1HR0E

Crystal structure of initiation factor if1 bound to the 30s ribosomal subunit
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of an initiation factor bound to the 30S ribosomal subunit.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 34
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2000-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1hr0E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1hr0E02
1T4LB 1FWKA 2UUAI 1T4NA 3C4BA 2LRSA 2AJ4A 2LTRA 4FW9A 1XMQI 4KHPE 2DEIA 1NHJA 4LF5E 2ZITA 2VF3A 1Z5CA 4YHHE 4LF8E 4UT4A 4DV2E 2YT4A 3V5RA 2UXCE 2LUQA 1B63A 1KIJA 4MYTA 5LMNI 4M30A 1KTVA 5LMUI 1EA6A 2ZM6E 1B62A 3HULA 4JV5I 5LMUE 4DV5I 2J7KA 1H73A 4HACB 1U2RA 3JAMC 3ZZTA 2VQFE 1Z0BA 3LTOA 2UXDI 2VQFI 2NA2A 1S4EA 4HY1A 1N34I 2RSMA 1IBKI 1Z0EA 4DV2I 1N34E 1IBKE 5IWAE 2X7IA 2BV3A 4LFBE 2HKJA 4JI1I 3CWVA 1Z0VA 1UEKA 1N0VC 3ZM7A 4JI1E 4USKA 4DR3I 4DPUA 5LL6R 4WYQB 4HACA 4P52A 1YYOA 4USMA 1STUA 1N0UA 3WU5A 4UTGA 1OJ4A 1J5EE 1ZM4A 2UUBE 2Q2EB 4OOGC 2ZM6I 1I94I 1MX0A 1EI1A 4JI5E 1ZXNA 3B78A 4WUBA 2LJPA 1ELOA 4GKKI 4DU8A 2UXBI 4B3SE 1H7UA 1NZ0A 1YYWA 4DPYA 4DR6E 3PYGA 4YY3I 3WU4A 4NXMI 4DR6I 4AQYE 4JI7E 3J7AM 4NXME 3GONA 4DR2I 1WHQA 2UXCI 4DV4I 4K0KI 3QT5A 3WU6A 2VQEI 2DEJA 1YYKA 4LFBI 2L2NA 2HHHI 4DR4E 2ZBKB 4JV5E 3T1HI 2LUPB 1IBMI 3OTOE 3JAMQ 4DV0I 2BM0A 4XTJA 4DV7E 4DPWA 5BR8E 4DPXA 4Z7YA 4M2ZA 1Z0CA 2E1RA 4PRXA 4KHPI 1O0WA 1X47A 1NHHA 3QT7A 4ZVIA 2V2ZA 4JG4A 4JI3I 4LF7I 3QT6A 4I3HA 1MG7A 2LJHA 4MYUA 4JYAI 1HNWI 3LLHA 4URLA 1ZBTA 4DR3E 5L3JA 1IBME 3OTOI 3ADGA 2JVAA 4B3RI 2IHR1 2E5LI 2V2VA 1PIEA 2UXDE 2KHXA 4ED4A 2LBSB 2E5LE 4K0KE 1VISA 2VQEE 2V8PA 1DI2A 3B82A 5IT9C 1X49A 2UUBI 4DR4I 4JI0I 3B8HA 1UHZA 4DV1E 3T1HE 1FNMA 2CZ9A 1IBLI 4DUZI 4DPTA 4PU9A 3LNUA 2N3GA 3ZZUA 4DUYE 1EKZA 2L2MA 5FLXQ 1Z59A 2NPFA 2R42A 1HR0E 1N32E 3HTXA 5GMEA 2LTSA 1Z5BA 1FI4A 4M1KA 1J5EI 4JI3E 4P7AA 2GS8A 4YHHI 4LF8I 2HHHE 4DV3E 4DR1I 4JI8I 2UXBE 3J81C 1PVGA 4B3RE 2A2DA 3K17A 4DUYI 4LF4E 3J81Q 1Z0GA 4NXNI 2DMYA 2RS6A 4DKKA 3J7Yp 4JI7I 4DR5I 2L2KB 1ZM2A 5A2QC 4LF7E 1HNZE 3J80C 3J7AG 2NUEA 4GKKE 4B3SI 4LFCI 1HNZI 4JI8E 5FLXC 1GQEA 1RC7A 3D4JA 4JI4I 3LPSA 2DIXA 4B3TE 2HFSA 1RQ0A 1KKHA 4AQYI 1FKAE 1HR0I 2WW4A 4NXNE 1HNXI 1X48A 2B7VA 2X36A 1XNRI 4HXZA 4X64I 1XMQE 1I94E 1J26A 4JI6E 1Z5AA 4X62E 5IWAI 3ZKBA 4JI2I 4OX9E 4JI0E 3K1JA 1N36I 1IBLE 2XEXA 4OX9I 1D6TA 1MU5A 4FWDA 4JYAE 1HNWE 1YZ9A 4FWHA 1BKNA 1XHKA 1WUUA 2NUGA 4Z7CA 2F4VE 1N32I 3J80Q 2OI2A 3PYDA 4FWGA 1S16A 1XNRE 2R3VA 3T1YI 4B3MI 4DV3I 1QZRA 4DV4E 2L3JA 4DR1E 4GKJI 1NHIA 3WU3A 2HK3A 4B3TI 3QT8A 4X62I 4JI2E 1Z0TA 4LF6E 1T4OA 4LF4I 2V2QA 4R1FA 4WUCA 4LFAE 4X65E 4DV6E 1XMOI 1N33E 4LF9I 1RREA 1Z0WA 2DB2A 2HFUA 2V34A 1A6FA 4WUDA 4DR2E 1H72C 2BM1A 2EFGA 3ADLA 4KQVA 4PRVA 5A2QQ 2NUFA 5LMNE 4DV1I 2MDRA 1N36E 1DARA 4JI4E 1XNQI 2L33A 4X66E 1ZXMA 1ZM3A 4X8WA 3ZKDA 2A2CA 4X66I 3PYEA 1HNXE 3ADIA 5IT9Q 1K47A 2UUCI 1WHNA 3C4TA 3VYXA 1FJGI 1ZM9A 5CFFE 2RTXA 4GKJE 3ZZ0A 1FJGE 4DR7I 1H74A 4X64E 1RR9A 3VYYA 4EMDA 4LFCE 4JI6I 2EZ6A 3ADJA 1XNQE 4X65I 4LF9E 1QU6A 4WFTA 2HKEA 4RPFA 2F4VI 1N33I 1FWLA 2RS7A 2UUAE 1UILA 4YY3E 4DR5E 4DU7A 4HYMA 4DV7I 2B7TA 4B3ME 2UUCE 2L3CA 4LF5I 2N3HA 3F0NA 2HK2A 2B3TB 3T1YE 1KVKA 3PYFA 4JI5I 4DR7E 3Q1QA 2JY9A 3H4LA 4LFAI 4DUZE 1XMOE 4DV5E 4DV6I 2CPNA 1PKPA 2UU9E 3P1XA 4DV0E 5GMDA 4LF6I 3V2UC 1H7SA 4FN5A 4DXLA 3M6AA 5BR8I 2UU9I
chains in the Genus database with same CATH superfamily
1T4LB 1FWKA 3U1YA 2CG9A 2UUAI 2PNLA 1T4NA 3BF2A 3C4BA 2PO0B 5T6JA 4Q28A 2DLQA 2LRSA 2AJ4A 1TF3A 2PO2A 2DMIA 2LTRA 4BC9A 4IFDF 2YTNA 2C37A 4FW9A 4R8OA 5C0XF 1XMQI 5AC5A 4KHPE 4FW5A 1T38A 2DEIA 2EE8A 2EMZA 1NHJA 4LF5E 2YTJA 4WSGA 2Z5BB 2ZITA 2RPCA 5DNYA 1Z5CA 2VF3A 4YHHE 3BBGA 4LF8E 4UT4A 4DV2E 2YT4A 3V5RA 2UXCE 2LUQA 1B63A 1KIJA 4MYTA 5LMNI 4AM3A 4M30A 1OYRA 1KTVA 5LMUI 1EA6A 2ZM6E 3BIDA 1B62A 2EOSA 2NN6A 3HULA 2EMKA 4JV5I 4LCFA 5LMUE 2EOEA 4DV5I 2WBSA 2JYAA 2YPNA 2J7KA 1H73A 4HACB 1U2RA 3JAMC 2HC5A 3ZZTA 2EMLA 2VQFE 5DNLA 5A6AA 1Z0BA 4OO1A 2EP3A 3LTOA 2UXDI 5JEAE 2VQFI 2NA2A 1BBOA 1S4EA 1EH6A 3QG5C 4IFDB 2V85A 4HY1A 4MU1A 1X6EA 5A6BD 1DQ3A 3M7ND 4KWYA 5JEAB 4R2RA 4LCHA 2EMGA 1N34I 1R6LA 2RSMA 1WJPA 2JOBA 3EPKA 1Z0EA 2C37B 1IBKI 5DROA 4BA1A 4F9AB 2PNMA 4DV2I 1N34E 2YTDA 1IBKE 4BMJA 2M4IA 5IWAE 4AIMA 2EPOA 3AUZA 2X7IA 4IZJA 2BV3A 3M85G 4LFBE 2HKJA 4JI1I 4IJDA 1Z0VA 3CWVA 1UEKA 1N0VC 2NN6B 3P76A 3ZM7A 2ODRD 4O24A 3L00A 3MHHC 2PO1B 4JI1E 2IOPA 2WBUA 4USKA 4DR3I 4DPUA 1E3HA 5LL6R 4BHBA 5LLQA 4WYQB 4R03A 2LCEA 4HACA 4U3BA 2FTXB 2A25A 4P52A 2EMAA 1YYOA 1YHCA 4USMA 1STUA 2NN6E 1MGTA 1N0UA 2EPPA 3WU5A 3C6MA 4UTGA 1OJ4A 1J5EE 1ZM4A 1A1JA 5DNXA 2UUBE 2Q2EB 2G7HA 5KL4A 4OOGC 2ZM6I 1I94I 1MX0A 1SFEA 1P47A 1Y4SA 2EL5A 1A1IA 1UN6B 1EI1A 4JI5E 2EMCA 1ZXNA 5FWKA 3B78A 2WNRB 4MU3A 2EMHA 4GZNC 2IERA 2LJPA 1ELOA 4WUBA 4GKKI 2EN1A 4DU8A 2UXBI 1HK7A 2R1FA 2YTPA 4KZSA 4ZYGA 4B3SE 2C38B 2Z5EA 4FW6A 1H7UA 1NZ0A 1UDQA 3CDJA 4MDTA 3EPJA 1YYWA 2PNZA 1UDNA 4HEIA 4DPYA 5AE1A 2E1MA 5JEAC 4DR6E 4R2AA 3PYGA 2V89A 2EQ0A 4HTGA 2LV2A 3KRNA 4MU4A 3WU4A 2BBGA 4YY3I 5C0XD 3U1KA 4NXMI 4DR6I 4AQYE 5DRRA 4JI7E 3BGHA 3J7AM 5KL7A 4NXME 3GONA 4DR2I 1WHQA 5A6BA 2YU8A 1BBGA 3OMLA 1L4SA 4B3MI 2UXCI 2JOXA 4WPYA 3H1CA 4DV4I 4K0KI 3QT5A 2V8QB 2LVHA 1UDOA 3WU6A 2DEJA 2VQEI 1N3GA 2JE6B 1YUJA 2I13A 5A6JA 4J3DA 2WBTA 3M99B 4TUIA 1YYKA 2YRMA 4LFBI 2L2NA 2YTFA 2HHHI 3VK6A 4DR4E 2ZBKB 4JV5E 3T1HI 2LUPB 2KOUA 1IBMI 2EQ1A 4IFDD 3OTOE 3JAMQ 4DV0I 3IWCA 2WNRA 2BM0A 2O1UA 2GQ0A 4XTJA 4WSPA 4DV7E 4DPWA 5BR8E 3THNA 4DPXA 1USUA 3L7ZA 4Z7YA 4M2ZA 5K36C 1P42A 2EM8A 1Z0CA 2EL6A 4QNKA 2E1RA 1YH8A 4PRXA 4KHPI 1O0WA 1X47A 1AAYA 1NHHA 3QT7A 5C0XB 2EN6A 4ZVIA 5AASA 2DLKA 3HQ1A 3IWBA 2O1WA 2V2ZA 4JG4A 5F3WA 3VHTB 4JI3I 4LF7I 1PJTA 1GZ6A 3QT6A 3THOB 5DRPA 1NEIA 4I3HA 5C0XE 2MKDA 1MG7A 2JWOA 2LJHA 2EMBA 4MYUA 2K4VA 5JEAF 4JYAI 4IZKA 1HNWI 3LLHA 2WP8A 4URLA 1ZBTA 4DR3E 5L3JA 3KZYA 1IBME 2GO3A 3OTOI 3FIGA 3ADGA 2JVAA 2BR2B 4B3RI 2DSYA 2IHR1 2R76A 2E5LI 2V2VA 1PIEA 2JXPA 4FK5C 2UXDE 1X6FA 2EOIA 4OO1F 2EM4A 2KHXA 4ED4A 2LBSB 2E5LE 4RH8A 5JEAD 4K0KE 1VISA 2HGHA 4MLVA 2VQEE 5TSEA 1RHYA 2V8PA 2EM7A 5KL2A 1DI2A 2EPRA 4WXCA 1KJKA 3B82A 5IT9C 2I9IA 3MSWA 2B9DA 4L5NC 4JI4I 1X49A 2UUBI 2L8TA 2MKNA 4JI0I 4DR4I 1UHZA 2EMXA 4DV1E 1IQSA 4F2JC 3T1HE 4R2DA 1FNMA 2CZ9A 4I8OA 4P78A 4LPFA 2YTIA 2YRKA 4DUZI 2YWQA 4NHRA 1UBDC 4DPTA 1ZAAC 4PU9A 2EPMX 2K7IA 3LNUA 3D4JA 2N3GA 4O43A 3ZZUA 4MLQA 4DUYE 2EOJA 1EKZA 4BC7A 3Q6MA 2YSOA 5EKWA 2EOFA 2L2MA 5FLXQ 1Z59A 2NPFA 2EPAA 2EOQA 2R42A 5ELWA 4F6MA 1HR0E 1N32E 4LU9A 3HTXA 2BB8A 5GMEA 2N8XA 2LTSA 4R2PA 1FI4A 1Z5BA 4OO1E 4M1KA 1ZBQA 2GPIA 2GHFA 2J65A 1J5EI 4JI3E 4P7AA 2JP9A 2GS8A 4N4RB 4YHHI 4L8NA 4LF8I 1G2DC 2HHHE 2C39B 1RMDA 2FGGA 4DV3E 4DR1I 2EM2A 4JI8I 2YTQA 1WRJA 4ZYEA 2UXBE 5KL3A 4M0VA 4BA1B 3J81C 1PVGA 4R2QA 2L92A 4B3RE 4WXDA 2A2DA 2FV4B 4IS1C 3K17A 2EN3A 1IQOA 4DUYI 4LF4E 1BB8A 1Y6ZA 3J81Q 1IMUA 1Y4UA 2YSPA 1Z0GA 4NXNI 1XXEA 2EQ3A 2DMYA 2JEBA 2RS6A 2L6MA 2BA0D 2ENAA 2YRHA 2RSIA 2EN7A 4DKKA 3J7Yp 2YZTA 4JI7I 4DR5I 2PO1A 2L2KB 1ZM2A 1X6HA 2AE8A 5A2QC 4R2EA 4LF7E 2HJJA 2VF1A 1HNZE 3J80C 3J7AG 2EPKX 2NUEA 4GKKE 3PS3A 4DMIA 1Y60A 2EMWA 2NABA 4B3SI 1XMOI 4LFCI 1HNZI 1JK1A 4JI8E 5FLXC 4IFDE 3LMLA 1GQEA 2M7QA 4BHCA 1RC7A 1R6MA 2V86A 2BA1G 3ZOQB 2DIXA 2WZOA 3TQMA 4B3TE 2HFSA 1RQ0A 1KKHA 3HKMA 3LPSA 2RQLA 3JTZA 4O4KA 4BBYA 2CVEA 2PO2B 2M1SA 2CGEA 4BS9A 4AQYI 1FKAE 2GO4A 2EMYA 1A1HA 1HR0I 2EPCA 2YTOA 1GTKA 2YTEA 4TUGA 4NXNE 2WW4A 1HNXI 2YTGA 1X48A 2B7VA 1YUIA 5IV8B 2Q8UA 2X36A 1XNRI 4AIDA 4ZYHA 4F54A 4HXZA 5AE2A 1A1LA 1KYQA 5ADZA 2EOOA 2ELZA 2JEBB 3PRYA 3C6KA 4X64I 1XMQE 1JK2A 1NCSA 3K85A 3EQ1A 1I94E 1MEYC 1J26A 3P3EA 4JI6E 1Z5AA 2F1DA 5C0XC 3NZKA 3DJWA 4NZVA 5K36F 4X62E 5IWAI 5A69A 4O5GA 3AV0A 3ZKBA 4JI2I 4OX9E 2JR1A 4JI0E 3K1JA 1N36I 2YU5A 1IBLE 2XEXA 4OX9I 1D6TA 1MU5A 4JYAE 1HNWE 1YZ9A 4FWHA 4FWDA 1BKNA 1XHKA 2ADRA 1WUUA 2EM6A 2NUGA 4Z7CA 2LJUA 2F4VE 1N32I 2M9AA 4J8ZA 3EPLA 3J80Q 2OI2A 4U3DA 5DRQA 5JEAA 3KWRA 2O1TA 3DF6A 3PYDA 4FWGA 2MC5A 1S16A 3ECRA 3MHSC 1XNRE 2R3VA 1E3PA 4MQYA 3T1YI 4IFDC 2MDGA 4DV3I 4F9BB 1QZRA 4DV4E 2L3JA 2Z5CB 4DR1E 1A1KA 2EJ4A 5AE3A 4GKJI 2EORA 2DRPA 1WXRA 2EOYA 3HPZA 2EOXA 3EPHA 4IZJB 5K36A 4P7DA 1NHIA 3WU3A 4ZYDA 2HK3A 2EM0A 1X3CA 4B3TI 4BA2B 3QT8A 4X62I 2NN6F 4JI2E 1T39A 1Z0TA 4LF6E 1PDAA 1T4OA 3P06A 4LF4I 3F6HA 2JPAA 2V2QA 3P3GA 4R1FA 4WUCA 4LFAE 2EN8A 4X65E 4DV6E 2J7JA 3H09A 3UK3C 1A1GA 1SR9A 2EN2A 1N33E 1OYPA 1RREA 1Z0WA 4LF9I 2DB2A 2HFUA 3CDIA 4NBQA 2WP8B 2V34A 1A1FA 4ISAA 2MC6A 4N3OA 3M7NG 2D9HA 3RMPA 4R2CA 1A6FA 2BR2A 4WUDA 3DD6A 1EH8A 4GEQB 4DR2E 1H72C 2BM1A 5K36E 1G2FC 2JEAA 1PJQA 2KONA 2EFGA 3ADLA 4KQVA 4PRVA 2LE2A 5A2QQ 2VRDA 2NUFA 5LMNE 4F9CB 2BA1D 4DV1I 2EOHA 1PJSA 2MDRA 2C38A 2EL4A 3GCMA 3B8HA 3IWDA 3M85D 1N36E 1DARA 2EMFA 4JI4E 4F6NA 1XNQI 2PNZB 2L33A 2Z5CA 3F6GA 4X66E 5A6KA 1ZXMA 2V83A 1ZM3A 4X8WA 3ZKDA 5K36B 2A2CA 1TF6A 4OO1C 4IZJD 1USVA 1EH7A 1IBLI 4X66I 2EM5A 2WCC3 2V88A 5KL5A 2LT7A 3PYEA 4BA2A 2EPZA 1HNXE 1YSAC 2DGCA 1ZU1A 3ADIA 2NN6C 4OKGA 2EN4A 2IESA 3PS1A 1X5WA 2GLIA 5IT9Q 3HXLA 1K47A 2UUCI 1WHNA 3C4TA 1Y5YA 2E72A 3VYXA 1FJGI 1ZM9A 2JE6A 2EPLX 5CFFE 2EOZA 2RTXA 4GKJE 3ZZ0A 1FJGE 1OYSA 2ENCA 4IS9A 1Z1BA 2ELYA 2IOQA 5KL6A 3Q6NA 4QNJA 4DR7I 1QNTA 5K36D 1H74A 4X64E 2VESA 3B4TA 1RR9A 1ZR9A 2LMZA 2JEAB 3VYYA 2EPXA 4WX9A 4EMDA 4LFCE 4JI6I 1B69A 2EZ6A 3ADJA 1VI7A 1XNQE 2NN6D 2EOMA 4X65I 4LF9E 1QU6A 4WFTA 2C39A 2HKEA 4RPFA 2F4VI 1N33I 2H36X 2PO0A 3L7ZB 2EWLA 1FWLA 1TN9A 1F2IG 3KZZA 2PRTA 5EL9A 2RS7A 2UUAE 1UILA 3HJCA 4GQUA 4YY3E 4DR5E 4DU7A 4OO1D 1YPNA 2CTDA 4Q35B 5AC4A 5IXMB 4M9VC 4FW4A 4MU0A 2O3ZA 3GLLA 2Z5BA 4HYMA 5C0XA 3HPSA 4DV7I 2B7TA 2CT1A 4B3ME 2O1VA 3GMEA 3UHMA 2UUCE 2EPUA 2L3CA 1DGCA 4LF5I 3P3CA 2N3HA 3PS2A 3F0NA 2HK2A 2B3TB 4FW7A 3T1YE 2V87A 2EM9A 3JU0A 1KVKA 2LO3A 2F8BA 3PYFA 4JI5I 4OZEA 2JT2A 4DR7E 2BA0G 4IZKB 4LTYA 4LOMA 3Q1QA 4FW3A 2JY9A 1AH5A 2CSHA 3H4LA 2VE7C 4BCAA 4LFAI 4DUZE 1UDSA 1XMOE 4DV5E 4LCGA 1LLMC 4DV6I 2ODRC 2CPNA 4OO1B 2EPNA 1PKPA 2ENHA 3P1XA 3K6QA 2EMIA 4DV0E 2UU9E 5GMDA 2EM3A 1H7SA 3V2UC 4FN5A 4DXLA 4LF6I 3M6AA 4IFDA 1YFHA 5BR8I 4X9JA 2UU9I 4RHBB 4R2SA
chains in the Genus database with same CATH topology
1T4LB 1FWKA 2CG9A 2UUAI 2PNLA 1T4NA 3C4BA 5T6JA 4Q28A 2LRSA 2AJ4A 2LTRA 4BC9A 4FW9A 4R8OA 1XMQI 4KHPE 2DEIA 1NHJA 4LF5E 2Z5BB 2ZITA 5DNYA 1Z5CA 2VF3A 4YHHE 4LF8E 4UT4A 4DV2E 2YT4A 3V5RA 2UXCE 2LUQA 1B63A 1KIJA 4MYTA 5LMNI 4M30A 1KTVA 5LMUI 1EA6A 2ZM6E 1B62A 3HULA 4JV5I 5LMUE 4DV5I 2J7KA 1H73A 4HACB 1U2RA 3JAMC 3ZZTA 2VQFE 1Z0BA 3LTOA 2UXDI 2VQFI 2NA2A 1S4EA 2V85A 4HY1A 1DQ3A 1N34I 2RSMA 2JOBA 1IBKI 1Z0EA 4F9AB 2PNMA 4DV2I 1N34E 1IBKE 4BMJA 2M4IA 5IWAE 3AUZA 2X7IA 4IZJA 2BV3A 4LFBE 2HKJA 4JI1I 3CWVA 1Z0VA 1UEKA 1N0VC 3ZM7A 2ODRD 4JI1E 2IOPA 4USKA 4DR3I 4DPUA 5LL6R 4WYQB 4R03A 4HACA 2FTXB 4P52A 1YYOA 4USMA 1STUA 1N0UA 3WU5A 4UTGA 1OJ4A 1J5EE 1ZM4A 2UUBE 2Q2EB 2G7HA 4OOGC 2ZM6I 1I94I 1MX0A 1Y4SA 5FWKA 1EI1A 4JI5E 1ZXNA 3B78A 4WUBA 2LJPA 1ELOA 4GKKI 4DU8A 2UXBI 1HK7A 4KZSA 4B3SE 2Z5EA 1H7UA 1NZ0A 1YYWA 4DPYA 5AE1A 2E1MA 4DR6E 3PYGA 2V89A 4YY3I 3WU4A 4NXMI 4DR6I 4AQYE 4JI7E 3J7AM 4NXME 3GONA 4DR2I 1WHQA 3OMLA 2UXCI 2JOXA 4WPYA 4DV4I 4K0KI 3QT5A 2V8QB 3WU6A 2VQEI 2DEJA 4TUIA 1YYKA 4LFBI 2L2NA 2HHHI 3VK6A 4DR4E 2ZBKB 4JV5E 3T1HI 2LUPB 2KOUA 1IBMI 3OTOE 3JAMQ 4DV0I 3IWCA 2BM0A 2O1UA 2GQ0A 4XTJA 4WSPA 4DV7E 4DPWA 5BR8E 4DPXA 1USUA 4Z7YA 4M2ZA 1Z0CA 2E1RA 4PRXA 4KHPI 1O0WA 1X47A 1NHHA 3QT7A 4ZVIA 5AASA 3HQ1A 3IWBA 2O1WA 2V2ZA 4JG4A 5F3WA 4JI3I 4LF7I 1GZ6A 3QT6A 4I3HA 1MG7A 2JWOA 2LJHA 4MYUA 2K4VA 4JYAI 4IZKA 1HNWI 3LLHA 4URLA 1ZBTA 4DR3E 5L3JA 1IBME 3OTOI 3FIGA 3ADGA 2JVAA 4B3RI 2DSYA 2IHR1 2E5LI 2V2VA 1PIEA 2UXDE 2KHXA 4ED4A 2LBSB 2E5LE 4K0KE 1VISA 2VQEE 2V8PA 1DI2A 3B82A 5IT9C 3MSWA 2B9DA 4L5NC 1X49A 2UUBI 2L8TA 4DR4I 4JI0I 1UHZA 4DV1E 3T1HE 2CZ9A 1FNMA 3B8HA 4I8OA 4P78A 4DUZI 1IBLI 4DPTA 4PU9A 3LNUA 2N3GA 3ZZUA 4DUYE 1EKZA 4BC7A 3Q6MA 2L2MA 5FLXQ 1Z59A 2NPFA 2R42A 1HR0E 3HTXA 1N32E 4LU9A 5GMEA 2LTSA 1Z5BA 1FI4A 4M1KA 1ZBQA 1J5EI 4JI3E 4P7AA 2GS8A 4YHHI 4L8NA 4LF8I 2HHHE 2FGGA 4DV3E 4DR1I 4JI8I 2UXBE 4M0VA 3J81C 1PVGA 2L92A 4B3RE 2A2DA 2FV4B 3K17A 4DUYI 4LF4E 1Y6ZA 3J81Q 1Y4UA 1Z0GA 4NXNI 2DMYA 2RS6A 2L6MA 4DKKA 3J7Yp 2YZTA 4JI7I 4DR5I 2L2KB 1ZM2A 5A2QC 4LF7E 2VF1A 1HNZE 3J80C 3J7AG 2NUEA 4GKKE 4DMIA 4B3SI 4LFCI 1HNZI 4JI8E 5FLXC 3LMLA 1GQEA 2M7QA 1RC7A 3D4JA 2V86A 4JI4I 3ZOQB 2DIXA 2WZOA 4B3TE 2HFSA 3LPSA 1RQ0A 1KKHA 3JTZA 4BBYA 2M1SA 2CGEA 4BS9A 4AQYI 1FKAE 1HR0I 4TUGA 2WW4A 4NXNE 1HNXI 1X48A 2B7VA 2X36A 1XNRI 4F54A 4HXZA 5AE2A 5ADZA 3PRYA 4X64I 1XMQE 3K85A 1I94E 1J26A 4JI6E 1Z5AA 3DJWA 4X62E 5IWAI 3ZKBA 3AV0A 4JI2I 4OX9E 2JR1A 4JI0E 3K1JA 1N36I 1IBLE 2XEXA 4OX9I 1D6TA 1MU5A 4JYAE 1HNWE 1YZ9A 4FWHA 4FWDA 1BKNA 1XHKA 1WUUA 2NUGA 4Z7CA 2F4VE 1N32I 4J8ZA 3J80Q 2OI2A 3KWRA 2O1TA 3DF6A 3PYDA 4FWGA 2MC5A 1S16A 1XNRE 2R3VA 3T1YI 4B3MI 4DV3I 4F9BB 1QZRA 4DV4E 2L3JA 2Z5CB 4DR1E 5AE3A 4GKJI 1WXRA 3HPZA 4IZJB 4P7DA 1NHIA 3WU3A 2HK3A 4B3TI 3QT8A 4X62I 4JI2E 1Z0TA 4LF6E 1T4OA 3P06A 4LF4I 3F6HA 2V2QA 4R1FA 4WUCA 4LFAE 4X65E 4DV6E 1XMOI 3H09A 1N33E 1SR9A 4LF9I 1RREA 1Z0WA 2DB2A 2HFUA 2V34A 4N3OA 2MC6A 3RMPA 1A6FA 4WUDA 4GEQB 4DR2E 1H72C 2BM1A 2KONA 2EFGA 3ADLA 4KQVA 4PRVA 2LE2A 5A2QQ 2NUFA 5LMNE 4F9CB 4DV1I 2MDRA 3IWDA 1N36E 1DARA 4JI4E 1XNQI 2L33A 2Z5CA 3F6GA 4X66E 1ZXMA 1ZM3A 2V83A 4X8WA 3ZKDA 2A2CA 4IZJD 1USVA 4X66I 2V88A 3PYEA 1HNXE 3ADIA 5IT9Q 3HXLA 1K47A 2UUCI 1WHNA 3C4TA 3VYXA 1FJGI 1ZM9A 5CFFE 2RTXA 4GKJE 3ZZ0A 1FJGE 2IOQA 3Q6NA 4DR7I 1H74A 4X64E 1RR9A 2LMZA 3VYYA 4EMDA 4LFCE 4JI6I 2EZ6A 3ADJA 1XNQE 4X65I 4LF9E 1QU6A 4WFTA 2HKEA 4RPFA 2F4VI 1N33I 2H36X 2EWLA 1FWLA 2RS7A 2UUAE 1UILA 3HJCA 4YY3E 4DR5E 4DU7A 2Z5BA 4HYMA 4DV7I 3HPSA 2B7TA 2O1VA 4B3ME 2UUCE 2L3CA 4LF5I 2N3HA 3F0NA 2HK2A 2B3TB 3T1YE 2V87A 3JU0A 1KVKA 2F8BA 3PYFA 4JI5I 4DR7E 4IZKB 4LTYA 3Q1QA 2JY9A 3H4LA 2VE7C 4BCAA 4LFAI 4DUZE 1XMOE 4DV5E 4DV6I 2ODRC 2CPNA 1PKPA 2UU9E 3P1XA 3K6QA 4DV0E 5GMDA 3V2UC 4LF6I 1H7SA 4FN5A 4DXLA 3M6AA 5BR8I 2UU9I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T4L B;  1FWK A;  2UUA I;  1T4N A;  3C4B A;  2LRS A;  2AJ4 A;  2LTR A;  4FW9 A;  1XMQ I;  4KHP E;  2DEI A;  1NHJ A;  4LF5 E;  2ZIT A;  2VF3 A;  1Z5C A;  4YHH E;  4LF8 E;  4UT4 A;  4DV2 E;  2YT4 A;  3V5R A;  2UXC E;  2LUQ A;  1B63 A;  1KIJ A;  4MYT A;  5LMN I;  4M30 A;  1KTV A;  5LMU I;  1EA6 A;  2ZM6 E;  1B62 A;  3HUL A;  4JV5 I;  5LMU E;  4DV5 I;  2J7K A;  1H73 A;  4HAC B;  1U2R A;  3JAM C;  3ZZT A;  2VQF E;  1Z0B A;  3LTO A;  2UXD I;  2VQF I;  2NA2 A;  1S4E A;  4HY1 A;  1N34 I;  2RSM A;  1IBK I;  1Z0E A;  4DV2 I;  1N34 E;  1IBK E;  5IWA E;  2X7I A;  2BV3 A;  4LFB E;  2HKJ A;  4JI1 I;  3CWV A;  1Z0V A;  1UEK A;  1N0V C;  3ZM7 A;  4JI1 E;  4USK A;  4DR3 I;  4DPU A;  5LL6 R;  4WYQ B;  4HAC A;  4P52 A;  1YYO A;  4USM A;  1STU A;  1N0U A;  3WU5 A;  4UTG A;  1OJ4 A;  1J5E E;  1ZM4 A;  2UUB E;  2Q2E B;  4OOG C;  2ZM6 I;  1I94 I;  1MX0 A;  1EI1 A;  4JI5 E;  1ZXN A;  3B78 A;  4WUB A;  2LJP A;  1ELO A;  4GKK I;  4DU8 A;  2UXB I;  4B3S E;  1H7U A;  1NZ0 A;  1YYW A;  4DPY A;  4DR6 E;  3PYG A;  4YY3 I;  3WU4 A;  4NXM I;  4DR6 I;  4AQY E;  4JI7 E;  3J7A M;  4NXM E;  3GON A;  4DR2 I;  1WHQ A;  2UXC I;  4DV4 I;  4K0K I;  3QT5 A;  3WU6 A;  2VQE I;  2DEJ A;  1YYK A;  4LFB I;  2L2N A;  2HHH I;  4DR4 E;  2ZBK B;  4JV5 E;  3T1H I;  2LUP B;  1IBM I;  3OTO E;  3JAM Q;  4DV0 I;  2BM0 A;  4XTJ A;  4DV7 E;  4DPW A;  5BR8 E;  4DPX A;  4Z7Y A;  4M2Z A;  1Z0C A;  2E1R A;  4PRX A;  4KHP I;  1O0W A;  1X47 A;  1NHH A;  3QT7 A;  4ZVI A;  2V2Z A;  4JG4 A;  4JI3 I;  4LF7 I;  3QT6 A;  4I3H A;  1MG7 A;  2LJH A;  4MYU A;  4JYA I;  1HNW I;  3LLH A;  4URL A;  1ZBT A;  4DR3 E;  5L3J A;  1IBM E;  3OTO I;  3ADG A;  2JVA A;  4B3R I;  2IHR 1;  2E5L I;  2V2V A;  1PIE A;  2UXD E;  2KHX A;  4ED4 A;  2LBS B;  2E5L E;  4K0K E;  1VIS A;  2VQE E;  2V8P A;  1DI2 A;  3B82 A;  5IT9 C;  1X49 A;  2UUB I;  4DR4 I;  4JI0 I;  3B8H A;  1UHZ A;  4DV1 E;  3T1H E;  1FNM A;  2CZ9 A;  1IBL I;  4DUZ I;  4DPT A;  4PU9 A;  3LNU A;  2N3G A;  3ZZU A;  4DUY E;  1EKZ A;  2L2M A;  5FLX Q;  1Z59 A;  2NPF A;  2R42 A;  1HR0 E;  1N32 E;  3HTX A;  5GME A;  2LTS A;  1Z5B A;  1FI4 A;  4M1K A;  1J5E I;  4JI3 E;  4P7A A;  2GS8 A;  4YHH I;  4LF8 I;  2HHH E;  4DV3 E;  4DR1 I;  4JI8 I;  2UXB E;  3J81 C;  1PVG A;  4B3R E;  2A2D A;  3K17 A;  4DUY I;  4LF4 E;  3J81 Q;  1Z0G A;  4NXN I;  2DMY A;  2RS6 A;  4DKK A;  3J7Y p;  4JI7 I;  4DR5 I;  2L2K B;  1ZM2 A;  5A2Q C;  4LF7 E;  1HNZ E;  3J80 C;  3J7A G;  2NUE A;  4GKK E;  4B3S I;  4LFC I;  1HNZ I;  4JI8 E;  5FLX C;  1GQE A;  1RC7 A;  3D4J A;  4JI4 I;  3LPS A;  2DIX A;  4B3T E;  2HFS A;  1RQ0 A;  1KKH A;  4AQY I;  1FKA E;  1HR0 I;  2WW4 A;  4NXN E;  1HNX I;  1X48 A;  2B7V A;  2X36 A;  1XNR I;  4HXZ A;  4X64 I;  1XMQ E;  1I94 E;  1J26 A;  4JI6 E;  1Z5A A;  4X62 E;  5IWA I;  3ZKB A;  4JI2 I;  4OX9 E;  4JI0 E;  3K1J A;  1N36 I;  1IBL E;  2XEX A;  4OX9 I;  1D6T A;  1MU5 A;  4FWD A;  4JYA E;  1HNW E;  1YZ9 A;  4FWH A;  1BKN A;  1XHK A;  1WUU A;  2NUG A;  4Z7C A;  2F4V E;  1N32 I;  3J80 Q;  2OI2 A;  3PYD A;  4FWG A;  1S16 A;  1XNR E;  2R3V A;  3T1Y I;  4B3M I;  4DV3 I;  1QZR A;  4DV4 E;  2L3J A;  4DR1 E;  4GKJ I;  1NHI A;  3WU3 A;  2HK3 A;  4B3T I;  3QT8 A;  4X62 I;  4JI2 E;  1Z0T A;  4LF6 E;  1T4O A;  4LF4 I;  2V2Q A;  4R1F A;  4WUC A;  4LFA E;  4X65 E;  4DV6 E;  1XMO I;  1N33 E;  4LF9 I;  1RRE A;  1Z0W A;  2DB2 A;  2HFU A;  2V34 A;  1A6F A;  4WUD A;  4DR2 E;  1H72 C;  2BM1 A;  2EFG A;  3ADL A;  4KQV A;  4PRV A;  5A2Q Q;  2NUF A;  5LMN E;  4DV1 I;  2MDR A;  1N36 E;  1DAR A;  4JI4 E;  1XNQ I;  2L33 A;  4X66 E;  1ZXM A;  1ZM3 A;  4X8W A;  3ZKD A;  2A2C A;  4X66 I;  3PYE A;  1HNX E;  3ADI A;  5IT9 Q;  1K47 A;  2UUC I;  1WHN A;  3C4T A;  3VYX A;  1FJG I;  1ZM9 A;  5CFF E;  2RTX A;  4GKJ E;  3ZZ0 A;  1FJG E;  4DR7 I;  1H74 A;  4X64 E;  1RR9 A;  3VYY A;  4EMD A;  4LFC E;  4JI6 I;  2EZ6 A;  3ADJ A;  1XNQ E;  4X65 I;  4LF9 E;  1QU6 A;  4WFT A;  2HKE A;  4RPF A;  2F4V I;  1N33 I;  1FWL A;  2RS7 A;  2UUA E;  1UIL A;  4YY3 E;  4DR5 E;  4DU7 A;  4HYM A;  4DV7 I;  2B7T A;  4B3M E;  2UUC E;  2L3C A;  4LF5 I;  2N3H A;  3F0N A;  2HK2 A;  2B3T B;  3T1Y E;  1KVK A;  3PYF A;  4JI5 I;  4DR7 E;  3Q1Q A;  2JY9 A;  3H4L A;  4LFA I;  4DUZ E;  1XMO E;  4DV5 E;  4DV6 I;  2CPN A;  1PKP A;  2UU9 E;  3P1X A;  4DV0 E;  5GMD A;  4LF6 I;  3V2U C;  1H7S A;  4FN5 A;  4DXL A;  3M6A A;  5BR8 I;  2UU9 I; 
#chains in the Genus database with same CATH topology
 1T4L B;  1FWK A;  3U1Y A;  2CG9 A;  2UUA I;  2PNL A;  1T4N A;  3BF2 A;  3C4B A;  2PO0 B;  5T6J A;  4Q28 A;  2DLQ A;  2LRS A;  2AJ4 A;  1TF3 A;  2PO2 A;  2DMI A;  2LTR A;  4BC9 A;  4IFD F;  2YTN A;  2C37 A;  4FW9 A;  4R8O A;  5C0X F;  1XMQ I;  5AC5 A;  4KHP E;  4FW5 A;  1T38 A;  2DEI A;  2EE8 A;  2EMZ A;  1NHJ A;  4LF5 E;  2YTJ A;  4WSG A;  2Z5B B;  2ZIT A;  2RPC A;  5DNY A;  1Z5C A;  2VF3 A;  4YHH E;  3BBG A;  4LF8 E;  4UT4 A;  4DV2 E;  2YT4 A;  3V5R A;  2UXC E;  2LUQ A;  1B63 A;  1KIJ A;  4MYT A;  5LMN I;  4AM3 A;  4M30 A;  1OYR A;  1KTV A;  5LMU I;  1EA6 A;  2ZM6 E;  3BID A;  1B62 A;  2EOS A;  2NN6 A;  3HUL A;  2EMK A;  4JV5 I;  4LCF A;  5LMU E;  2EOE A;  4DV5 I;  2WBS A;  2JYA A;  2YPN A;  2J7K A;  1H73 A;  4HAC B;  1U2R A;  3JAM C;  2HC5 A;  3ZZT A;  2EML A;  2VQF E;  5DNL A;  5A6A A;  1Z0B A;  4OO1 A;  2EP3 A;  3LTO A;  2UXD I;  5JEA E;  2VQF I;  2NA2 A;  1BBO A;  1S4E A;  1EH6 A;  3QG5 C;  4IFD B;  2V85 A;  4HY1 A;  4MU1 A;  1X6E A;  5A6B D;  1DQ3 A;  3M7N D;  4KWY A;  5JEA B;  4R2R A;  4LCH A;  2EMG A;  1N34 I;  1R6L A;  2RSM A;  1WJP A;  2JOB A;  3EPK A;  1Z0E A;  2C37 B;  1IBK I;  5DRO A;  4BA1 A;  4F9A B;  2PNM A;  4DV2 I;  1N34 E;  2YTD A;  1IBK E;  4BMJ A;  2M4I A;  5IWA E;  4AIM A;  2EPO A;  3AUZ A;  2X7I A;  4IZJ A;  2BV3 A;  3M85 G;  4LFB E;  2HKJ A;  4JI1 I;  4IJD A;  1Z0V A;  3CWV A;  1UEK A;  1N0V C;  2NN6 B;  3P76 A;  3ZM7 A;  2ODR D;  4O24 A;  3L00 A;  3MHH C;  2PO1 B;  4JI1 E;  2IOP A;  2WBU A;  4USK A;  4DR3 I;  4DPU A;  1E3H A;  5LL6 R;  4BHB A;  5LLQ A;  4WYQ B;  4R03 A;  2LCE A;  4HAC A;  4U3B A;  2FTX B;  2A25 A;  4P52 A;  2EMA A;  1YYO A;  1YHC A;  4USM A;  1STU A;  2NN6 E;  1MGT A;  1N0U A;  2EPP A;  3WU5 A;  3C6M A;  4UTG A;  1OJ4 A;  1J5E E;  1ZM4 A;  1A1J A;  5DNX A;  2UUB E;  2Q2E B;  2G7H A;  5KL4 A;  4OOG C;  2ZM6 I;  1I94 I;  1MX0 A;  1SFE A;  1P47 A;  1Y4S A;  2EL5 A;  1A1I A;  1UN6 B;  1EI1 A;  4JI5 E;  2EMC A;  1ZXN A;  5FWK A;  3B78 A;  2WNR B;  4MU3 A;  2EMH A;  4GZN C;  2IER A;  2LJP A;  1ELO A;  4WUB A;  4GKK I;  2EN1 A;  4DU8 A;  2UXB I;  1HK7 A;  2R1F A;  2YTP A;  4KZS A;  4ZYG A;  4B3S E;  2C38 B;  2Z5E A;  4FW6 A;  1H7U A;  1NZ0 A;  1UDQ A;  3CDJ A;  4MDT A;  3EPJ A;  1YYW A;  2PNZ A;  1UDN A;  4HEI A;  4DPY A;  5AE1 A;  2E1M A;  5JEA C;  4DR6 E;  4R2A A;  3PYG A;  2V89 A;  2EQ0 A;  4HTG A;  2LV2 A;  3KRN A;  4MU4 A;  3WU4 A;  2BBG A;  4YY3 I;  5C0X D;  3U1K A;  4NXM I;  4DR6 I;  4AQY E;  5DRR A;  4JI7 E;  3BGH A;  3J7A M;  5KL7 A;  4NXM E;  3GON A;  4DR2 I;  1WHQ A;  5A6B A;  2YU8 A;  1BBG A;  3OML A;  1L4S A;  4B3M I;  2UXC I;  2JOX A;  4WPY A;  3H1C A;  4DV4 I;  4K0K I;  3QT5 A;  2V8Q B;  2LVH A;  1UDO A;  3WU6 A;  2DEJ A;  2VQE I;  1N3G A;  2JE6 B;  1YUJ A;  2I13 A;  5A6J A;  4J3D A;  2WBT A;  3M99 B;  4TUI A;  1YYK A;  2YRM A;  4LFB I;  2L2N A;  2YTF A;  2HHH I;  3VK6 A;  4DR4 E;  2ZBK B;  4JV5 E;  3T1H I;  2LUP B;  2KOU A;  1IBM I;  2EQ1 A;  4IFD D;  3OTO E;  3JAM Q;  4DV0 I;  3IWC A;  2WNR A;  2BM0 A;  2O1U A;  2GQ0 A;  4XTJ A;  4WSP A;  4DV7 E;  4DPW A;  5BR8 E;  3THN A;  4DPX A;  1USU A;  3L7Z A;  4Z7Y A;  4M2Z A;  5K36 C;  1P42 A;  2EM8 A;  1Z0C A;  2EL6 A;  4QNK A;  2E1R A;  1YH8 A;  4PRX A;  4KHP I;  1O0W A;  1X47 A;  1AAY A;  1NHH A;  3QT7 A;  5C0X B;  2EN6 A;  4ZVI A;  5AAS A;  2DLK A;  3HQ1 A;  3IWB A;  2O1W A;  2V2Z A;  4JG4 A;  5F3W A;  3VHT B;  4JI3 I;  4LF7 I;  1PJT A;  1GZ6 A;  3QT6 A;  3THO B;  5DRP A;  1NEI A;  4I3H A;  5C0X E;  2MKD A;  1MG7 A;  2JWO A;  2LJH A;  2EMB A;  4MYU A;  2K4V A;  5JEA F;  4JYA I;  4IZK A;  1HNW I;  3LLH A;  2WP8 A;  4URL A;  1ZBT A;  4DR3 E;  5L3J A;  3KZY A;  1IBM E;  2GO3 A;  3OTO I;  3FIG A;  3ADG A;  2JVA A;  2BR2 B;  4B3R I;  2DSY A;  2IHR 1;  2R76 A;  2E5L I;  2V2V A;  1PIE A;  2JXP A;  4FK5 C;  2UXD E;  1X6F A;  2EOI A;  4OO1 F;  2EM4 A;  2KHX A;  4ED4 A;  2LBS B;  2E5L E;  4RH8 A;  5JEA D;  4K0K E;  1VIS A;  2HGH A;  4MLV A;  2VQE E;  5TSE A;  1RHY A;  2V8P A;  2EM7 A;  5KL2 A;  1DI2 A;  2EPR A;  4WXC A;  1KJK A;  3B82 A;  5IT9 C;  2I9I A;  3MSW A;  2B9D A;  4L5N C;  4JI4 I;  1X49 A;  2UUB I;  2L8T A;  2MKN A;  4JI0 I;  4DR4 I;  1UHZ A;  2EMX A;  4DV1 E;  1IQS A;  4F2J C;  3T1H E;  4R2D A;  1FNM A;  2CZ9 A;  4I8O A;  4P78 A;  4LPF A;  2YTI A;  2YRK A;  4DUZ I;  2YWQ A;  4NHR A;  1UBD C;  4DPT A;  1ZAA C;  4PU9 A;  2EPM X;  2K7I A;  3LNU A;  3D4J A;  2N3G A;  4O43 A;  3ZZU A;  4MLQ A;  4DUY E;  2EOJ A;  1EKZ A;  4BC7 A;  3Q6M A;  2YSO A;  5EKW A;  2EOF A;  2L2M A;  5FLX Q;  1Z59 A;  2NPF A;  2EPA A;  2EOQ A;  2R42 A;  5ELW A;  4F6M A;  1HR0 E;  1N32 E;  4LU9 A;  3HTX A;  2BB8 A;  5GME A;  2N8X A;  2LTS A;  4R2P A;  1FI4 A;  1Z5B A;  4OO1 E;  4M1K A;  1ZBQ A;  2GPI A;  2GHF A;  2J65 A;  1J5E I;  4JI3 E;  4P7A A;  2JP9 A;  2GS8 A;  4N4R B;  4YHH I;  4L8N A;  4LF8 I;  1G2D C;  2HHH E;  2C39 B;  1RMD A;  2FGG A;  4DV3 E;  4DR1 I;  2EM2 A;  4JI8 I;  2YTQ A;  1WRJ A;  4ZYE A;  2UXB E;  5KL3 A;  4M0V A;  4BA1 B;  3J81 C;  1PVG A;  4R2Q A;  2L92 A;  4B3R E;  4WXD A;  2A2D A;  2FV4 B;  4IS1 C;  3K17 A;  2EN3 A;  1IQO A;  4DUY I;  4LF4 E;  1BB8 A;  1Y6Z A;  3J81 Q;  1IMU A;  1Y4U A;  2YSP A;  1Z0G A;  4NXN I;  1XXE A;  2EQ3 A;  2DMY A;  2JEB A;  2RS6 A;  2L6M A;  2BA0 D;  2ENA A;  2YRH A;  2RSI A;  2EN7 A;  4DKK A;  3J7Y p;  2YZT A;  4JI7 I;  4DR5 I;  2PO1 A;  2L2K B;  1ZM2 A;  1X6H A;  2AE8 A;  5A2Q C;  4R2E A;  4LF7 E;  2HJJ A;  2VF1 A;  1HNZ E;  3J80 C;  3J7A G;  2EPK X;  2NUE A;  4GKK E;  3PS3 A;  4DMI A;  1Y60 A;  2EMW A;  2NAB A;  4B3S I;  1XMO I;  4LFC I;  1HNZ I;  1JK1 A;  4JI8 E;  5FLX C;  4IFD E;  3LML A;  1GQE A;  2M7Q A;  4BHC A;  1RC7 A;  1R6M A;  2V86 A;  2BA1 G;  3ZOQ B;  2DIX A;  2WZO A;  3TQM A;  4B3T E;  2HFS A;  1RQ0 A;  1KKH A;  3HKM A;  3LPS A;  2RQL A;  3JTZ A;  4O4K A;  4BBY A;  2CVE A;  2PO2 B;  2M1S A;  2CGE A;  4BS9 A;  4AQY I;  1FKA E;  2GO4 A;  2EMY A;  1A1H A;  1HR0 I;  2EPC A;  2YTO A;  1GTK A;  2YTE A;  4TUG A;  4NXN E;  2WW4 A;  1HNX I;  2YTG A;  1X48 A;  2B7V A;  1YUI A;  5IV8 B;  2Q8U A;  2X36 A;  1XNR I;  4AID A;  4ZYH A;  4F54 A;  4HXZ A;  5AE2 A;  1A1L A;  1KYQ A;  5ADZ A;  2EOO A;  2ELZ A;  2JEB B;  3PRY A;  3C6K A;  4X64 I;  1XMQ E;  1JK2 A;  1NCS A;  3K85 A;  3EQ1 A;  1I94 E;  1MEY C;  1J26 A;  3P3E A;  4JI6 E;  1Z5A A;  2F1D A;  5C0X C;  3NZK A;  3DJW A;  4NZV A;  5K36 F;  4X62 E;  5IWA I;  5A69 A;  4O5G A;  3AV0 A;  3ZKB A;  4JI2 I;  4OX9 E;  2JR1 A;  4JI0 E;  3K1J A;  1N36 I;  2YU5 A;  1IBL E;  2XEX A;  4OX9 I;  1D6T A;  1MU5 A;  4JYA E;  1HNW E;  1YZ9 A;  4FWH A;  4FWD A;  1BKN A;  1XHK A;  2ADR A;  1WUU A;  2EM6 A;  2NUG A;  4Z7C A;  2LJU A;  2F4V E;  1N32 I;  2M9A A;  4J8Z A;  3EPL A;  3J80 Q;  2OI2 A;  4U3D A;  5DRQ A;  5JEA A;  3KWR A;  2O1T A;  3DF6 A;  3PYD A;  4FWG A;  2MC5 A;  1S16 A;  3ECR A;  3MHS C;  1XNR E;  2R3V A;  1E3P A;  4MQY A;  3T1Y I;  4IFD C;  2MDG A;  4DV3 I;  4F9B B;  1QZR A;  4DV4 E;  2L3J A;  2Z5C B;  4DR1 E;  1A1K A;  2EJ4 A;  5AE3 A;  4GKJ I;  2EOR A;  2DRP A;  1WXR A;  2EOY A;  3HPZ A;  2EOX A;  3EPH A;  4IZJ B;  5K36 A;  4P7D A;  1NHI A;  3WU3 A;  4ZYD A;  2HK3 A;  2EM0 A;  1X3C A;  4B3T I;  4BA2 B;  3QT8 A;  4X62 I;  2NN6 F;  4JI2 E;  1T39 A;  1Z0T A;  4LF6 E;  1PDA A;  1T4O A;  3P06 A;  4LF4 I;  3F6H A;  2JPA A;  2V2Q A;  3P3G A;  4R1F A;  4WUC A;  4LFA E;  2EN8 A;  4X65 E;  4DV6 E;  2J7J A;  3H09 A;  3UK3 C;  1A1G A;  1SR9 A;  2EN2 A;  1N33 E;  1OYP A;  1RRE A;  1Z0W A;  4LF9 I;  2DB2 A;  2HFU A;  3CDI A;  4NBQ A;  2WP8 B;  2V34 A;  1A1F A;  4ISA A;  2MC6 A;  4N3O A;  3M7N G;  2D9H A;  3RMP A;  4R2C A;  1A6F A;  2BR2 A;  4WUD A;  3DD6 A;  1EH8 A;  4GEQ B;  4DR2 E;  1H72 C;  2BM1 A;  5K36 E;  1G2F C;  2JEA A;  1PJQ A;  2KON A;  2EFG A;  3ADL A;  4KQV A;  4PRV A;  2LE2 A;  5A2Q Q;  2VRD A;  2NUF A;  5LMN E;  4F9C B;  2BA1 D;  4DV1 I;  2EOH A;  1PJS A;  2MDR A;  2C38 A;  2EL4 A;  3GCM A;  3B8H A;  3IWD A;  3M85 D;  1N36 E;  1DAR A;  2EMF A;  4JI4 E;  4F6N A;  1XNQ I;  2PNZ B;  2L33 A;  2Z5C A;  3F6G A;  4X66 E;  5A6K A;  1ZXM A;  2V83 A;  1ZM3 A;  4X8W A;  3ZKD A;  5K36 B;  2A2C A;  1TF6 A;  4OO1 C;  4IZJ D;  1USV A;  1EH7 A;  1IBL I;  4X66 I;  2EM5 A;  2WCC 3;  2V88 A;  5KL5 A;  2LT7 A;  3PYE A;  4BA2 A;  2EPZ A;  1HNX E;  1YSA C;  2DGC A;  1ZU1 A;  3ADI A;  2NN6 C;  4OKG A;  2EN4 A;  2IES A;  3PS1 A;  1X5W A;  2GLI A;  5IT9 Q;  3HXL A;  1K47 A;  2UUC I;  1WHN A;  3C4T A;  1Y5Y A;  2E72 A;  3VYX A;  1FJG I;  1ZM9 A;  2JE6 A;  2EPL X;  5CFF E;  2EOZ A;  2RTX A;  4GKJ E;  3ZZ0 A;  1FJG E;  1OYS A;  2ENC A;  4IS9 A;  1Z1B A;  2ELY A;  2IOQ A;  5KL6 A;  3Q6N A;  4QNJ A;  4DR7 I;  1QNT A;  5K36 D;  1H74 A;  4X64 E;  2VES A;  3B4T A;  1RR9 A;  1ZR9 A;  2LMZ A;  2JEA B;  3VYY A;  2EPX A;  4WX9 A;  4EMD A;  4LFC E;  4JI6 I;  1B69 A;  2EZ6 A;  3ADJ A;  1VI7 A;  1XNQ E;  2NN6 D;  2EOM A;  4X65 I;  4LF9 E;  1QU6 A;  4WFT A;  2C39 A;  2HKE A;  4RPF A;  2F4V I;  1N33 I;  2H36 X;  2PO0 A;  3L7Z B;  2EWL A;  1FWL A;  1TN9 A;  1F2I G;  3KZZ A;  2PRT A;  5EL9 A;  2RS7 A;  2UUA E;  1UIL A;  3HJC A;  4GQU A;  4YY3 E;  4DR5 E;  4DU7 A;  4OO1 D;  1YPN A;  2CTD A;  4Q35 B;  5AC4 A;  5IXM B;  4M9V C;  4FW4 A;  4MU0 A;  2O3Z A;  3GLL A;  2Z5B A;  4HYM A;  5C0X A;  3HPS A;  4DV7 I;  2B7T A;  2CT1 A;  4B3M E;  2O1V A;  3GME A;  3UHM A;  2UUC E;  2EPU A;  2L3C A;  1DGC A;  4LF5 I;  3P3C A;  2N3H A;  3PS2 A;  3F0N A;  2HK2 A;  2B3T B;  4FW7 A;  3T1Y E;  2V87 A;  2EM9 A;  3JU0 A;  1KVK A;  2LO3 A;  2F8B A;  3PYF A;  4JI5 I;  4OZE A;  2JT2 A;  4DR7 E;  2BA0 G;  4IZK B;  4LTY A;  4LOM A;  3Q1Q A;  4FW3 A;  2JY9 A;  1AH5 A;  2CSH A;  3H4L A;  2VE7 C;  4BCA A;  4LFA I;  4DUZ E;  1UDS A;  1XMO E;  4DV5 E;  4LCG A;  1LLM C;  4DV6 I;  2ODR C;  2CPN A;  4OO1 B;  2EPN A;  1PKP A;  2ENH A;  3P1X A;  3K6Q A;  2EMI A;  4DV0 E;  2UU9 E;  5GMD A;  2EM3 A;  1H7S A;  3V2U C;  4FN5 A;  4DXL A;  4LF6 I;  3M6A A;  4IFD A;  1YFH A;  5BR8 I;  4X9J A;  2UU9 I;  4RHB B;  4R2S A; 
#chains in the Genus database with same CATH homology
 1T4L B;  1FWK A;  2CG9 A;  2UUA I;  2PNL A;  1T4N A;  3C4B A;  5T6J A;  4Q28 A;  2LRS A;  2AJ4 A;  2LTR A;  4BC9 A;  4FW9 A;  4R8O A;  1XMQ I;  4KHP E;  2DEI A;  1NHJ A;  4LF5 E;  2Z5B B;  2ZIT A;  5DNY A;  1Z5C A;  2VF3 A;  4YHH E;  4LF8 E;  4UT4 A;  4DV2 E;  2YT4 A;  3V5R A;  2UXC E;  2LUQ A;  1B63 A;  1KIJ A;  4MYT A;  5LMN I;  4M30 A;  1KTV A;  5LMU I;  1EA6 A;  2ZM6 E;  1B62 A;  3HUL A;  4JV5 I;  5LMU E;  4DV5 I;  2J7K A;  1H73 A;  4HAC B;  1U2R A;  3JAM C;  3ZZT A;  2VQF E;  1Z0B A;  3LTO A;  2UXD I;  2VQF I;  2NA2 A;  1S4E A;  2V85 A;  4HY1 A;  1DQ3 A;  1N34 I;  2RSM A;  2JOB A;  1IBK I;  1Z0E A;  4F9A B;  2PNM A;  4DV2 I;  1N34 E;  1IBK E;  4BMJ A;  2M4I A;  5IWA E;  3AUZ A;  2X7I A;  4IZJ A;  2BV3 A;  4LFB E;  2HKJ A;  4JI1 I;  3CWV A;  1Z0V A;  1UEK A;  1N0V C;  3ZM7 A;  2ODR D;  4JI1 E;  2IOP A;  4USK A;  4DR3 I;  4DPU A;  5LL6 R;  4WYQ B;  4R03 A;  4HAC A;  2FTX B;  4P52 A;  1YYO A;  4USM A;  1STU A;  1N0U A;  3WU5 A;  4UTG A;  1OJ4 A;  1J5E E;  1ZM4 A;  2UUB E;  2Q2E B;  2G7H A;  4OOG C;  2ZM6 I;  1I94 I;  1MX0 A;  1Y4S A;  5FWK A;  1EI1 A;  4JI5 E;  1ZXN A;  3B78 A;  4WUB A;  2LJP A;  1ELO A;  4GKK I;  4DU8 A;  2UXB I;  1HK7 A;  4KZS A;  4B3S E;  2Z5E A;  1H7U A;  1NZ0 A;  1YYW A;  4DPY A;  5AE1 A;  2E1M A;  4DR6 E;  3PYG A;  2V89 A;  4YY3 I;  3WU4 A;  4NXM I;  4DR6 I;  4AQY E;  4JI7 E;  3J7A M;  4NXM E;  3GON A;  4DR2 I;  1WHQ A;  3OML A;  2UXC I;  2JOX A;  4WPY A;  4DV4 I;  4K0K I;  3QT5 A;  2V8Q B;  3WU6 A;  2VQE I;  2DEJ A;  4TUI A;  1YYK A;  4LFB I;  2L2N A;  2HHH I;  3VK6 A;  4DR4 E;  2ZBK B;  4JV5 E;  3T1H I;  2LUP B;  2KOU A;  1IBM I;  3OTO E;  3JAM Q;  4DV0 I;  3IWC A;  2BM0 A;  2O1U A;  2GQ0 A;  4XTJ A;  4WSP A;  4DV7 E;  4DPW A;  5BR8 E;  4DPX A;  1USU A;  4Z7Y A;  4M2Z A;  1Z0C A;  2E1R A;  4PRX A;  4KHP I;  1O0W A;  1X47 A;  1NHH A;  3QT7 A;  4ZVI A;  5AAS A;  3HQ1 A;  3IWB A;  2O1W A;  2V2Z A;  4JG4 A;  5F3W A;  4JI3 I;  4LF7 I;  1GZ6 A;  3QT6 A;  4I3H A;  1MG7 A;  2JWO A;  2LJH A;  4MYU A;  2K4V A;  4JYA I;  4IZK A;  1HNW I;  3LLH A;  4URL A;  1ZBT A;  4DR3 E;  5L3J A;  1IBM E;  3OTO I;  3FIG A;  3ADG A;  2JVA A;  4B3R I;  2DSY A;  2IHR 1;  2E5L I;  2V2V A;  1PIE A;  2UXD E;  2KHX A;  4ED4 A;  2LBS B;  2E5L E;  4K0K E;  1VIS A;  2VQE E;  2V8P A;  1DI2 A;  3B82 A;  5IT9 C;  3MSW A;  2B9D A;  4L5N C;  1X49 A;  2UUB I;  2L8T A;  4DR4 I;  4JI0 I;  1UHZ A;  4DV1 E;  3T1H E;  2CZ9 A;  1FNM A;  3B8H A;  4I8O A;  4P78 A;  4DUZ I;  1IBL I;  4DPT A;  4PU9 A;  3LNU A;  2N3G A;  3ZZU A;  4DUY E;  1EKZ A;  4BC7 A;  3Q6M A;  2L2M A;  5FLX Q;  1Z59 A;  2NPF A;  2R42 A;  1HR0 E;  3HTX A;  1N32 E;  4LU9 A;  5GME A;  2LTS A;  1Z5B A;  1FI4 A;  4M1K A;  1ZBQ A;  1J5E I;  4JI3 E;  4P7A A;  2GS8 A;  4YHH I;  4L8N A;  4LF8 I;  2HHH E;  2FGG A;  4DV3 E;  4DR1 I;  4JI8 I;  2UXB E;  4M0V A;  3J81 C;  1PVG A;  2L92 A;  4B3R E;  2A2D A;  2FV4 B;  3K17 A;  4DUY I;  4LF4 E;  1Y6Z A;  3J81 Q;  1Y4U A;  1Z0G A;  4NXN I;  2DMY A;  2RS6 A;  2L6M A;  4DKK A;  3J7Y p;  2YZT A;  4JI7 I;  4DR5 I;  2L2K B;  1ZM2 A;  5A2Q C;  4LF7 E;  2VF1 A;  1HNZ E;  3J80 C;  3J7A G;  2NUE A;  4GKK E;  4DMI A;  4B3S I;  4LFC I;  1HNZ I;  4JI8 E;  5FLX C;  3LML A;  1GQE A;  2M7Q A;  1RC7 A;  3D4J A;  2V86 A;  4JI4 I;  3ZOQ B;  2DIX A;  2WZO A;  4B3T E;  2HFS A;  3LPS A;  1RQ0 A;  1KKH A;  3JTZ A;  4BBY A;  2M1S A;  2CGE A;  4BS9 A;  4AQY I;  1FKA E;  1HR0 I;  4TUG A;  2WW4 A;  4NXN E;  1HNX I;  1X48 A;  2B7V A;  2X36 A;  1XNR I;  4F54 A;  4HXZ A;  5AE2 A;  5ADZ A;  3PRY A;  4X64 I;  1XMQ E;  3K85 A;  1I94 E;  1J26 A;  4JI6 E;  1Z5A A;  3DJW A;  4X62 E;  5IWA I;  3ZKB A;  3AV0 A;  4JI2 I;  4OX9 E;  2JR1 A;  4JI0 E;  3K1J A;  1N36 I;  1IBL E;  2XEX A;  4OX9 I;  1D6T A;  1MU5 A;  4JYA E;  1HNW E;  1YZ9 A;  4FWH A;  4FWD A;  1BKN A;  1XHK A;  1WUU A;  2NUG A;  4Z7C A;  2F4V E;  1N32 I;  4J8Z A;  3J80 Q;  2OI2 A;  3KWR A;  2O1T A;  3DF6 A;  3PYD A;  4FWG A;  2MC5 A;  1S16 A;  1XNR E;  2R3V A;  3T1Y I;  4B3M I;  4DV3 I;  4F9B B;  1QZR A;  4DV4 E;  2L3J A;  2Z5C B;  4DR1 E;  5AE3 A;  4GKJ I;  1WXR A;  3HPZ A;  4IZJ B;  4P7D A;  1NHI A;  3WU3 A;  2HK3 A;  4B3T I;  3QT8 A;  4X62 I;  4JI2 E;  1Z0T A;  4LF6 E;  1T4O A;  3P06 A;  4LF4 I;  3F6H A;  2V2Q A;  4R1F A;  4WUC A;  4LFA E;  4X65 E;  4DV6 E;  1XMO I;  3H09 A;  1N33 E;  1SR9 A;  4LF9 I;  1RRE A;  1Z0W A;  2DB2 A;  2HFU A;  2V34 A;  4N3O A;  2MC6 A;  3RMP A;  1A6F A;  4WUD A;  4GEQ B;  4DR2 E;  1H72 C;  2BM1 A;  2KON A;  2EFG A;  3ADL A;  4KQV A;  4PRV A;  2LE2 A;  5A2Q Q;  2NUF A;  5LMN E;  4F9C B;  4DV1 I;  2MDR A;  3IWD A;  1N36 E;  1DAR A;  4JI4 E;  1XNQ I;  2L33 A;  2Z5C A;  3F6G A;  4X66 E;  1ZXM A;  1ZM3 A;  2V83 A;  4X8W A;  3ZKD A;  2A2C A;  4IZJ D;  1USV A;  4X66 I;  2V88 A;  3PYE A;  1HNX E;  3ADI A;  5IT9 Q;  3HXL A;  1K47 A;  2UUC I;  1WHN A;  3C4T A;  3VYX A;  1FJG I;  1ZM9 A;  5CFF E;  2RTX A;  4GKJ E;  3ZZ0 A;  1FJG E;  2IOQ A;  3Q6N A;  4DR7 I;  1H74 A;  4X64 E;  1RR9 A;  2LMZ A;  3VYY A;  4EMD A;  4LFC E;  4JI6 I;  2EZ6 A;  3ADJ A;  1XNQ E;  4X65 I;  4LF9 E;  1QU6 A;  4WFT A;  2HKE A;  4RPF A;  2F4V I;  1N33 I;  2H36 X;  2EWL A;  1FWL A;  2RS7 A;  2UUA E;  1UIL A;  3HJC A;  4YY3 E;  4DR5 E;  4DU7 A;  2Z5B A;  4HYM A;  4DV7 I;  3HPS A;  2B7T A;  2O1V A;  4B3M E;  2UUC E;  2L3C A;  4LF5 I;  2N3H A;  3F0N A;  2HK2 A;  2B3T B;  3T1Y E;  2V87 A;  3JU0 A;  1KVK A;  2F8B A;  3PYF A;  4JI5 I;  4DR7 E;  4IZK B;  4LTY A;  3Q1Q A;  2JY9 A;  3H4L A;  2VE7 C;  4BCA A;  4LFA I;  4DUZ E;  1XMO E;  4DV5 E;  4DV6 I;  2ODR C;  2CPN A;  1PKP A;  2UU9 E;  3P1X A;  3K6Q A;  4DV0 E;  5GMD A;  3V2U C;  4LF6 I;  1H7S A;  4FN5 A;  4DXL A;  3M6A A;  5BR8 I;  2UU9 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...