2 A;  1WRJ A;  2EOF A;  1QU6 A;  1KYQ A;  2EPO A;  4DV1 E;  2EMC A;  2M1S A;  5AE3 A;  4OO1 B;  3MHH C;  2EMF A;  1ZBT A;  2HFS A;  2RS7 A;  2YRH A;  1U2R A;  2BM0 A;  3QT5 A;  1I94 I;  1UEK A;  4HXZ A;  4JI4 I;  5K36 C;  3ADG A;  4O43 A;  1PDA A;  1XNR I;  4U3D A;  3K17 A;  2NN6 F;  1T38 A;  4R2D A;  2EFG A;  3EPJ A;  2ODR C;  2JOX A;  2EOR A;  2EPN A;  2EPR A;  5IT9 C;  4YY3 I;  2LVH A;  4DUZ E;  5C0X C;  4TUI A;  1D6T A;  1KJK A;  1XXE A;  2L92 A;  1Z5A A;  2JR1 A;  4NXN I;  1YPN A;  2CZ9 A;  1T4O A;  1PVG A;  2DRP A;  4DR5 I;  4R2C A;  3VYY A;  2YZT A;  2BA0 G;  4WXD A;  2EN7 A;  2NN6 D;  2NA2 A;  2EOH A;  2E5L E;  4NXM I;  3WU5 A;  3EQ1 A;  1BKN A;  2CT1 A;  1UDO A;  2BA0 D;  2L8T A;  2NUF A;  5KL7 A;  1E3P A;  4IZJ A;  1Y4S A;  2E1R A;  3IWC A;  3ZKB A;  4DV5 I;  5AAS A;  2HFU A;  4DPT A;  2HJJ A;  1NHH A;  4JV5 I;  4Z7Y A;  3AUZ A;  1YYK A;  3L00 A;  5AC5 A;  1IBM E;  3WU6 A;  1WXR A;  4JI8 I;  3WU3 A;  4Z7C A;  4JI3 I;  1Y5Y A;  1IBK E;  4K0K I;  2EL4 A;  4R03 A;  1DGC A;  4JI3 E;  4OKG A;  4JI5 I;  2VE7 C;  1WUU A;  1ELO A;  4DV3 E;  2R3V A;  4K0K E;  2JEA B;  2BB8 A;  1N36 I;  2JYA A;  2UXB E;  2EOJ A;  2YTF A;  3K6Q A;  2RS6 A;  4AQY I;  4X65 E;  1ZM4 A;  2J7K A;  1YUI A;  2CSH A;  4AQY E;  1IBL E;  3PS3 A;  2ELY A;  2ELZ A;  1Y60 A;  3MHS C;  1NHI A;  4QNK A;  2MC5 A;  5A6J A;  1EH8 A;  2LT7 A;  3K85 A;  5C0X D;  2BBG A;  4LF8 I;  4OX9 I;  2HKE A;  1S4E A;  1P47 A;  1Z0E A;  2EMW A;  4JI0 I;  2EN6 A;  4J8Z A;  2KHX A;  5K36 A;  4IJD A;  2NPF A;  4AID A;  2V89 A;  4LPF A;  4KZS A;  4PU9 A;  2NN6 C;  2DGC A;  2EOY A;  1IQS A;  3B4T A;  4JI4 E;  4HAC B;  4DR6 I;  3PYD A;  2WP8 A;  3B8H A;  2EOX A;  2LRS A;  1MG7 A;  1S16 A;  2C37 A;  3Q1Q A;  1XMQ E;  2RTX A;  2DIX A;  2YPN A;  2EPC A;  4O5G A;  2FGG A;  5LMU E;  2VF3 A;  4R2P A;  3L7Z A;  1FI4 A;  3LLH A;  5K36 B;  2L2N A;  1KIJ A;  2JVA A;  3C6M A;  3ADL A;  4HEI A;  4KHP E;  2BV3 A;  3LNU A;  4LCF A;  1XMQ I;  2GPI A;  2JEB B;  5T6J A;  2EQ3 A;  4I8O A;  2DLQ A;  3H09 A;  1HR0 E;  1USU A;  2GHF A;  4FW3 A;  5JEA F;  3J81 Q;  4HAC A;  2VQF E;  3LTO A;  1SR9 A;  4URL A;  4OO1 E;  4GEQ B;  3T1H I;  2HK2 A;  2EJ4 A;  4R2S A;  4FWD A;  1MEY C;  1PKP A;  2BA1 D;  2WP8 B;  1B69 A;  3HQ1 A;  5GMD A;  1X48 A;  2JEA A;  4JG4 A;  1YUJ A;  4IFD D;  2NUE A;  1HNX I;  1T39 A;  1AH5 A;  4IFD E;  4BBY A;  2V8Q B;  4LTY A;  2VQE E;  2RSM A;  2EPZ A;  3HPS A;  4BA1 B;  4LFC E;  1A1F A;  2AJ4 A;  4FW9 A;  3DJW A;  4FW6 A;  4ZYD A;  2NUG A;  1WJP A;  5TSE A;  4MLQ A;  4DR2 E;  3QT6 A;  2VF1 A;  1A1G A;  2YTN A;  5DNL A;  4YHH I;  1K47 A;  4IFD B;  2UUB E;  4LU9 A;  2V87 A;  4B3S E;  4IZJ B;  5K36 F;  4DV3 I;  2EM0 A;  4AM3 A;  2EPK X;  1BBO A;  4DU8 A;  4F6N A;  4MYU A;  2EMX A;  4R8O A;  3KRN A;  4ISA A;  1H74 A;  3M85 D;  3DD6 A;  1DAR A;  2RSI A;  4UTG A;  4LFA E;  4LF5 I;  2MDR A;  2UUC I;  3T1Y I;  2OI2 A;  4X64 E;  4LF4 E;  2EM4 A;  1N32 I;  2EP3 A;  2EOO A;  1P42 A;  3EPK A;  3F6G A;  2XEX A;  1HNZ E;  1Z0G A;  2UU9 E;  1DQ3 A;  4JYA E;  1N3G A;  2EE8 A;  2WNR B;  4HY1 A;  5IXM B;  5C0X E;  4GQU A;  5L3J A;  1JK1 A;  3WU4 A;  2UU9 I;  2I9I A;  3C4B A;  2B7V A;  4JI1 E;  4LOM A;  5DRR A;  2EM7 A;  4DV4 E;  1NCS A;  2KON A;  3P1X A;  2DB2 A;  2ENA A;  4X62 E;  1H72 C;  1IQO A;  5DRQ A;  1BB8 A;  4DU7 A;  2WBU A;  1EKZ A;  4LF6 E;  4DV0 E;  2HKJ A;  4DV4 I;  4X62 I;  2YWQ A;  4DR4 E;  2EPP A;  5A69 A;  4RH8 A;  4J3D A;  3ZKD A;  3DF6 A;  3BF2 A;  1L4S A;  3HXL A;  4KHP I;  3UHM A;  1T4L B;  2L3J A;  4R2A A;  1Z5B A;  1ZXM A;  2PNZ B;  5DRP A;  1Z5C A;  4DV2 I;  1NHJ A;  2PNL A;  2EMA A;  3GCM A;  2YTD A;  1KTV A;  2MKD A;  2B9D A;  4PRV A;  4USK A;  3BGH A;  2VQF I;  4DV1 I;  4JI6 I;  2H36 X;  1RMD A;  3M99 B;  4L5N C;  4BS9 A;  4DKK A;  5FLX C;  4GZN C;  2EN8 A;  1UBD C;  1USV A;  4B3T E;  2C37 B;  1Z1B A;  2EN3 A;  1Y4U A;  4P52 A;  1FKA E;  4M0V A;  2PO0 A;  2N3G A;  3OTO E;  1A1H A;  2UUA E;  3GME A;  3ZM7 A;  4M2Z A;  1ZR9 A;  2C38 A;  5K36 D;  1J26 A;  1KKH A;  5C0X F;  4HTG A;  2EMB A;  2Q8U A;  2MC6 A;  3C6K A;  3P76 A;  5AE2 A;  3B82 A;  4IFD F;  4TUG A;  4DMI A;  4JI2 I;  4IS1 C;  3HPZ A;  4DV6 I;  5EKW A;  1GQE A;  4DPY A;  2PO0 B;  2ZM6 E;  1VIS A;  3F0N A;  4DV6 E;  4EMD A;  1N34 I;  5EL9 A;  5CFF E;  1QNT A;  1UN6 B;  2V2V A;  2L33 A;  1N34 E;  4DV7 I;  3V2U C;  2V88 A;  1J5E I;  4MLV A;  4DR3 I;  2E5L I;  1EH6 A;  2EPU A;  1DI2 A;  2BR2 A;  2HC5 A;  3J80 C;  3L7Z B;  3JAM Q;  5C0X A;  1A1I A;  3EPL A;  1MGT A;  1HK7 A;  2VRD A;  4DR3 E;  1R6M A;  2X36 A;  3V5R A;  3PRY A;  2EPM X;  2I13 A;  2JPA A;  2BM1 A;  3TQM A;  2JE6 B;  4BHC A;  4LF5 E;  4LFA I;  5LL6 R;  4ZYG A;  4FW7 A;  4F9C B;  2O1T A;  4O4K A;  4X64 I;  4LF4 I;  2GO4 A;  1IBM I;  4GKK E;  4HYM A;  3M7N G;  1WHQ A;  5A6B D;  4JI8 E;  2L6M A;  2M7Q A;  3BID A;  2EOS A;  4FW5 A;  2LTS A;  4GKK I;  2A25 A;  3THO B;  4BC9 A;  4BA2 A;  4BC7 A;  2YRK A;  4WXC A;  2YU5 A;  4WSG A;  2NN6 E;  1FWK A;  3LPS A;  4KQV A;  2EWL A;  1F2I G;  4MU0 A;  4XTJ A;  4FWG A;  2HK3 A;  5GME A;  2YTQ A;  2EMI A;  4LF7 E;  4NXN E;  4M9V C;  2F4V E;  2V2Z A;  2Z5C A;  1N0V C;  2EM8 A;  1UDS A;  3HKM A;  4LCG A;  2Q2E B;  2L2K B;  1A1J A;  5FWK A;  4NZV A;  1PJQ A;  3KZZ A;  5IWA I;  4F9B B;  2YTI A;  5IT9 Q;  2EMH A;  3VYX A;  2LUQ A;  4LF8 E;  1YZ9 A;  2LBS B;  4JI0 E;  1X6H A;  2BA1 G;  3P06 A;  3B78 A;  2EMY A;  1OYP A;  2JWO A;  1A1K A;  1HR0 I;  4WUD A;  2EOZ A;  5JEA A;  3K1J A;  1GTK A;  2EZ6 A;  3IWB A;  2LUP B;  4DR6 E;  4NBQ A;  2EOM A;  3J7A G;  2YRM A;  5LMN E;  1N33 E;  3M6A A;  2LMZ A;  4Q28 A;  2EMZ A;  2IHR 1;  5LMU I;  1UIL A;  4MU3 A;  3KWR A;  3QG5 C;  5A6B A;  4BA1 A;  4B3R I;  3HJC A;  2V34 A;  2LJH A;  2F1D A;  3J7A M;  2UXB I;  2E1M A;  4OO1 C;  2YU8 A;  2EOI A;  1XMO E;  1HNW E;  3QT8 A;  3GLL A;  2LV2 A;  1G2F C;  2GO3 A;  1XNQ E;  4FN5 A;  1Z0B A;  4IS9 A;  1Z59 A;  1HNW I;  1ZM9 A;  2EMG A;  2NN6 A;  4WFT A;  2V86 A;  2HGH A;  3ADI A;  5BR8 E;  3T1H E;  4OO1 F;  1B62 A;  1EA6 A;  2YTP A;  2D9H A;  2CG9 A;  3PS2 A;  4Q35 B;  2YSP A;  2LCE A;  2EL5 A;  4M1K A;  1E3H A;  4N3O A;  5A2Q Q;  5BR8 I;  3Q6M A;  3C4T A;  2JEB A;  2WW4 A;  4P7D A;  4WYQ B;  1RC7 A;  4IZK B;  3U1K A;  4IFD C;  2V8P A;  3RMP A;  5A6A A;  4ED4 A;  1XNR E;  4F6M A;  4MDT A;  4IFD A;  4OO1 A;  3VK6 A;  1IBK I;  2CPN A;  4N4R B;  1OYS A;  1Z0V A;  3M7N D;  2EM2 A;  1A6F A;  3FIG A;  4YY3 E;  1Z0W A;  1TN9 A;  2O1U A;  2GLI A;  1N36 E;  3CWV A;  2B7T A;  1A1L A;  1B63 A;  3CDI A;  1YFH A;  4B3S I;  3P3C A;  3JTZ A;  3ZZT A;  4I3H A;  4DR5 E;  4DPX A;  2YSO A;  4ZYH A;  2C38 B;  2R76 A;  2PO1 B;  4NHR A;  4DUY I;  4WX9 A;  4B3M I;  2GS8 A;  2ZIT A;  4NXM E;  2O1V A;  4WUB A;  4GKJ E;  4DUY E;  4B3M E;  4ZYE A;  2CTD A;  2UUC E;  2C39 A;  2LE2 A;  4GKJ I;  2IOQ A;  2IES A;  2F8B A;  4BMJ A;  2Z5E A;  3J80 Q;  1X6F A;  3PYG A;  2B3T B;  1YSA C;  1HNZ I;  2O1W A;  3HTX A;  1X47 A;  2PNZ A;  4OZE A;  2YTJ A;  4QNJ A;  4LFC I;  2V85 A;  4FWH A;  1SFE A;  4OOG C;  4P7A A;  2IOP A;  1OJ4 A;  2WCC 3;  2DMY A;  1NEI A;  4WUC A;  2LO3 A;  4BHB A;  4IZK A;  1LLM C;  2IER A;  2NN6 B;  3Q6N A;  4DXL A;  5JEA D;  2EM6 A;  4JI5 E;  5LLQ A;  2EMK A;  2V83 A;  2WZO A;  2FTX B;  2J65 A;  2ODR D;  2AE8 A;  2UUB I;  3PS1 A;  3QT7 A;  4B3R E;  2EM9 A;  2EN2 A;  1ZU1 A;  2LJU A;  3F6H A;  1FJG I;  1PIE A;  2YTE A;  2RPC A;  2PRT A;  1MX0 A;  2EPL X;  2ZBK B;  1YYO A;  2WBS A;  3H4L A;  4X65 I;  4X66 I;  1XMO I;  2VES A;  3MSW A;  1BBG A;  2K4V A;  1XNQ I;  1YHC A;  2ENC A;  5JEA B;  4DR1 E;  4LFB I;  3EPH A;  5FLX Q;  4JI6 E;  3IWD A;  2DEI A;  5KL3 A;  3T1Y E;  2X7I A;  3JAM C;  4LF6 I;  5DRO A;  2DEJ A;  1H7S A;  3JU0 A;  1HNX E;  1WHN A;  5A6K A;  2N3H A;  2G7H A;  1UDN A;  4B3T I;  1R6L A;  5K36 E;  4U3B A;  2EM3 A;  3UK3 C;  1QZR A;  3LML A;  4UT4 A;  3U1Y A;  2VQE I;  4JI7 I;  2EPA A;  2UUA I;  1RQ0 A; 
#chains in the Genus database with same CATH homology
 2A2C A;  2R42 A;  4JI7 E;  2JY9 A;  3ADJ A;  1ZM2 A;  4JI1 I;  4DR2 I;  4JI2 E;  4DV0 I;  1ZXN A;  1H73 A;  2CGE A;  1RRE A;  1EI1 A;  4DV7 E;  1ZM3 A;  4R1F A;  4L8N A;  4X8W A;  1YYW A;  4F9A B;  2Z5C B;  1I94 E;  1O0W A;  5DNY A;  1N32 E;  2YT4 A;  2V2Q A;  1T4N A;  4DPU A;  2L3C A;  4ZVI A;  1Y6Z A;  1H7U A;  4IZJ D;  3OTO I;  1RR9 A;  1MU5 A;  2JOB A;  3PYF A;  4DUZ I;  4PRX A;  2A2D A;  1N0U A;  3GON A;  4DR4 I;  4YHH E;  4LF7 I;  2F4V I;  2Z5B A;  1Z0T A;  4MYT A;  2ZM6 I;  5A2Q C;  1NZ0 A;  2FV4 B;  1FJG E;  4DV2 E;  3OML A;  2UXD E;  4X66 E;  1J5E E;  3D4J A;  4DV5 E;  2L2M A;  4LF9 E;  2UXD I;  2KOU A;  4DPW A;  1Z0C A;  5F3W A;  4LF9 I;  4LFB E;  4JV5 E;  4DR1 I;  1FWL A;  3PYE A;  2Z5B B;  3ZZU A;  4F54 A;  1UHZ A;  4JYA I;  1STU A;  3J7Y p;  4DR7 I;  5AE1 A;  1ZBQ A;  4WPY A;  3HUL A;  5LMN I;  2LJP A;  1N33 I;  4DR7 E;  2UXC I;  3ZOQ B;  3J81 C;  2UXC E;  2HHH E;  4WSP A;  4RPF A;  2DSY A;  1GZ6 A;  1KVK A;  2HHH I;  5ADZ A;  1IBL I;  1XHK A;  2PNM A;  1X49 A;  2M4I A;  3AV0 A;  4P78 A;  1FNM A;  4OX9 E;  2LTR A;  4M30 A;  5IWA E;  2GQ0 A;  4BCA A;  3ZZ0 A;  1QU6 A;  4DV1 E;  2M1S A;  5AE3 A;  2HFS A;  1ZBT A;  2RS7 A;  1U2R A;  2BM0 A;  3QT5 A;  1I94 I;  1UEK A;  4HXZ A;  4JI4 I;  3ADG A;  1XNR I;  3K17 A;  2EFG A;  5IT9 C;  2ODR C;  2JOX A;  4YY3 I;  4DUZ E;  4TUI A;  1D6T A;  2L92 A;  1Z5A A;  2JR1 A;  4NXN I;  2CZ9 A;  1T4O A;  1PVG A;  4DR5 I;  3VYY A;  2YZT A;  2NA2 A;  4NXM I;  2E5L E;  3WU5 A;  1BKN A;  2L8T A;  2NUF A;  4IZJ A;  1Y4S A;  2E1R A;  3IWC A;  3ZKB A;  4DV5 I;  5AAS A;  2HFU A;  4DPT A;  1NHH A;  4JV5 I;  4Z7Y A;  3AUZ A;  1YYK A;  3WU6 A;  1IBM E;  1WXR A;  4JI8 I;  3WU3 A;  4Z7C A;  4JI3 I;  1IBK E;  4K0K I;  4R03 A;  4JI3 E;  4JI5 I;  2VE7 C;  1WUU A;  1ELO A;  4DV3 E;  2R3V A;  4K0K E;  1N36 I;  2UXB E;  3K6Q A;  2RS6 A;  4AQY I;  4X65 E;  1ZM4 A;  2J7K A;  4AQY E;  1IBL E;  1NHI A;  2MC5 A;  3K85 A;  4OX9 I;  4LF8 I;  2HKE A;  1S4E A;  4JI0 I;  1Z0E A;  4J8Z A;  2KHX A;  2NPF A;  2V89 A;  4KZS A;  4PU9 A;  4JI4 E;  4HAC B;  4DR6 I;  3PYD A;  3B8H A;  2LRS A;  1MG7 A;  1S16 A;  3Q1Q A;  1XMQ E;  2RTX A;  2DIX A;  2FGG A;  5LMU E;  2VF3 A;  1FI4 A;  3LLH A;  2L2N A;  1KIJ A;  2JVA A;  3ADL A;  4KHP E;  2BV3 A;  1XMQ I;  3LNU A;  5T6J A;  4I8O A;  1USU A;  3H09 A;  1HR0 E;  3J81 Q;  4HAC A;  2VQF E;  3LTO A;  1SR9 A;  4URL A;  4GEQ B;  3T1H I;  2HK2 A;  4FWD A;  1PKP A;  3HQ1 A;  5GMD A;  1X48 A;  4JG4 A;  2NUE A;  1HNX I;  4BBY A;  2V8Q B;  4LTY A;  2VQE E;  2RSM A;  3HPS A;  4LFC E;  2AJ4 A;  4FW9 A;  3DJW A;  2NUG A;  4DR2 E;  3QT6 A;  2VF1 A;  4YHH I;  1K47 A;  2UUB E;  4LU9 A;  2V87 A;  4B3S E;  4IZJ B;  4DV3 I;  4DU8 A;  4MYU A;  4R8O A;  1H74 A;  1DAR A;  4UTG A;  4LFA E;  4LF5 I;  2MDR A;  2UUC I;  3T1Y I;  2OI2 A;  4X64 E;  4LF4 E;  1N32 I;  3F6G A;  2XEX A;  1HNZ E;  1Z0G A;  2UU9 E;  1DQ3 A;  4JYA E;  4HY1 A;  5L3J A;  3WU4 A;  2UU9 I;  3C4B A;  2B7V A;  4JI1 E;  4DV4 E;  4LF6 I;  4USM A;  2KON A;  3P1X A;  2DB2 A;  4X62 E;  1H72 C;  4DU7 A;  1EKZ A;  4LF6 E;  4DV0 E;  2HKJ A;  4DV4 I;  4X62 I;  4DR4 E;  3ZKD A;  3DF6 A;  3HXL A;  4KHP I;  1T4L B;  2L3J A;  1Z5B A;  1ZXM A;  1Z5C A;  4DV2 I;  1NHJ A;  2PNL A;  1KTV A;  2VQF I;  2B9D A;  4PRV A;  4USK A;  4DV1 I;  4JI6 I;  2H36 X;  4DKK A;  4L5N C;  4BS9 A;  5FLX C;  1USV A;  4B3T E;  1Y4U A;  4P52 A;  1FKA E;  4M0V A;  2N3G A;  3OTO E;  2UUA E;  3ZM7 A;  4M2Z A;  1J26 A;  1KKH A;  2MC6 A;  5AE2 A;  3B82 A;  4TUG A;  4DMI A;  4JI2 I;  3HPZ A;  4DV6 I;  1GQE A;  4DPY A;  2ZM6 E;  1VIS A;  3F0N A;  4DV6 E;  4EMD A;  1N34 I;  5CFF E;  2V2V A;  4DV7 I;  2L33 A;  1N34 E;  3V2U C;  2V88 A;  1J5E I;  4DR3 I;  2E5L I;  1DI2 A;  3J80 C;  3JAM Q;  2X36 A;  1HK7 A;  4DR3 E;  3V5R A;  3PRY A;  2BM1 A;  4LF5 E;  4LFA I;  5LL6 R;  4F9C B;  2O1T A;  4X64 I;  4LF4 I;  1IBM I;  4GKK E;  4HYM A;  1WHQ A;  4JI8 E;  2L6M A;  2M7Q A;  2LTS A;  4GKK I;  4BC9 A;  4BC7 A;  1FWK A;  3LPS A;  4KQV A;  2EWL A;  4XTJ A;  4FWG A;  2HK3 A;  5GME A;  4LF7 E;  2F4V E;  2V2Z A;  4NXN E;  2Z5C A;  1N0V C;  5FWK A;  2Q2E B;  2L2K B;  5IWA I;  4F9B B;  5IT9 Q;  3VYX A;  4LF8 E;  2LUQ A;  1YZ9 A;  2LBS B;  4JI0 E;  3P06 A;  3B78 A;  2JWO A;  4WUD A;  3K1J A;  2EZ6 A;  3IWB A;  2LUP B;  4DR6 E;  3J7A G;  5LMN E;  1N33 E;  3M6A A;  2LMZ A;  4Q28 A;  2IHR 1;  5LMU I;  1UIL A;  3KWR A;  4B3R I;  3HJC A;  2V34 A;  2LJH A;  3J7A M;  2UXB I;  2E1M A;  1XMO E;  1HNW E;  3QT8 A;  1XNQ E;  4FN5 A;  1Z0B A;  1HNW I;  1Z59 A;  1ZM9 A;  4WFT A;  2V86 A;  3ADI A;  5BR8 E;  3T1H E;  1B62 A;  1EA6 A;  2CG9 A;  4N3O A;  4M1K A;  5A2Q Q;  5BR8 I;  3Q6M A;  3C4T A;  2WW4 A;  4P7D A;  4WYQ B;  1RC7 A;  4IZK B;  2V8P A;  3RMP A;  4ED4 A;  1XNR E;  3VK6 A;  1IBK I;  2CPN A;  1Z0V A;  1A6F A;  3FIG A;  4YY3 E;  1Z0W A;  2O1U A;  1N36 E;  3CWV A;  2B7T A;  1B63 A;  4B3S I;  3JTZ A;  3ZZT A;  4I3H A;  4DR5 E;  4DPX A;  4DUY I;  4B3M I;  2GS8 A;  2ZIT A;  4NXM E;  2O1V A;  4WUB A;  4GKJ E;  4DUY E;  4B3M E;  2UUC E;  2LE2 A;  4GKJ I;  2IOQ A;  2F8B A;  4BMJ A;  2Z5E A;  3J80 Q;  3PYG A;  2B3T B;  1HNZ I;  2O1W A;  3HTX A;  1X47 A;  4LFC I;  2V85 A;  4FWH A;  4OOG C;  4P7A A;  2IOP A;  1OJ4 A;  2DMY A;  4WUC A;  4IZK A;  3Q6N A;  4DXL A;  4JI5 E;  2V83 A;  2WZO A;  2FTX B;  2ODR D;  2UUB I;  3QT7 A;  4B3R E;  3F6H A;  1FJG I;  1PIE A;  4X65 I;  3H4L A;  1MX0 A;  4X66 I;  2ZBK B;  1HR0 I;  1YYO A;  1XMO I;  3MSW A;  2K4V A;  1XNQ I;  4LFB I;  4DR1 E;  5FLX Q;  4JI6 E;  3IWD A;  2DEI A;  2X7I A;  3T1Y E;  3JAM C;  2DEJ A;  1H7S A;  3JU0 A;  1HNX E;  1WHN A;  2N3H A;  2G7H A;  4B3T I;  1QZR A;  4UT4 A;  3LML A;  2VQE I;  4JI7 I;  2UUA I;  1RQ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...