1HR0E

Crystal structure of initiation factor if1 bound to the 30s ribosomal subunit
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
150
structure length
150
Chain Sequence
b'DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
molecule tags Ribosome
source organism Escherichia coli
publication title Crystal structure of an initiation factor bound to the 30S ribosomal subunit.
pubmed doi rcsb
total genus 34
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2000-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1hr0E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1hr0E02
4LFBI 4NXMI 2LJPA 2F4VI 1FJGI 4JI8I 4X65E 1UEKA 4OX9E 1HNZE 1XMQI 4WFTA 4JI8E 3J7AG 2UXCI 2B3TB 4X62E 1HR0I 2KHXA 4X62I 4KHPE 4B3SI 3F0NA 2NUGA 3T1YE 4LF8E 2N3GA 1QU6A 3ZZ0A 4JYAE 1J26A 4DR5E 3M6AA 2L2MA 2JY9A 4B3TE 3PYFA 2NA2A 4HACB 2L33A 2L2NA 4FW9A 1Z0WA 1N33E 4R1FA 1NHJA 1UHZA 2DMYA 4MYUA 4YY3E 1PIEA 2UUBE 1J5EE 1FWKA 4P7AA 1RQ0A 2GS8A 4PRVA 3QT5A 1X47A 5CFFE 2LTSA 4JI0E 5LMNE 4JI4I 2E5LI 4DR5I 4NXNI 3T1HI 4DV1E 5LMNI 3B78A 1FI4A 5GMEA 2UXBI 5BR8I 1Z59A 1QZRA 2NUEA 4AQYE 4JI3I 2ZITA 3PYDA 5IWAI 3J7Yp 1N0VC 1IBKI 4GKKI 2NUFA 3ADIA 2B7VA 1Z5CA 4B3RI 4DR2E 1GQEA 4WYQB 1MX0A 2E1RA 4M2ZA 2RTXA 1XHKA 3J80C 1N33I 1RREA 4HYMA 4DUYE 3B82A 4DV7E 1OJ4A 2V2ZA 4DPXA 1WHNA 2RS6A 2VF3A 4DXLA 1EI1A 1KKHA 1HNXI 4K0KI 1FNMA 1KIJA 2LJHA 2VQEI 2UXCE 2V34A 4DV3E 4PRXA 1ZM4A 3ZZUA 1IBLI 4LF7I 4LF9I 3J7AM 5FLXQ 1XMQE 3VYXA 4OX9I 4X65I 2HKJA 2F4VE 1Z0CA 2XEXA 1K47A 1Z0EA 4DR6I 4WUBA 4B3ME 3P1XA 3HULA 1STUA 3H4LA 2E5LE 1I94E 3C4TA 4EMDA 4M1KA 3ZKBA 1FKAE 1HNWE 2ZM6E 5GMDA 3J81C 2HKEA 4DR4I 1YYKA 1ZM2A 4LFAI 4DV0E 3ADLA 1VISA 1O0WA 2V2QA 2HK2A 4DU8A 4GKJI 1N36I 4DR7E 2ZM6I 4LF5E 4GKJE 1HNWI 4JI5E 4JV5E 4P52A 4K0KE 1I94I 2DEJA 4KHPI 2N3HA 1H73A 1D6TA 1WUUA 2UU9E 3V2UC 3WU6A 4GKKE 1IBKE 1KVKA 4JI3E 4AQYI 2DEIA 4Z7YA 1UILA 4JI7E 2B7TA 1T4NA 4NXME 3K1JA 1FWLA 2MDRA 1NHIA 2BM1A 3C4BA 1H74A 1IBMI 2UU9I 4UT4A 5BR8E 4YY3I 1X49A 4DV0I 4JI4E 3ZKDA 4DV6E 1XMOI 1ZM3A 2LRSA 2CPNA 4JI6E 2BV3A 1KTVA 4RPFA 1XMOE 1PVGA 4LF4E 1N34E 4ZVIA 3K17A 4MYTA 4LFCE 3WU3A 2UXDE 3T1YI 4LF8I 3LLHA 4DR2I 5LMUI 3LNUA 4DR1E 4DV7I 1IBME 1X48A 5IT9C 2R42A 2VQFI 2BM0A 2RSMA 4LF6E 1T4LB 2LUPB 3OTOI 1YYWA 4URLA 4B3TI 2CZ9A 1S4EA 3T1HE 4JI0I 1MU5A 3JAMQ 2LTRA 3QT8A 1EA6A 2WW4A 2UUAE 5A2QC 4DV4I 2UUBI 2L2KB 5FLXC 2IHR1 1EKZA 1HNZI 4NXNE 4UTGA 1WHQA 4JI5I 4DR3I 1DI2A 4LFBE 2HFSA 4WUCA 2R3VA 4DV2I 3ZZTA 1J5EI 2LUQA 4DPWA 3WU4A 4FWDA 4DV5I 4USMA 2UXDI 1S16A 1N34I 2AJ4A 4DPUA 1RC7A 4X64E 2L3JA 2HK3A 4DUZI 2HHHE 1XNRE 3J80Q 3B8HA 4DR3E 2LBSB 2HFUA 4DV1I 2ZBKB 4OOGC 3PYEA 4B3MI 2HHHI 1XNRI 1ELOA 1PKPA 2UUAI 1HR0E 3V5RA 2X36A 4DR6E 2X7IA 4JG4A 1H72C 5L3JA 2UXBE 2A2DA 2UUCE 2A2CA 4XTJA 1FJGE 1N36E 3WU5A 4Z7CA 1B63A 1XNQE 1YYOA 3LPSA 2RS7A 1N0UA 4LFAE 2L3CA 2NPFA 4DR7I 3D4JA 4JYAI 1DARA 4KQVA 4JI1I 1T4OA 4DV4E 2EZ6A 5IWAE 1N32I 4PU9A 4X8WA 1Z0BA 3QT6A 3VYYA 4JI2I 4LF4I 4JI7I 3OTOE 3ADGA 5IT9Q 2VQFE 3JAMC 4FN5A 4X64I 4DR1I 1HNXE 5LMUE 1RR9A 2DB2A 4JI1E 1B62A 4X66I 1ZM9A 4DV2E 2OI2A 1Z0TA 1Z5BA 1ZBTA 4LF5I 2Q2EB 4JI6I 3LTOA 2V2VA 4DV6I 4X66E 3CWVA 4FWHA 1MG7A 2UUCI 1XNQI 5LL6R 1NZ0A 3PYGA 4B3RE 4YHHE 2JVAA 1N32E 4DKKA 1Z0GA 4DU7A 4HY1A 3ZM7A 4HXZA 4FWGA 4DPTA 3J81Q 2J7KA 3ADJA 1H7SA 4JI2E 3GONA 4DV3I 4LF6I 4ED4A 2VQEE 4DUZE 1U2RA 4YHHI 1YZ9A 1H7UA 1Z5AA 4DV5E 4I3HA 1IBLE 4LF7E 4LF9E 4JV5I 4LFCI 3Q1QA 5A2QQ 2DIXA 4DUYI 4DPYA 2EFGA 4WUDA 4HACA 3HTXA 1NHHA 4M30A 1ZXMA 1ZXNA 1BKNA 2V8PA 3QT7A 4B3SE 4USKA 1Z0VA 2YT4A 4DR4E 1A6FA
chains in the Genus database with same CATH superfamily
4LFBI 5KL2A 4NXMI 2JEAA 2LJPA 2F4VI 2EOOA 4JI8I 1A1GA 1FJGI 4X65E 1UEKA 5JEAA 4OX9E 1HNZE 1XMQI 4WFTA 3VHTB 4JI8E 2R1FA 1F2IG 3J7AG 2IERA 4WPYA 2CSHA 2JE6A 4AIDA 2UXCI 2B3TB 4X62E 3C6MA 1E3HA 4BS9A 1LLMC 4L8NA 1HR0I 2J65A 4X9JA 5A6JA 2EOJA 2KHXA 2YRHA 4X62I 2PRTA 1SFEA 2O1TA 2MKNA 4KHPE 2K4VA 4B3SI 3F0NA 2Q8UA 5C0XD 2NUGA 3T1YE 4LF8E 2KONA 4IFDD 1YFHA 2N3GA 1T39A 1QU6A 3DD6A 2MC5A 3PS1A 4JYAE 1J26A 4DR5E 3M6AA 4KWYA 2L2MA 2WBSA 3ZZ0A 2JY9A 4B3TE 3PYFA 2LCEA 2NA2A 3JU0A 2L33A 4L5NC 4HACB 3KWRA 2L2NA 2O1WA 4WXCA 4DMIA 1Z0WA 4FW9A 4LCGA 1N33E 2JPAA 4R1FA 1NHJA 2JP9A 1UHZA 1YUJA 4IFDB 2DMYA 4MYUA 5KL3A 1A1HA 4YY3E 1UDNA 1PIEA 2UUBE 1J5EE 1FWKA 4P7AA 4O24A 2NN6E 1RQ0A 2EL6A 2EN8A 4R2AA 3QG5C 2GS8A 2Z5CB 4PRVA 3QT5A 1X47A 2RSIA 2IOPA 1MGTA 4IS9A 4OO1B 5CFFE 4R2EA 2LTSA 4R2SA 4JI0E 2EPOA 5LMNE 4JI4I 2E5LI 4TUIA 4DR5I 2D9HA 3HPSA 4NXNI 3T1HI 4OO1D 4DV1E 1P42A 3MHHC 5LMNI 4O5GA 1FI4A 3B78A 2EMFA 5GMEA 2UXBI 5BR8I 4Q35B 1Z59A 1QZRA 2NUEA 1EH7A 4R2RA 3EPJA 4AQYE 2ZITA 5FWKA 4JI3I 3PYDA 5IWAI 1WJPA 3J7Yp 1N0VC 1IBKI 4GKKI 2NUFA 3ADIA 2I13A 2HGHA 2B7VA 1Z5CA 4B3RI 4DR2E 1GQEA 4WYQB 2EMGA 1VI7A 4ZYGA 1MX0A 2C39A 2E1RA 2EM3A 3M7ND 2EN4A 4M2ZA 2RTXA 3BGHA 1XHKA 3J80C 3DJWA 2JXPA 4M0VA 4BC7A 1TN9A 1N33I 1RREA 4HYMA 3M7NG 4DUYE 3B82A 1HK7A 2V89A 2WBUA 2ODRD 4DV7E 1OJ4A 2V2ZA 1Y6ZA 4DPXA 1WHNA 2RS6A 1NEIA 2VF3A 4QNKA 4DXLA 1X6EA 1PJQA 1EI1A 1KKHA 4MQYA 5DRQA 5AC5A 2A25A 1HNXI 5K36C 4K0KI 2R76A 1OYRA 1FNMA 1KIJA 5C0XA 2LJHA 2CVEA 2BR2A 2VQEI 2UXCE 2V34A 2NABA 2Z5BA 5DROA 4DV3E 2KOUA 1UDQA 1ZM4A 4PRXA 3ZZUA 4IZKB 1IBLI 4LCHA 4LF7I 4LF9I 5FLXQ 1XMQE 3EPHA 3VYXA 4OX9I 3J7AM 4OZEA 4X65I 2HKJA 2F4VE 1Z0CA 4ZYHA 2XEXA 2EPUA 1YSAC 1YPNA 3AV0A 1K47A 4GZNC 3K6QA 2EP3A 4R2CA 1Z0EA 2EQ0A 1IQOA 4OO1C 3P76A 4DR6I 2EOHA 4LU9A 4WUBA 4B3ME 4FW7A 2EPPA 3P1XA 3HULA 2PNZB 1STUA 2WNRA 3GCMA 3H4LA 4MU1A 2EN2A 2E5LE 1I94E 3C4TA 3L00A 3C6KA 4EMDA 2J7JA 2NN6B 4M1KA 3ZKBA 2WZOA 1FKAE 1P47A 1HNWE 2C37A 1X3CA 1Y4UA 2ZM6E 5K36F 4OO1A 2V88A 3J81C 5AE1A 4BBYA 5F3WA 5GMDA 2HKEA 3B4TA 1YYKA 1ZM2A 2BA0G 4O4KA 1KJKA 4DV0E 1USUA 5C0XB 2EMKA 4LFAI 3LMLA 2YTGA 2EMAA 4WSGA 3ADLA 1IQSA 2EPLX 2YTPA 4F9BB 1A1KA 1VISA 1O0WA 4DV2I 5DNXA 2EM8A 2V2QA 2HK2A 4DU8A 2EPAA 3L7ZA 2EM7A 2O1VA 4KZSA 3L7ZB 2CGEA 4GKJI 4LTYA 3GMEA 1N36I 2CT1A 4DR7E 2ZM6I 4LF5E 2PNLA 2N8XA 1TF3A 4JI5E 4GKJE 4JV5E 1HNWI 4P52A 2EMBA 5K36D 3Q6NA 2LT7A 1A1FA 4K0KE 1I94I 2DEJA 2EOZA 4KHPI 2N3HA 1H73A 1OYPA 4RHBB 1D6TA 1WUUA 2WCC3 4LCFA 5TSEA 2EM5A 2PO0A 2UU9E 1NCSA 4OKGA 3V2UC 2CTDA 2DSYA 3WU6A 4GKKE 1IBKE 1KVKA 4AIMA 4JI3E 4AQYI 1A1JA 5KL7A 2EM4A 2DEIA 2NN6A 1UILA 4JI7E 2PO2B 2YRMA 4Z7YA 3P3EA 2B7TA 1WXRA 1XXEA 3HXLA 1BBOA 1T4NA 2C38A 4NXME 3K1JA 3M85D 2F1DA 3M99B 1FWLA 2MDRA 2HC5A 1NHIA 2Z5BB 2BM1A 5JEAD 2M4IA 2YWQA 3C4BA 1H74A 1IBMI 2UU9I 4UT4A 2EE8A 2EOQA 5BR8E 3P3GA 4YY3I 3OMLA 1X49A 2EMHA 1AAYA 4IZJD 2EOIA 3NZKA 2EPZA 2DLQA 2PO1A 2FTXB 2V8QB 2EL4A 4DV0I 1WRJA 4JI4E 4DV6E 3ZKDA 1BB8A 5K36E 1TF6A 3JTZA 2EMIA 2EL5A 2V86A 1XMOI 1ZM3A 2LRSA 2CPNA 1PDAA 4JI6E 2BV3A 4IZJA 1KTVA 4RPFA 2WP8B 5DNYA 3ECRA 1XMOE 1PVGA 2M1SA 1N34E 1SR9A 4LF4E 4LFCE 3K17A 4MYTA 4ZVIA 4BA1B 2V83A 4BHBA 5JEAE 3WU3A 1Y5YA 1X5WA 2UXDE 5ADZA 3T1YI 4LF8I 2YSPA 3LLHA 4DR2I 5LMUI 4TUGA 4ISAA 3LNUA 4DR1E 2EMYA 2FGGA 4DV7I 1IBME 1X48A 5IT9C 2R42A 4F6NA 2VQFI 2LE2A 2EPRA 2RSMA 1R6MA 2BM0A 4LF6E 2E72A 1T4LB 2VESA 2LUPB 5C0XF 2C38B 1YYWA 3OTOI 4IFDF 1EH8A 2L6MA 4F9AB 4URLA 2NN6D 4B3TI 2JT2A 3KZZA 2CZ9A 1S4EA 1ZBQA 3T1HE 4R03A 1YUIA 2EMWA 2JE6B 1DQ3A 4JI0I 1MU5A 3AUZA 3JAMQ 2LTRA 4OO1E 4NBQA 4J3DA 5KL6A 1N3GA 3QT8A 1EA6A 3H1CA 3HQ1A 2UUAE 2WW4A 2YTJA 5A2QC 2EORA 3PRYA 4DV4I 2UUBI 2L2KB 1Z1BA 5FLXC 5K36A 2O3ZA 2LMZA 1L4SA 2EPMX 2IHR1 4MLVA 3ZOQB 1EKZA 4QNJA 2YTEA 1B69A 4NXNE 2G7HA 2LVHA 3PS2A 4UTGA 1HNZI 2WP8A 2Z5CA 1WHQA 3MSWA 2NN6C 4JI5I 4DR3I 2PNMA 2EOEA 1DI2A 4I8OA 2YTFA 4LFBE 2YRKA 1ZAAC 2HFSA 2YTDA 2DLKA 2EM2A 2EM9A 2R3VA 1UDOA 4WUCA 5A6BA 2GLIA 3F6GA 2BR2B 3ZZTA 2LUQA 2RQLA 1MEYC 1J5EI 1PJTA 4DPWA 3WU4A 4FWDA 4DV5I 5A69A 5AE3A 4USMA 2EMLA 2UXDI 1BBGA 5IXMB 5DNLA 2EPXA 2V85A 1S16A 2BA1G 2C37B 4MU3A 2EQ1A 2WBTA 1N34I 2AJ4A 4DPUA 1ZR9A 1QNTA 5LLQA 1RC7A 4RH8A 5AC4A 4X64E 2L3JA 2HK3A 2EJ4A 2JEBB 4DUZI 4BA2A 2IOQA 2HHHE 1XNRE 3J80Q 4NZVA 2WNRB 4DR3E 2DRPA 3B8HA 2F8BA 3BBGA 2LBSB 3P06A 4ZYDA 2C39B 2HFUA 4DV1I 2L92A 2ZBKB 4OOGC 2PNZA 3PYEA 5K36B 3RMPA 5KL5A 4B3MI 2EPNA 2BBGA 2HHHI 1XNRI 2JEAB 1ELOA 1PKPA 2UUAI 2EPCA 1HR0E 3V5RA 2X36A 5C0XE 4DR6E 2X7IA 5ELWA 4JG4A 1H72C 5JEAB 2GHFA 5L3JA 3BF2A 2EOFA 2UXBE 3P3CA 2O1UA 2YTNA 2A2DA 1X6HA 3EPLA 2UUCE 2A2CA 2FV4B 5JEAC 4U3DA 4XTJA 2EOYA 1EH6A 2ADRA 2DMIA 2MDGA 1FJGE 4BHCA 2EM0A 2EOXA 1A1LA 2DGCA 3GLLA 1N36E 3WU5A 4NHRA 4Z7CA 2RPCA 3U1YA 1B63A 2BB8A 3CDJA 2B9DA 2GPIA 4F2JC 4FK5C 3TQMA 3PS3A 5KL4A 1XNQE 1PJSA 2IESA 4FW3A 2L8TA 2EPKX 2M7QA 2LJUA 4BCAA 1YYOA 3LPSA 2VRDA 3HPZA 2M9AA 2MKDA 2RS7A 4LFAE 1N0UA 1RHYA 4LPFA 2EMXA 2L3CA 2NPFA 3THOB 4DR7I 1G2DC 2YTOA 1A1IA 2JWOA 2EMZA 4MU0A 2MC6A 3D4JA 2ENAA 1R6LA 4M9VC 4JYAI 4DR4I 2VE7C 1DARA 3Q6MA 1UDSA 4KQVA 2E1MA 4JI1I 3VK6A 2PO2A 1T4OA 4DV4E 2EZ6A 1E3PA 2ELZA 5IWAE 3DF6A 1JK1A 5T6JA 1DGCA 2EQ3A 2EN7A 1N32I 2H36X 5JEAF 5AASA 4X8WA 3F6HA 1Z0BA 3KRNA 4PU9A 3QT6A 3U1KA 4OO1F 1USVA 3VYYA 2Z5EA 2EM6A 4JI2I 4FW4A 4F54A 4N3OA 4MDTA 3KZYA 4LF4I 4JI7I 2BA0D 3OTOE 3ADGA 2JEBA 4IJDA 4BA2B 3UK3C 5IT9Q 5IV8B 2VQFE 1UN6B 4MU4A 2YPNA 3JAMC 3EPKA 2ENHA 4FN5A 4X64I 1JK2A 4P7DA 4DR1I 2EWLA 2YSOA 2YU5A 5LMUE 1HNXE 1RR9A 5DRPA 2DB2A 2EN3A 4JI1E 2GO3A 4BA1A 3IWBA 2K7IA 1B62A 4X66I 1ZM9A 5A6AA 4AM3A 4DV2E 2EOMA 3IWCA 3EQ1A 1Z0TA 2OI2A 5AE2A 1Z5BA 1ZBTA 1AH5A 2V87A 1T38A 2Q2EB 4LOMA 1IMUA 4JI6I 4LF5I 2EN1A 4IFDA 3LTOA 2V2VA 4DV6I 5A6BD 2JR1A 2YU8A 4X66E 3K85A 3CWVA 4FWHA 1MG7A 1ZU1A 2UUCI 1XNQI 5LL6R 1NZ0A 3PYGA 4B3RE 4R2PA 4YHHE 4IS1C 2JVAA 1N32E 2LV2A 4DKKA 3FIGA 1Z0GA 4DU7A 2ENCA 1Y4SA 1Y60A 4HY1A 4R2DA 3ZM7A 4HXZA 4FWGA 4DPTA 4WX9A 3J81Q 2YZTA 4HEIA 2J7KA 5A6KA 3HKMA 4R8OA 3ADJA 2VF1A 4R2QA 2EMCA 1H7SA 4JI2E 3GONA 2EN6A 1YH8A 1RMDA 2YTIA 3BIDA 4HTGA 4Q28A 1UBDC 4DV3I 4BMJA 2CG9A 2EOSA 4N4RB 3THNA 5DRRA 4LF6I 4GEQB 4ED4A 4FW6A 1G2FC 4FW5A 5C0XC 2VQEE 1X6FA 4MLQA 4DUZE 1U2RA 4IFDC 3IWDA 2JOBA 2GO4A 2PO0B 3M85G 4YHHI 1KYQA 3HJCA 4IFDE 4WSPA 1YZ9A 1YHCA 1H7UA 4IZKA 1Z5AA 5EL9A 3CDIA 4P78A 4DV5E 4I3HA 3UHMA 2ODRC 4F9CB 3H09A 1IBLE 4LF7E 4LF9E 4JV5I 4LFCI 4IZJB 4O43A 3Q1QA 4ZYEA 2PO1B 2HJJA 2GQ0A 2JYAA 5A2QQ 2DIXA 2NN6F 4DUYI 4BC9A 2BA1D 4DPYA 2EFGA 2AE8A 4U3BA 4WUDA 2ELYA 5EKWA 1OYSA 4HACA 4F6MA 4J8ZA 3HTXA 1NHHA 4GQUA 3MHSC 4M30A 1ZXMA 1GZ6A 2JOXA 1ZXNA 1BKNA 1GTKA 2V8PA 3QT7A 4B3SE 4USKA 2I9IA 1Z0VA 2YT4A 4DR4E 4WXDA 1A6FA 2YTQA 2LO3A
chains in the Genus database with same CATH topology
4LFBI 4NXMI 2LJPA 2F4VI 1FJGI 4JI8I 4X65E 1UEKA 4OX9E 1HNZE 1XMQI 4WFTA 4JI8E 3J7AG 4WPYA 2UXCI 2B3TB 4X62E 4BS9A 4L8NA 1HR0I 2KHXA 4X62I 2O1TA 4KHPE 2K4VA 4B3SI 3F0NA 2NUGA 3T1YE 4LF8E 2KONA 2N3GA 1QU6A 2MC5A 3ZZ0A 4JYAE 1J26A 4DR5E 3M6AA 2L2MA 2JY9A 4B3TE 3PYFA 2NA2A 3JU0A 4L5NC 2L33A 4HACB 3KWRA 2L2NA 2O1WA 4DMIA 4FW9A 1Z0WA 1N33E 4R1FA 1NHJA 1UHZA 2DMYA 4MYUA 4YY3E 1PIEA 2UUBE 1J5EE 1FWKA 4P7AA 1RQ0A 2GS8A 2Z5CB 4PRVA 3QT5A 1X47A 2IOPA 5CFFE 2LTSA 4JI0E 5LMNE 4JI4I 2E5LI 4TUIA 4DR5I 3HPSA 4NXNI 3T1HI 4DV1E 5LMNI 3B78A 1FI4A 5GMEA 2UXBI 5BR8I 1Z59A 1QZRA 2NUEA 4AQYE 5FWKA 2ZITA 4JI3I 3PYDA 5IWAI 3J7Yp 1N0VC 1IBKI 4GKKI 2NUFA 3ADIA 2B7VA 1Z5CA 4B3RI 4DR2E 1GQEA 4WYQB 1MX0A 2E1RA 4M2ZA 2RTXA 1XHKA 3J80C 3DJWA 4M0VA 4BC7A 1N33I 1RREA 4HYMA 4DUYE 3B82A 1HK7A 2V89A 2ODRD 4DV7E 1OJ4A 2V2ZA 1Y6ZA 4DPXA 1WHNA 2RS6A 2VF3A 4DXLA 1EI1A 1KKHA 1HNXI 4K0KI 1FNMA 1KIJA 2LJHA 2VQEI 2UXCE 2V34A 2Z5BA 4DV3E 2KOUA 1ZM4A 4PRXA 3ZZUA 4IZKB 1IBLI 4LF7I 4LF9I 3J7AM 5FLXQ 1XMQE 3VYXA 4OX9I 4X65I 2HKJA 2F4VE 1Z0CA 2XEXA 3AV0A 1K47A 3K6QA 1Z0EA 4DR6I 4LU9A 4WUBA 4B3ME 3P1XA 3HULA 1STUA 3H4LA 2E5LE 1I94E 3C4TA 4EMDA 4M1KA 3ZKBA 2WZOA 1FKAE 1HNWE 1Y4UA 2ZM6E 2V88A 3J81C 5AE1A 4BBYA 5F3WA 5GMDA 2HKEA 4DR4I 1YYKA 1ZM2A 4LFAI 1USUA 4DV0E 3LMLA 3ADLA 4F9BB 1VISA 1O0WA 2V2QA 2HK2A 4DU8A 2O1VA 4KZSA 4GKJI 2CGEA 4LTYA 1N36I 4DR7E 2ZM6I 4LF5E 2PNLA 4GKJE 1HNWI 4JI5E 4JV5E 4P52A 3Q6NA 4K0KE 1I94I 2DEJA 4KHPI 2N3HA 1H73A 1D6TA 1WUUA 2UU9E 3V2UC 2DSYA 3WU6A 4GKKE 1IBKE 1KVKA 4JI3E 4AQYI 2DEIA 4Z7YA 1UILA 4JI7E 2B7TA 1WXRA 3HXLA 1T4NA 4NXME 3K1JA 1FWLA 2MDRA 1NHIA 2Z5BB 2BM1A 2M4IA 3C4BA 1H74A 1IBMI 2UU9I 4UT4A 5BR8E 4YY3I 3OMLA 1X49A 4IZJD 2FTXB 2V8QB 4DV0I 4JI4E 3ZKDA 4DV6E 3JTZA 1XMOI 2V86A 1ZM3A 2LRSA 2CPNA 4JI6E 2BV3A 4IZJA 1KTVA 4RPFA 5DNYA 1XMOE 1PVGA 2M1SA 1N34E 1SR9A 4LF4E 4LFCE 3K17A 4MYTA 4ZVIA 2V83A 3WU3A 2UXDE 5ADZA 3T1YI 4LF8I 3LLHA 4DR2I 5LMUI 4TUGA 3LNUA 4DR1E 4DV7I 2FGGA 1IBME 5IT9C 1X48A 2R42A 2VQFI 2LE2A 2RSMA 2BM0A 4LF6E 1T4LB 2LUPB 3OTOI 1YYWA 2L6MA 4F9AB 4URLA 4B3TI 2CZ9A 1S4EA 1ZBQA 3T1HE 4R03A 1DQ3A 4JI0I 1MU5A 3AUZA 3JAMQ 2LTRA 3QT8A 1EA6A 3HQ1A 2UUAE 2WW4A 3PRYA 5A2QC 4DV4I 2UUBI 2L2KB 5FLXC 2LMZA 2IHR1 3ZOQB 1EKZA 1HNZI 4NXNE 2G7HA 4UTGA 2Z5CA 1WHQA 3MSWA 4JI5I 4DR3I 2PNMA 1DI2A 4I8OA 4LFBE 2HFSA 4WUCA 2R3VA 4DV2I 3ZZTA 3F6GA 1J5EI 2LUQA 4DPWA 3WU4A 4FWDA 4DV5I 5AE3A 4USMA 2UXDI 1S16A 2V85A 1N34I 2AJ4A 4DPUA 1RC7A 4X64E 2L3JA 2HK3A 4DUZI 2IOQA 2HHHE 1XNRE 3J80Q 3B8HA 4DR3E 3P06A 2F8BA 2LBSB 2HFUA 4DV1I 2L92A 2ZBKB 4OOGC 3PYEA 3RMPA 4B3MI 2HHHI 1XNRI 1ELOA 1PKPA 2UUAI 1HR0E 3V5RA 2X36A 4DR6E 2X7IA 4JG4A 1H72C 5L3JA 2UXBE 2O1UA 2A2DA 2UUCE 2A2CA 2FV4B 4XTJA 1FJGE 1N36E 3WU5A 4Z7CA 1B63A 2B9DA 1XNQE 2L8TA 2M7QA 4BCAA 1YYOA 3LPSA 3HPZA 1N0UA 2RS7A 4LFAE 2L3CA 2NPFA 4DR7I 2JWOA 2MC6A 3D4JA 4JYAI 2VE7C 1DARA 3Q6MA 4KQVA 2E1MA 4JI1I 3VK6A 1T4OA 4DV4E 2EZ6A 5IWAE 3DF6A 5T6JA 1N32I 2H36X 5AASA 4X8WA 3F6HA 1Z0BA 4PU9A 3QT6A 1USVA 3VYYA 2Z5EA 4JI2I 4F54A 4N3OA 4LF4I 4JI7I 3OTOE 3ADGA 5IT9Q 2VQFE 3JAMC 4FN5A 4X64I 4P7DA 4DR1I 2EWLA 1HNXE 5LMUE 1RR9A 2DB2A 4JI1E 3IWBA 1B62A 4X66I 1ZM9A 4DV2E 2OI2A 3IWCA 1Z0TA 5AE2A 1Z5BA 1ZBTA 2V87A 2Q2EB 4LF5I 4JI6I 3LTOA 2V2VA 4DV6I 2JR1A 4X66E 3K85A 3CWVA 4FWHA 1MG7A 2UUCI 1XNQI 5LL6R 1NZ0A 3PYGA 4B3RE 4YHHE 2JVAA 1N32E 4DKKA 3FIGA 1Z0GA 4DU7A 1Y4SA 4HY1A 3ZM7A 4HXZA 4FWGA 4DPTA 3J81Q 2YZTA 2J7KA 4R8OA 3ADJA 2VF1A 1H7SA 4JI2E 3GONA 4Q28A 4DV3I 4BMJA 2CG9A 4LF6I 4GEQB 4ED4A 2VQEE 4DUZE 1U2RA 3IWDA 2JOBA 4YHHI 3HJCA 4WSPA 1YZ9A 1H7UA 4IZKA 1Z5AA 4P78A 4DV5E 4I3HA 2ODRC 4F9CB 3H09A 1IBLE 4LF7E 4LF9E 4JV5I 4LFCI 4IZJB 3Q1QA 2GQ0A 5A2QQ 2DIXA 4DUYI 4BC9A 4DPYA 2EFGA 4WUDA 4HACA 4J8ZA 3HTXA 1NHHA 4M30A 1ZXMA 1GZ6A 2JOXA 1ZXNA 1BKNA 2V8PA 3QT7A 4B3SE 4USKA 1Z0VA 2YT4A 4DR4E 1A6FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LFB I;  4NXM I;  2LJP A;  2F4V I;  1FJG I;  4JI8 I;  4X65 E;  1UEK A;  4OX9 E;  1HNZ E;  1XMQ I;  4WFT A;  4JI8 E;  3J7A G;  2UXC I;  2B3T B;  4X62 E;  1HR0 I;  2KHX A;  4X62 I;  4KHP E;  4B3S I;  3F0N A;  2NUG A;  3T1Y E;  4LF8 E;  2N3G A;  1QU6 A;  3ZZ0 A;  4JYA E;  1J26 A;  4DR5 E;  3M6A A;  2L2M A;  2JY9 A;  4B3T E;  3PYF A;  2NA2 A;  4HAC B;  2L33 A;  2L2N A;  4FW9 A;  1Z0W A;  1N33 E;  4R1F A;  1NHJ A;  1UHZ A;  2DMY A;  4MYU A;  4YY3 E;  1PIE A;  2UUB E;  1J5E E;  1FWK A;  4P7A A;  1RQ0 A;  2GS8 A;  4PRV A;  3QT5 A;  1X47 A;  5CFF E;  2LTS A;  4JI0 E;  5LMN E;  4JI4 I;  2E5L I;  4DR5 I;  4NXN I;  3T1H I;  4DV1 E;  5LMN I;  3B78 A;  1FI4 A;  5GME A;  2UXB I;  5BR8 I;  1Z59 A;  1QZR A;  2NUE A;  4AQY E;  4JI3 I;  2ZIT A;  3PYD A;  5IWA I;  3J7Y p;  1N0V C;  1IBK I;  4GKK I;  2NUF A;  3ADI A;  2B7V A;  1Z5C A;  4B3R I;  4DR2 E;  1GQE A;  4WYQ B;  1MX0 A;  2E1R A;  4M2Z A;  2RTX A;  1XHK A;  3J80 C;  1N33 I;  1RRE A;  4HYM A;  4DUY E;  3B82 A;  4DV7 E;  1OJ4 A;  2V2Z A;  4DPX A;  1WHN A;  2RS6 A;  2VF3 A;  4DXL A;  1EI1 A;  1KKH A;  1HNX I;  4K0K I;  1FNM A;  1KIJ A;  2LJH A;  2VQE I;  2UXC E;  2V34 A;  4DV3 E;  4PRX A;  1ZM4 A;  3ZZU A;  1IBL I;  4LF7 I;  4LF9 I;  3J7A M;  5FLX Q;  1XMQ E;  3VYX A;  4OX9 I;  4X65 I;  2HKJ A;  2F4V E;  1Z0C A;  2XEX A;  1K47 A;  1Z0E A;  4DR6 I;  4WUB A;  4B3M E;  3P1X A;  3HUL A;  1STU A;  3H4L A;  2E5L E;  1I94 E;  3C4T A;  4EMD A;  4M1K A;  3ZKB A;  1FKA E;  1HNW E;  2ZM6 E;  5GMD A;  3J81 C;  2HKE A;  4DR4 I;  1YYK A;  1ZM2 A;  4LFA I;  4DV0 E;  3ADL A;  1VIS A;  1O0W A;  2V2Q A;  2HK2 A;  4DU8 A;  4GKJ I;  1N36 I;  4DR7 E;  2ZM6 I;  4LF5 E;  4GKJ E;  1HNW I;  4JI5 E;  4JV5 E;  4P52 A;  4K0K E;  1I94 I;  2DEJ A;  4KHP I;  2N3H A;  1H73 A;  1D6T A;  1WUU A;  2UU9 E;  3V2U C;  3WU6 A;  4GKK E;  1IBK E;  1KVK A;  4JI3 E;  4AQY I;  2DEI A;  4Z7Y A;  1UIL A;  4JI7 E;  2B7T A;  1T4N A;  4NXM E;  3K1J A;  1FWL A;  2MDR A;  1NHI A;  2BM1 A;  3C4B A;  1H74 A;  1IBM I;  2UU9 I;  4UT4 A;  5BR8 E;  4YY3 I;  1X49 A;  4DV0 I;  4JI4 E;  3ZKD A;  4DV6 E;  1XMO I;  1ZM3 A;  2LRS A;  2CPN A;  4JI6 E;  2BV3 A;  1KTV A;  4RPF A;  1XMO E;  1PVG A;  4LF4 E;  1N34 E;  4ZVI A;  3K17 A;  4MYT A;  4LFC E;  3WU3 A;  2UXD E;  3T1Y I;  4LF8 I;  3LLH A;  4DR2 I;  5LMU I;  3LNU A;  4DR1 E;  4DV7 I;  1IBM E;  1X48 A;  5IT9 C;  2R42 A;  2VQF I;  2BM0 A;  2RSM A;  4LF6 E;  1T4L B;  2LUP B;  3OTO I;  1YYW A;  4URL A;  4B3T I;  2CZ9 A;  1S4E A;  3T1H E;  4JI0 I;  1MU5 A;  3JAM Q;  2LTR A;  3QT8 A;  1EA6 A;  2WW4 A;  2UUA E;  5A2Q C;  4DV4 I;  2UUB I;  2L2K B;  5FLX C;  2IHR 1;  1EKZ A;  1HNZ I;  4NXN E;  4UTG A;  1WHQ A;  4JI5 I;  4DR3 I;  1DI2 A;  4LFB E;  2HFS A;  4WUC A;  2R3V A;  4DV2 I;  3ZZT A;  1J5E I;  2LUQ A;  4DPW A;  3WU4 A;  4FWD A;  4DV5 I;  4USM A;  2UXD I;  1S16 A;  1N34 I;  2AJ4 A;  4DPU A;  1RC7 A;  4X64 E;  2L3J A;  2HK3 A;  4DUZ I;  2HHH E;  1XNR E;  3J80 Q;  3B8H A;  4DR3 E;  2LBS B;  2HFU A;  4DV1 I;  2ZBK B;  4OOG C;  3PYE A;  4B3M I;  2HHH I;  1XNR I;  1ELO A;  1PKP A;  2UUA I;  1HR0 E;  3V5R A;  2X36 A;  4DR6 E;  2X7I A;  4JG4 A;  1H72 C;  5L3J A;  2UXB E;  2A2D A;  2UUC E;  2A2C A;  4XTJ A;  1FJG E;  1N36 E;  3WU5 A;  4Z7C A;  1B63 A;  1XNQ E;  1YYO A;  3LPS A;  2RS7 A;  1N0U A;  4LFA E;  2L3C A;  2NPF A;  4DR7 I;  3D4J A;  4JYA I;  1DAR A;  4KQV A;  4JI1 I;  1T4O A;  4DV4 E;  2EZ6 A;  5IWA E;  1N32 I;  4PU9 A;  4X8W A;  1Z0B A;  3QT6 A;  3VYY A;  4JI2 I;  4LF4 I;  4JI7 I;  3OTO E;  3ADG A;  5IT9 Q;  2VQF E;  3JAM C;  4FN5 A;  4X64 I;  4DR1 I;  1HNX E;  5LMU E;  1RR9 A;  2DB2 A;  4JI1 E;  1B62 A;  4X66 I;  1ZM9 A;  4DV2 E;  2OI2 A;  1Z0T A;  1Z5B A;  1ZBT A;  4LF5 I;  2Q2E B;  4JI6 I;  3LTO A;  2V2V A;  4DV6 I;  4X66 E;  3CWV A;  4FWH A;  1MG7 A;  2UUC I;  1XNQ I;  5LL6 R;  1NZ0 A;  3PYG A;  4B3R E;  4YHH E;  2JVA A;  1N32 E;  4DKK A;  1Z0G A;  4DU7 A;  4HY1 A;  3ZM7 A;  4HXZ A;  4FWG A;  4DPT A;  3J81 Q;  2J7K A;  3ADJ A;  1H7S A;  4JI2 E;  3GON A;  4DV3 I;  4LF6 I;  4ED4 A;  2VQE E;  4DUZ E;  1U2R A;  4YHH I;  1YZ9 A;  1H7U A;  1Z5A A;  4DV5 E;  4I3H A;  1IBL E;  4LF7 E;  4LF9 E;  4JV5 I;  4LFC I;  3Q1Q A;  5A2Q Q;  2DIX A;  4DUY I;  4DPY A;  2EFG A;  4WUD A;  4HAC A;  3HTX A;  1NHH A;  4M30 A;  1ZXM A;  1ZXN A;  1BKN A;  2V8P A;  3QT7 A;  4B3S E;  4USK A;  1Z0V A;  2YT4 A;  4DR4 E;  1A6F A; 
#chains in the Genus database with same CATH topology
 4LFB I;  5KL2 A;  4NXM I;  2JEA A;  2LJP A;  2F4V I;  2EOO A;  4JI8 I;  1A1G A;  1FJG I;  4X65 E;  1UEK A;  5JEA A;  4OX9 E;  1HNZ E;  1XMQ I;  4WFT A;  3VHT B;  4JI8 E;  2R1F A;  1F2I G;  3J7A G;  2IER A;  4WPY A;  2CSH A;  2JE6 A;  4AID A;  2UXC I;  2B3T B;  4X62 E;  3C6M A;  1E3H A;  4BS9 A;  1LLM C;  4L8N A;  1HR0 I;  2J65 A;  4X9J A;  5A6J A;  2EOJ A;  2KHX A;  2YRH A;  4X62 I;  2PRT A;  1SFE A;  2O1T A;  2MKN A;  4KHP E;  2K4V A;  4B3S I;  3F0N A;  2Q8U A;  5C0X D;  2NUG A;  3T1Y E;  4LF8 E;  2KON A;  4IFD D;  1YFH A;  2N3G A;  1T39 A;  1QU6 A;  3DD6 A;  2MC5 A;  3PS1 A;  4JYA E;  1J26 A;  4DR5 E;  3M6A A;  4KWY A;  2L2M A;  2WBS A;  3ZZ0 A;  2JY9 A;  4B3T E;  3PYF A;  2LCE A;  2NA2 A;  3JU0 A;  2L33 A;  4L5N C;  4HAC B;  3KWR A;  2L2N A;  2O1W A;  4WXC A;  4DMI A;  1Z0W A;  4FW9 A;  4LCG A;  1N33 E;  2JPA A;  4R1F A;  1NHJ A;  2JP9 A;  1UHZ A;  1YUJ A;  4IFD B;  2DMY A;  4MYU A;  5KL3 A;  1A1H A;  4YY3 E;  1UDN A;  1PIE A;  2UUB E;  1J5E E;  1FWK A;  4P7A A;  4O24 A;  2NN6 E;  1RQ0 A;  2EL6 A;  2EN8 A;  4R2A A;  3QG5 C;  2GS8 A;  2Z5C B;  4PRV A;  3QT5 A;  1X47 A;  2RSI A;  2IOP A;  1MGT A;  4IS9 A;  4OO1 B;  5CFF E;  4R2E A;  2LTS A;  4R2S A;  4JI0 E;  2EPO A;  5LMN E;  4JI4 I;  2E5L I;  4TUI A;  4DR5 I;  2D9H A;  3HPS A;  4NXN I;  3T1H I;  4OO1 D;  4DV1 E;  1P42 A;  3MHH C;  5LMN I;  4O5G A;  1FI4 A;  3B78 A;  2EMF A;  5GME A;  2UXB I;  5BR8 I;  4Q35 B;  1Z59 A;  1QZR A;  2NUE A;  1EH7 A;  4R2R A;  3EPJ A;  4AQY E;  2ZIT A;  5FWK A;  4JI3 I;  3PYD A;  5IWA I;  1WJP A;  3J7Y p;  1N0V C;  1IBK I;  4GKK I;  2NUF A;  3ADI A;  2I13 A;  2HGH A;  2B7V A;  1Z5C A;  4B3R I;  4DR2 E;  1GQE A;  4WYQ B;  2EMG A;  1VI7 A;  4ZYG A;  1MX0 A;  2C39 A;  2E1R A;  2EM3 A;  3M7N D;  2EN4 A;  4M2Z A;  2RTX A;  3BGH A;  1XHK A;  3J80 C;  3DJW A;  2JXP A;  4M0V A;  4BC7 A;  1TN9 A;  1N33 I;  1RRE A;  4HYM A;  3M7N G;  4DUY E;  3B82 A;  1HK7 A;  2V89 A;  2WBU A;  2ODR D;  4DV7 E;  1OJ4 A;  2V2Z A;  1Y6Z A;  4DPX A;  1WHN A;  2RS6 A;  1NEI A;  2VF3 A;  4QNK A;  4DXL A;  1X6E A;  1PJQ A;  1EI1 A;  1KKH A;  4MQY A;  5DRQ A;  5AC5 A;  2A25 A;  1HNX I;  5K36 C;  4K0K I;  2R76 A;  1OYR A;  1FNM A;  1KIJ A;  5C0X A;  2LJH A;  2CVE A;  2BR2 A;  2VQE I;  2UXC E;  2V34 A;  2NAB A;  2Z5B A;  5DRO A;  4DV3 E;  2KOU A;  1UDQ A;  1ZM4 A;  4PRX A;  3ZZU A;  4IZK B;  1IBL I;  4LCH A;  4LF7 I;  4LF9 I;  5FLX Q;  1XMQ E;  3EPH A;  3VYX A;  4OX9 I;  3J7A M;  4OZE A;  4X65 I;  2HKJ A;  2F4V E;  1Z0C A;  4ZYH A;  2XEX A;  2EPU A;  1YSA C;  1YPN A;  3AV0 A;  1K47 A;  4GZN C;  3K6Q A;  2EP3 A;  4R2C A;  1Z0E A;  2EQ0 A;  1IQO A;  4OO1 C;  3P76 A;  4DR6 I;  2EOH A;  4LU9 A;  4WUB A;  4B3M E;  4FW7 A;  2EPP A;  3P1X A;  3HUL A;  2PNZ B;  1STU A;  2WNR A;  3GCM A;  3H4L A;  4MU1 A;  2EN2 A;  2E5L E;  1I94 E;  3C4T A;  3L00 A;  3C6K A;  4EMD A;  2J7J A;  2NN6 B;  4M1K A;  3ZKB A;  2WZO A;  1FKA E;  1P47 A;  1HNW E;  2C37 A;  1X3C A;  1Y4U A;  2ZM6 E;  5K36 F;  4OO1 A;  2V88 A;  3J81 C;  5AE1 A;  4BBY A;  5F3W A;  5GMD A;  2HKE A;  3B4T A;  1YYK A;  1ZM2 A;  2BA0 G;  4O4K A;  1KJK A;  4DV0 E;  1USU A;  5C0X B;  2EMK A;  4LFA I;  3LML A;  2YTG A;  2EMA A;  4WSG A;  3ADL A;  1IQS A;  2EPL X;  2YTP A;  4F9B B;  1A1K A;  1VIS A;  1O0W A;  4DV2 I;  5DNX A;  2EM8 A;  2V2Q A;  2HK2 A;  4DU8 A;  2EPA A;  3L7Z A;  2EM7 A;  2O1V A;  4KZS A;  3L7Z B;  2CGE A;  4GKJ I;  4LTY A;  3GME A;  1N36 I;  2CT1 A;  4DR7 E;  2ZM6 I;  4LF5 E;  2PNL A;  2N8X A;  1TF3 A;  4JI5 E;  4GKJ E;  4JV5 E;  1HNW I;  4P52 A;  2EMB A;  5K36 D;  3Q6N A;  2LT7 A;  1A1F A;  4K0K E;  1I94 I;  2DEJ A;  2EOZ A;  4KHP I;  2N3H A;  1H73 A;  1OYP A;  4RHB B;  1D6T A;  1WUU A;  2WCC 3;  4LCF A;  5TSE A;  2EM5 A;  2PO0 A;  2UU9 E;  1NCS A;  4OKG A;  3V2U C;  2CTD A;  2DSY A;  3WU6 A;  4GKK E;  1IBK E;  1KVK A;  4AIM A;  4JI3 E;  4AQY I;  1A1J A;  5KL7 A;  2EM4 A;  2DEI A;  2NN6 A;  1UIL A;  4JI7 E;  2PO2 B;  2YRM A;  4Z7Y A;  3P3E A;  2B7T A;  1WXR A;  1XXE A;  3HXL A;  1BBO A;  1T4N A;  2C38 A;  4NXM E;  3K1J A;  3M85 D;  2F1D A;  3M99 B;  1FWL A;  2MDR A;  2HC5 A;  1NHI A;  2Z5B B;  2BM1 A;  5JEA D;  2M4I A;  2YWQ A;  3C4B A;  1H74 A;  1IBM I;  2UU9 I;  4UT4 A;  2EE8 A;  2EOQ A;  5BR8 E;  3P3G A;  4YY3 I;  3OML A;  1X49 A;  2EMH A;  1AAY A;  4IZJ D;  2EOI A;  3NZK A;  2EPZ A;  2DLQ A;  2PO1 A;  2FTX B;  2V8Q B;  2EL4 A;  4DV0 I;  1WRJ A;  4JI4 E;  4DV6 E;  3ZKD A;  1BB8 A;  5K36 E;  1TF6 A;  3JTZ A;  2EMI A;  2EL5 A;  2V86 A;  1XMO I;  1ZM3 A;  2LRS A;  2CPN A;  1PDA A;  4JI6 E;  2BV3 A;  4IZJ A;  1KTV A;  4RPF A;  2WP8 B;  5DNY A;  3ECR A;  1XMO E;  1PVG A;  2M1S A;  1N34 E;  1SR9 A;  4LF4 E;  4LFC E;  3K17 A;  4MYT A;  4ZVI A;  4BA1 B;  2V83 A;  4BHB A;  5JEA E;  3WU3 A;  1Y5Y A;  1X5W A;  2UXD E;  5ADZ A;  3T1Y I;  4LF8 I;  2YSP A;  3LLH A;  4DR2 I;  5LMU I;  4TUG A;  4ISA A;  3LNU A;  4DR1 E;  2EMY A;  2FGG A;  4DV7 I;  1IBM E;  1X48 A;  5IT9 C;  2R42 A;  4F6N A;  2VQF I;  2LE2 A;  2EPR A;  2RSM A;  1R6M A;  2BM0 A;  4LF6 E;  2E72 A;  1T4L B;  2VES A;  2LUP B;  5C0X F;  2C38 B;  1YYW A;  3OTO I;  4IFD F;  1EH8 A;  2L6M A;  4F9A B;  4URL A;  2NN6 D;  4B3T I;  2JT2 A;  3KZZ A;  2CZ9 A;  1S4E A;  1ZBQ A;  3T1H E;  4R03 A;  1YUI A;  2EMW A;  2JE6 B;  1DQ3 A;  4JI0 I;  1MU5 A;  3AUZ A;  3JAM Q;  2LTR A;  4OO1 E;  4NBQ A;  4J3D A;  5KL6 A;  1N3G A;  3QT8 A;  1EA6 A;  3H1C A;  3HQ1 A;  2UUA E;  2WW4 A;  2YTJ A;  5A2Q C;  2EOR A;  3PRY A;  4DV4 I;  2UUB I;  2L2K B;  1Z1B A;  5FLX C;  5K36 A;  2O3Z A;  2LMZ A;  1L4S A;  2EPM X;  2IHR 1;  4MLV A;  3ZOQ B;  1EKZ A;  4QNJ A;  2YTE A;  1B69 A;  4NXN E;  2G7H A;  2LVH A;  3PS2 A;  4UTG A;  1HNZ I;  2WP8 A;  2Z5C A;  1WHQ A;  3MSW A;  2NN6 C;  4JI5 I;  4DR3 I;  2PNM A;  2EOE A;  1DI2 A;  4I8O A;  2YTF A;  4LFB E;  2YRK A;  1ZAA C;  2HFS A;  2YTD A;  2DLK A;  2EM2 A;  2EM9 A;  2R3V A;  1UDO A;  4WUC A;  5A6B A;  2GLI A;  3F6G A;  2BR2 B;  3ZZT A;  2LUQ A;  2RQL A;  1MEY C;  1J5E I;  1PJT A;  4DPW A;  3WU4 A;  4FWD A;  4DV5 I;  5A69 A;  5AE3 A;  4USM A;  2EML A;  2UXD I;  1BBG A;  5IXM B;  5DNL A;  2EPX A;  2V85 A;  1S16 A;  2BA1 G;  2C37 B;  4MU3 A;  2EQ1 A;  2WBT A;  1N34 I;  2AJ4 A;  4DPU A;  1ZR9 A;  1QNT A;  5LLQ A;  1RC7 A;  4RH8 A;  5AC4 A;  4X64 E;  2L3J A;  2HK3 A;  2EJ4 A;  2JEB B;  4DUZ I;  4BA2 A;  2IOQ A;  2HHH E;  1XNR E;  3J80 Q;  4NZV A;  2WNR B;  4DR3 E;  2DRP A;  3B8H A;  2F8B A;  3BBG A;  2LBS B;  3P06 A;  4ZYD A;  2C39 B;  2HFU A;  4DV1 I;  2L92 A;  2ZBK B;  4OOG C;  2PNZ A;  3PYE A;  5K36 B;  3RMP A;  5KL5 A;  4B3M I;  2EPN A;  2BBG A;  2HHH I;  1XNR I;  2JEA B;  1ELO A;  1PKP A;  2UUA I;  2EPC A;  1HR0 E;  3V5R A;  2X36 A;  5C0X E;  4DR6 E;  2X7I A;  5ELW A;  4JG4 A;  1H72 C;  5JEA B;  2GHF A;  5L3J A;  3BF2 A;  2EOF A;  2UXB E;  3P3C A;  2O1U A;  2YTN A;  2A2D A;  1X6H A;  3EPL A;  2UUC E;  2A2C A;  2FV4 B;  5JEA C;  4U3D A;  4XTJ A;  2EOY A;  1EH6 A;  2ADR A;  2DMI A;  2MDG A;  1FJG E;  4BHC A;  2EM0 A;  2EOX A;  1A1L A;  2DGC A;  3GLL A;  1N36 E;  3WU5 A;  4NHR A;  4Z7C A;  2RPC A;  3U1Y A;  1B63 A;  2BB8 A;  3CDJ A;  2B9D A;  2GPI A;  4F2J C;  4FK5 C;  3TQM A;  3PS3 A;  5KL4 A;  1XNQ E;  1PJS A;  2IES A;  4FW3 A;  2L8T A;  2EPK X;  2M7Q A;  2LJU A;  4BCA A;  1YYO A;  3LPS A;  2VRD A;  3HPZ A;  2M9A A;  2MKD A;  2RS7 A;  4LFA E;  1N0U A;  1RHY A;  4LPF A;  2EMX A;  2L3C A;  2NPF A;  3THO B;  4DR7 I;  1G2D C;  2YTO A;  1A1I A;  2JWO A;  2EMZ A;  4MU0 A;  2MC6 A;  3D4J A;  2ENA A;  1R6L A;  4M9V C;  4JYA I;  4DR4 I;  2VE7 C;  1DAR A;  3Q6M A;  1UDS A;  4KQV A;  2E1M A;  4JI1 I;  3VK6 A;  2PO2 A;  1T4O A;  4DV4 E;  2EZ6 A;  1E3P A;  2ELZ A;  5IWA E;  3DF6 A;  1JK1 A;  5T6J A;  1DGC A;  2EQ3 A;  2EN7 A;  1N32 I;  2H36 X;  5JEA F;  5AAS A;  4X8W A;  3F6H A;  1Z0B A;  3KRN A;  4PU9 A;  3QT6 A;  3U1K A;  4OO1 F;  1USV A;  3VYY A;  2Z5E A;  2EM6 A;  4JI2 I;  4FW4 A;  4F54 A;  4N3O A;  4MDT A;  3KZY A;  4LF4 I;  4JI7 I;  2BA0 D;  3OTO E;  3ADG A;  2JEB A;  4IJD A;  4BA2 B;  3UK3 C;  5IT9 Q;  5IV8 B;  2VQF E;  1UN6 B;  4MU4 A;  2YPN A;  3JAM C;  3EPK A;  2ENH A;  4FN5 A;  4X64 I;  1JK2 A;  4P7D A;  4DR1 I;  2EWL A;  2YSO A;  2YU5 A;  5LMU E;  1HNX E;  1RR9 A;  5DRP A;  2DB2 A;  2EN3 A;  4JI1 E;  2GO3 A;  4BA1 A;  3IWB A;  2K7I A;  1B62 A;  4X66 I;  1ZM9 A;  5A6A A;  4AM3 A;  4DV2 E;  2EOM A;  3IWC A;  3EQ1 A;  1Z0T A;  2OI2 A;  5AE2 A;  1Z5B A;  1ZBT A;  1AH5 A;  2V87 A;  1T38 A;  2Q2E B;  4LOM A;  1IMU A;  4JI6 I;  4LF5 I;  2EN1 A;  4IFD A;  3LTO A;  2V2V A;  4DV6 I;  5A6B D;  2JR1 A;  2YU8 A;  4X66 E;  3K85 A;  3CWV A;  4FWH A;  1MG7 A;  1ZU1 A;  2UUC I;  1XNQ I;  5LL6 R;  1NZ0 A;  3PYG A;  4B3R E;  4R2P A;  4YHH E;  4IS1 C;  2JVA A;  1N32 E;  2LV2 A;  4DKK A;  3FIG A;  1Z0G A;  4DU7 A;  2ENC A;  1Y4S A;  1Y60 A;  4HY1 A;  4R2D A;  3ZM7 A;  4HXZ A;  4FWG A;  4DPT A;  4WX9 A;  3J81 Q;  2YZT A;  4HEI A;  2J7K A;  5A6K A;  3HKM A;  4R8O A;  3ADJ A;  2VF1 A;  4R2Q A;  2EMC A;  1H7S A;  4JI2 E;  3GON A;  2EN6 A;  1YH8 A;  1RMD A;  2YTI A;  3BID A;  4HTG A;  4Q28 A;  1UBD C;  4DV3 I;  4BMJ A;  2CG9 A;  2EOS A;  4N4R B;  3THN A;  5DRR A;  4LF6 I;  4GEQ B;  4ED4 A;  4FW6 A;  1G2F C;  4FW5 A;  5C0X C;  2VQE E;  1X6F A;  4MLQ A;  4DUZ E;  1U2R A;  4IFD C;  3IWD A;  2JOB A;  2GO4 A;  2PO0 B;  3M85 G;  4YHH I;  1KYQ A;  3HJC A;  4IFD E;  4WSP A;  1YZ9 A;  1YHC A;  1H7U A;  4IZK A;  1Z5A A;  5EL9 A;  3CDI A;  4P78 A;  4DV5 E;  4I3H A;  3UHM A;  2ODR C;  4F9C B;  3H09 A;  1IBL E;  4LF7 E;  4LF9 E;  4JV5 I;  4LFC I;  4IZJ B;  4O43 A;  3Q1Q A;  4ZYE A;  2PO1 B;  2HJJ A;  2GQ0 A;  2JYA A;  5A2Q Q;  2DIX A;  2NN6 F;  4DUY I;  4BC9 A;  2BA1 D;  4DPY A;  2EFG A;  2AE8 A;  4U3B A;  4WUD A;  2ELY A;  5EKW A;  1OYS A;  4HAC A;  4F6M A;  4J8Z A;  3HTX A;  1NHH A;  4GQU A;  3MHS C;  4M30 A;  1ZXM A;  1GZ6 A;  2JOX A;  1ZXN A;  1BKN A;  1GTK A;  2V8P A;  3QT7 A;  4B3S E;  4USK A;  2I9I A;  1Z0V A;  2YT4 A;  4DR4 E;  4WXD A;  1A6F A;  2YTQ A;  2LO3 A; 
#chains in the Genus database with same CATH homology
 4LFB I;  4NXM I;  2LJP A;  2F4V I;  1FJG I;  4JI8 I;  4X65 E;  1UEK A;  4OX9 E;  1HNZ E;  1XMQ I;  4WFT A;  4JI8 E;  3J7A G;  4WPY A;  2UXC I;  2B3T B;  4X62 E;  4BS9 A;  4L8N A;  1HR0 I;  2KHX A;  4X62 I;  2O1T A;  4KHP E;  2K4V A;  4B3S I;  3F0N A;  2NUG A;  3T1Y E;  4LF8 E;  2KON A;  2N3G A;  1QU6 A;  2MC5 A;  3ZZ0 A;  4JYA E;  1J26 A;  4DR5 E;  3M6A A;  2L2M A;  2JY9 A;  4B3T E;  3PYF A;  2NA2 A;  3JU0 A;  4L5N C;  2L33 A;  4HAC B;  3KWR A;  2L2N A;  2O1W A;  4DMI A;  4FW9 A;  1Z0W A;  1N33 E;  4R1F A;  1NHJ A;  1UHZ A;  2DMY A;  4MYU A;  4YY3 E;  1PIE A;  2UUB E;  1J5E E;  1FWK A;  4P7A A;  1RQ0 A;  2GS8 A;  2Z5C B;  4PRV A;  3QT5 A;  1X47 A;  2IOP A;  5CFF E;  2LTS A;  4JI0 E;  5LMN E;  4JI4 I;  2E5L I;  4TUI A;  4DR5 I;  3HPS A;  4NXN I;  3T1H I;  4DV1 E;  5LMN I;  3B78 A;  1FI4 A;  5GME A;  2UXB I;  5BR8 I;  1Z59 A;  1QZR A;  2NUE A;  4AQY E;  5FWK A;  2ZIT A;  4JI3 I;  3PYD A;  5IWA I;  3J7Y p;  1N0V C;  1IBK I;  4GKK I;  2NUF A;  3ADI A;  2B7V A;  1Z5C A;  4B3R I;  4DR2 E;  1GQE A;  4WYQ B;  1MX0 A;  2E1R A;  4M2Z A;  2RTX A;  1XHK A;  3J80 C;  3DJW A;  4M0V A;  4BC7 A;  1N33 I;  1RRE A;  4HYM A;  4DUY E;  3B82 A;  1HK7 A;  2V89 A;  2ODR D;  4DV7 E;  1OJ4 A;  2V2Z A;  1Y6Z A;  4DPX A;  1WHN A;  2RS6 A;  2VF3 A;  4DXL A;  1EI1 A;  1KKH A;  1HNX I;  4K0K I;  1FNM A;  1KIJ A;  2LJH A;  2VQE I;  2UXC E;  2V34 A;  2Z5B A;  4DV3 E;  2KOU A;  1ZM4 A;  4PRX A;  3ZZU A;  4IZK B;  1IBL I;  4LF7 I;  4LF9 I;  3J7A M;  5FLX Q;  1XMQ E;  3VYX A;  4OX9 I;  4X65 I;  2HKJ A;  2F4V E;  1Z0C A;  2XEX A;  3AV0 A;  1K47 A;  3K6Q A;  1Z0E A;  4DR6 I;  4LU9 A;  4WUB A;  4B3M E;  3P1X A;  3HUL A;  1STU A;  3H4L A;  2E5L E;  1I94 E;  3C4T A;  4EMD A;  4M1K A;  3ZKB A;  2WZO A;  1FKA E;  1HNW E;  1Y4U A;  2ZM6 E;  2V88 A;  3J81 C;  5AE1 A;  4BBY A;  5F3W A;  5GMD A;  2HKE A;  4DR4 I;  1YYK A;  1ZM2 A;  4LFA I;  1USU A;  4DV0 E;  3LML A;  3ADL A;  4F9B B;  1VIS A;  1O0W A;  2V2Q A;  2HK2 A;  4DU8 A;  2O1V A;  4KZS A;  4GKJ I;  2CGE A;  4LTY A;  1N36 I;  4DR7 E;  2ZM6 I;  4LF5 E;  2PNL A;  4GKJ E;  1HNW I;  4JI5 E;  4JV5 E;  4P52 A;  3Q6N A;  4K0K E;  1I94 I;  2DEJ A;  4KHP I;  2N3H A;  1H73 A;  1D6T A;  1WUU A;  2UU9 E;  3V2U C;  2DSY A;  3WU6 A;  4GKK E;  1IBK E;  1KVK A;  4JI3 E;  4AQY I;  2DEI A;  4Z7Y A;  1UIL A;  4JI7 E;  2B7T A;  1WXR A;  3HXL A;  1T4N A;  4NXM E;  3K1J A;  1FWL A;  2MDR A;  1NHI A;  2Z5B B;  2BM1 A;  2M4I A;  3C4B A;  1H74 A;  1IBM I;  2UU9 I;  4UT4 A;  5BR8 E;  4YY3 I;  3OML A;  1X49 A;  4IZJ D;  2FTX B;  2V8Q B;  4DV0 I;  4JI4 E;  3ZKD A;  4DV6 E;  3JTZ A;  1XMO I;  2V86 A;  1ZM3 A;  2LRS A;  2CPN A;  4JI6 E;  2BV3 A;  4IZJ A;  1KTV A;  4RPF A;  5DNY A;  1XMO E;  1PVG A;  2M1S A;  1N34 E;  1SR9 A;  4LF4 E;  4LFC E;  3K17 A;  4MYT A;  4ZVI A;  2V83 A;  3WU3 A;  2UXD E;  5ADZ A;  3T1Y I;  4LF8 I;  3LLH A;  4DR2 I;  5LMU I;  4TUG A;  3LNU A;  4DR1 E;  4DV7 I;  2FGG A;  1IBM E;  5IT9 C;  1X48 A;  2R42 A;  2VQF I;  2LE2 A;  2RSM A;  2BM0 A;  4LF6 E;  1T4L B;  2LUP B;  3OTO I;  1YYW A;  2L6M A;  4F9A B;  4URL A;  4B3T I;  2CZ9 A;  1S4E A;  1ZBQ A;  3T1H E;  4R03 A;  1DQ3 A;  4JI0 I;  1MU5 A;  3AUZ A;  3JAM Q;  2LTR A;  3QT8 A;  1EA6 A;  3HQ1 A;  2UUA E;  2WW4 A;  3PRY A;  5A2Q C;  4DV4 I;  2UUB I;  2L2K B;  5FLX C;  2LMZ A;  2IHR 1;  3ZOQ B;  1EKZ A;  1HNZ I;  4NXN E;  2G7H A;  4UTG A;  2Z5C A;  1WHQ A;  3MSW A;  4JI5 I;  4DR3 I;  2PNM A;  1DI2 A;  4I8O A;  4LFB E;  2HFS A;  4WUC A;  2R3V A;  4DV2 I;  3ZZT A;  3F6G A;  1J5E I;  2LUQ A;  4DPW A;  3WU4 A;  4FWD A;  4DV5 I;  5AE3 A;  4USM A;  2UXD I;  1S16 A;  2V85 A;  1N34 I;  2AJ4 A;  4DPU A;  1RC7 A;  4X64 E;  2L3J A;  2HK3 A;  4DUZ I;  2IOQ A;  2HHH E;  1XNR E;  3J80 Q;  3B8H A;  4DR3 E;  3P06 A;  2F8B A;  2LBS B;  2HFU A;  4DV1 I;  2L92 A;  2ZBK B;  4OOG C;  3PYE A;  3RMP A;  4B3M I;  2HHH I;  1XNR I;  1ELO A;  1PKP A;  2UUA I;  1HR0 E;  3V5R A;  2X36 A;  4DR6 E;  2X7I A;  4JG4 A;  1H72 C;  5L3J A;  2UXB E;  2O1U A;  2A2D A;  2UUC E;  2A2C A;  2FV4 B;  4XTJ A;  1FJG E;  1N36 E;  3WU5 A;  4Z7C A;  1B63 A;  2B9D A;  1XNQ E;  2L8T A;  2M7Q A;  4BCA A;  1YYO A;  3LPS A;  3HPZ A;  1N0U A;  2RS7 A;  4LFA E;  2L3C A;  2NPF A;  4DR7 I;  2JWO A;  2MC6 A;  3D4J A;  4JYA I;  2VE7 C;  1DAR A;  3Q6M A;  4KQV A;  2E1M A;  4JI1 I;  3VK6 A;  1T4O A;  4DV4 E;  2EZ6 A;  5IWA E;  3DF6 A;  5T6J A;  1N32 I;  2H36 X;  5AAS A;  4X8W A;  3F6H A;  1Z0B A;  4PU9 A;  3QT6 A;  1USV A;  3VYY A;  2Z5E A;  4JI2 I;  4F54 A;  4N3O A;  4LF4 I;  4JI7 I;  3OTO E;  3ADG A;  5IT9 Q;  2VQF E;  3JAM C;  4FN5 A;  4X64 I;  4P7D A;  4DR1 I;  2EWL A;  1HNX E;  5LMU E;  1RR9 A;  2DB2 A;  4JI1 E;  3IWB A;  1B62 A;  4X66 I;  1ZM9 A;  4DV2 E;  2OI2 A;  3IWC A;  1Z0T A;  5AE2 A;  1Z5B A;  1ZBT A;  2V87 A;  2Q2E B;  4LF5 I;  4JI6 I;  3LTO A;  2V2V A;  4DV6 I;  2JR1 A;  4X66 E;  3K85 A;  3CWV A;  4FWH A;  1MG7 A;  2UUC I;  1XNQ I;  5LL6 R;  1NZ0 A;  3PYG A;  4B3R E;  4YHH E;  2JVA A;  1N32 E;  4DKK A;  3FIG A;  1Z0G A;  4DU7 A;  1Y4S A;  4HY1 A;  3ZM7 A;  4HXZ A;  4FWG A;  4DPT A;  3J81 Q;  2YZT A;  2J7K A;  4R8O A;  3ADJ A;  2VF1 A;  1H7S A;  4JI2 E;  3GON A;  4Q28 A;  4DV3 I;  4BMJ A;  2CG9 A;  4LF6 I;  4GEQ B;  4ED4 A;  2VQE E;  4DUZ E;  1U2R A;  3IWD A;  2JOB A;  4YHH I;  3HJC A;  4WSP A;  1YZ9 A;  1H7U A;  4IZK A;  1Z5A A;  4P78 A;  4DV5 E;  4I3H A;  2ODR C;  4F9C B;  3H09 A;  1IBL E;  4LF7 E;  4LF9 E;  4JV5 I;  4LFC I;  4IZJ B;  3Q1Q A;  2GQ0 A;  5A2Q Q;  2DIX A;  4DUY I;  4BC9 A;  4DPY A;  2EFG A;  4WUD A;  4HAC A;  4J8Z A;  3HTX A;  1NHH A;  4M30 A;  1ZXM A;  1GZ6 A;  2JOX A;  1ZXN A;  1BKN A;  2V8P A;  3QT7 A;  4B3S E;  4USK A;  1Z0V A;  2YT4 A;  4DR4 E;  1A6F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...