1HR0F

Crystal structure of initiation factor if1 bound to the 30s ribosomal subunit
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
101
structure length
101
Chain Sequence
MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLANA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of an initiation factor bound to the 30S ribosomal subunit.
pubmed doi rcsb
molecule keywords 16S RIBOSOMAL RNA
molecule tags Ribosome
source organism Escherichia coli
total genus 26
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2000-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01250 Ribosomal_S6 Ribosomal protein S6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1hr0F00
4LF9F 5AJ3F 4JI2F 1HNZF 1QJHA 4LFCF 4DR5F 2KJWA 4DR7F 1XMQF 1CQNA 2YY3A 2F4VF 4DV7F 4B3MF 2J5AA 4X64F 4LFBF 1N33F 4DR1F 4DV4F 1IJFB 1IBMF 1N32F 2UXCF 1J5EF 3T1HF 4JI4F 4LF8F 3T1YF 1XMOF 4B3TF 4K0KF 4DV0F 2UUCF 4YY3F 4GKKF 4JI7F 4NXNF 1F60B 1FJGF 4DV6F 1RISA 1FKAF 1XNQF 2UUBF 2VQEF 4LFAF 1G1XA 2UU9F 4X62F 2ZM6F 4LF4F 4DV5F 4DUYF 4JI0F 1VMBA 2E5LF 2UXBF 4JI3F 2VQFF 4LF7F 4JI8F 4DR3F 3ZZPA 4LF6F 5IWAF 4DV2F 2UUAF 1IBLF 1IJEB 1XNRF 4YHHF 4AQYF 4OX9F 1G7CB 4DR2F 1HNXF 5BR8F 1N34F 2RJZA 4JI6F 4DUZF 1HNWF 2B7BB 4B3RF 4JYAF 4JV5F 2BVZA 1IBKF 1B64A 1N36F 1CQMA 4KHPF 3OTOF 4X66F 1HR0F 2BXJA 4GKJF 4DR6F 2KJVA 4LF5F 4DR4F 4X65F 5LMNF 4JI1F 1I94F 2B7CB 1GH8A 2HHHF 3R3TA 4B3SF 4JI5F 2UXDF 4NXMF 4DV1F 5LMUF 1LOUA 4DV3F
chains in the Genus database with same CATH superfamily
3PYGA 3I0RB 3GV7B 3B4DA 5A2QU 3MMCB 2ZH4A 2DNRA 4R5PB 1JJHA 1SV5B 3J81U 2AIRB 1NH7A 2HWIA 4AL7A 1RT5B 5KFUA 1FERA 2ZZTA 4K4ZA 2YNIA 4G3IA 1U02A 3BBFA 5C42A 2DPIA 3BSOA 1J5EJ 1FF2A 3R6GB 1EJ7L 1V3ZA 5G0RB 2AJ4A 2XO6A 3L3CA 5J1NA 3NLCA 4LBHA 3KMSA 4OHWA 2K1RA 2CQGA 3G87A 5C7PA 3Q8YA 5L1KA 4ID5A 2P6TA 5L1LA 3NNHA 4IQXA 1UVIA 1IKVA 2M88A 3VALA 4DR2J 3T5LA 2BM1A 2ROEA 5E0OA 2GHWA 2OAUA 4C2MA 2C2KB 3DLHA 1J5OB 1JJ4A 2CKWA 4C7QA 2F40A 4TYBA 3PZPA 4DX7A 1HNZF 3JQMA 3F41A 4U7UD 2YNFA 1MROB 2F4VF 2IA6A 2DY9A 5CXTA 3W9IA 4RU9A 4AUKA 4GVBB 2GVDB 2ALYB 1BQXA 2WTFA 2JVRA 2HFVA 2ZWPA 2GGPA 3QLHA 4DL3A 5J2MB 3MD1A 2HRYA 3OFEA 3TWZA 4EBEA 3GFYA 2IRUA 3UR0A 1X7VA 4C8ZA 1FRJA 4DDFA 1IM4A 4P9SA 2GS8A 5LJ3Y 1HW9A 1HNVA 1F1BB 3EZUA 1OO0B 2GZOA 4CZCA 2D41A 3NGKA 3GQCA 1U0HA 3CVKA 1VYAA 3KYLA 5KFBA 3L09A 5CD4H 3NKYA 3TX8A 1U48A 1XNRJ 1NM2A 3MR7A 2VPYB 1S12A 1D9FA 5IZHA 3KJFB 4RW9A 1JLBA 2BACA 5D0RA 2XYGB 4LVOP 2H5EA 1TK5A 3OSNA 4Q8FA 2HSEB 3CJKA 4OX7A 4IR9A 4HVZA 4WXOA 3KLIA 2LMIA 4DSEA 2DHAA 2AJ2A 4L3NA 4TY9A 3ELHA 2Y3YA 2LQJA 4NI2A 2MZQA 2RH3A 4TLRA 1WEZA 1TKTB 3CT9A 1IJFB 2ZKUA 3C66A 3ZZZA 4ZKAA 1S1WB 3PFEA 4JV0A 3KJQB 2FD2A 1RT7B 3RRKA 2KRRA 1GTEA 3M8SA 3ET6A 4PG6A 2VDHA 4JB8B 3QGIA 2UUBF 5MAOA 3UCGA 3IA0A 3OTCA 3CTRA 1HW8A 4R25A 3SSQA 4LF7F 2BA9A 3MAAA 4NZ7A 2HNZB 2ADBA 1UW4A 5L9NA 1VLOA 4I7FA 4C3MA 5KG7A 3SI8A 2GCFA 2ZH6A 4IDKA 1ZETA 3JAMY 3GWCA 4QYZJ 5DM7Q 1IBLJ 2ZUGA 2R7WA 2N7YA 1HHQA 1M90T 4FYYB 3K2YA 4B9SA 2Q6BA 3PY8A 4MIAA 2DVIA 1UETA 2ATLA 3IG1B 1NMEB 3L95X 5F0WA 5LOQA 2XMWA 3V5RA 4OMFG 2OHDA 4LIWA 1SIWB 1NPKA 3NBPA 1YRXA 2IMOA 4KR0B 3HK2A 5G4DA 1QSLA 3CB4A 2NZCA 1MU2B 3IGNA 4QIVA 2HQDA 4LIRA 4DR1F 2E5HA 2KXHA 2HIQA 3AD9C 3DOMA 4DU7A 3TP2A 1TV6A 3OXLA 2VH7A 8AT1B 4LF8J 4K4TA 3SV4A 5HP1A 4GMKA 5J2PA 4ZMMA 4JI3F 2L41A 1YITS 1KLNA 1P9QC 2B9YA 3VAMA 2QE5A 1HNWF 1DQ8A 3JTNA 4BHQA 2DD8S 1JXLA 2EFQA 4B9TA 2VV5A 1RT5A 3BPSP 4B3RJ 3OTOJ 2E9ZA 1TZ0A 1WDTA 3IWLA 2X51A 1Q79A 2CJAA 3SZ2A 5H9EK 2AD9A 2PD1A 1B0VA 3T1AA 5IV3A 3AD8C 1FA0A 2W8LA 4WXWA 1JLQA 2W9CA 2D9PA 2F8EX 4JUZA 1IKWB 4C8LA 1N8RT 3PX0A 1KLMB 1H2UX 1FXLA 2ZHAA 3CC7S 1SB6A 3S1TA 4NPOA 1P9YA 4DLEA 4RU2A 1U2RA 1XEZA 1BD6A 1HD0A 5F8GA 5E2QA 4FXDA 3G6ES 2C2EA 2KTQA 4Y28C 4KC5A 2QZ8A 1GXUA 5HROB 3MUTP 2RILA 1J5OA 3SIPB 1NRKA 2ZJPQ 3TA2A 4PPZA 1MROA 4MH8A 3QT6A 3BO4A 1EB0A 5CCMA 3P3DA 1HKAA 3J7A1 2GNKA 3KLHB 4NA2A 1RGVA 4GVBA 2AX1A 2GVDA 4F3QA 4X66J 2PA3A 5E3RA 4FZVA 3BQ0A 3T5JA 5B0GA 3BKFA 1OYEA 4K5RA 4AL6A 2R9LA 4O3SA 2W7AA 2YWHA 3GYXB 1OSDA 1OMSA 2PMZD 2XZDB 2E44A 1REVB 2A6OA 3I5CA 3QWPA 4HHUA 4DV0J 2KG0A 2FHJD 2ZZNA 1XK8A 2HPUA 1UP1A 2C42A 2Z0GA 4DV6J 4Y3CA 2RDIA 1D09B 3LGNA 4WU2A 2F65A 2ILYA 3I56S 3KLVA 2HQGA 3TUIC 1RLDA 1HL6A 4RNNA 2YQ3A 1C1BB 3QMQA 4KGMA 1S6UA 1RWNB 3VAJA 4J9VA 3KHRA 2F63A 2CQ1A 2EXUA 1EETB 2UUAF 1IKXB 2P9CA 1NPPA 5EN1A 1TL1A 1Y00A 1U2CA 5DGBA 4G65A 4ECSA 5KFVA 3M8RA 4LRBA 1TKTA 2K8GA 2V4JA 1LEOA 3CGIA 2FZGB 3PCOB 3PRVA 5ETVA 4GKJJ 4OHVA 3CCZA 3NNAA 1RT7A 3Q23A 2I6WA 2QG9B 2V8DA 4LSLB 3ZZTA 3VAHA 4DR5F 1TK8A 4QIWD 3UNGC 2OTJS 1PAEX 1WHVA 2HVHA 2ROPA 5I3PA 4J9NA 3DHWC 3VQSA 2ZVSA 3DOLB 3DOKB 1BQMB 1TMMA 2MQQA 3MMJA 2M2BA 1CG2A 2BRLA 4OYPA 4JI7J 1NH8A 1UEKA 2J6TA 4USUA 2CUYA 4DL2A 1RHMB 4QJVA 3H4DA 3CF5Q 2HKEA 3HZEA 2R4FA 2BVZA 2MB0B 3IR7B 3R2DJ 4K50A 1H72C 2FIUA 3NWRA 2ZJQQ 4F4KA 4LF2A 3PJ9A 3CCES 5KOXA 3TAMB 5JVHQ 1FWPA 2E1CA 2MKJA 4JI5F 3SEOA 1VBXA 1SQFA 2ZE2B 4WP9A 3ZZYA 4DL6A 5GMKa 4F50A 2J7KA 4U7UK 3TZWA 2E7WA 2J8SA 2BJ7A 3LGMA 1C4CA 4P2SA 2ZD1A 3DRPA 2K3KA 1DARA 4NRTA 2HQFA 3HHNB 4BLGA 4F8RA 2FJBB 3HD1A 5KFTA 2BW2A 2RRNA 2VJVA 4UUWA 2YKAA 4ECYA 5IWAJ 4ZHRA 2ZC4A 4F67A 2J9DE 3FZBA 2V67A 3GCXP 2C3YA 1RTZA 1NK4A 1NKCA 2E5IA 4WPAA 1FVSA 1IKWA 3G2XA 1KLMA 4HYKA 3CXCR 4U8YA 1F6TA 1B0TA 3NRBA 3CDUA 3EGNA 3IRXB 2AU0A 4LR9A 3HHKA 2FGOA 1RA7A 2DR5A 4YB5A 1SUQB 1QM9A 4UUXA 3EXYA 5HROA 3W5ZA 3EZ5A 2HHXA 1MMLA 3HHLB 2QEXS 2NPFA 5H9EJ 3DLGB 3VVTA 1WOOA 3KHLA 4DPOA 1UMJA 2RU9A 2QA4G 3WDOA 2LCWA 4DV4F 2OPRB 1NAQA 3QSIA 2XMMA 4HI2A 5J2QB 1FHTA 4ZN1A 4DL5A 3CJ0A 3KLHA 1FXDA 2UUCF 1XN9A 2GIQA 4GKKF 1H6KX 5KFDA 2DH9A 1HYSB 1H74A 2YTCA 2EEYA 1JLAA 1S7HA 1L3TA 2LEAA 2W4CA 4F25A 1RAEB 2JC0A 2D3OR 1REVA 1AYEA 3ZTQA 1FFSB 4F7VA 2CQ4A 2FB0A 3GJRB 2V0NA 1MNEA 2P2CB 1EARA 1VQLS 4CP5A 1RAJA 1N88A 2QGFB 4Y2IA 2FVQA 3I6PA 3PFOA 2ZJRQ 1T9YA 2GHVC 1W25A 3OL9A 1U4BA 4K4WA 3M4XA 1KDNA 3EWGA 1UVKA 4PKDB 5D78A 1RWXB 1XMQJ 2ZBQA 3NS6A 3E01B 1HLWA 2H5IB 5C24A 1AROP 3BM7A 4YOEA 4X62J 2HQ3A 2HYIB 2R2TA 2MQOA 4GVLA 3CMAS 3SBMA 1YGYA 3WC2A 2BQRA 2JC1A 3ENAA 3HSZA 2RAQA 4NRUA 4ED2A 5BJRA 2WVEA 2UU9J 5E3QA 3GJSB 3TUZC 2KFZA 4LSLA 2YWGA 3GG1A 3DM2B 3OVSA 1RTDA 2BOPA 3UPFA 3B8HA 4K4SA 5HMWA 1PYOB 1B4SA 4ZCKA 3BDEA 3TJ9A 4NLXA 2BUNA 2KRBA 3DOLA 4BCAA 1BQMA 2HNYB 3UWTA 1WKJA 4Z37A 5F8MA 2YKPA 4QWCA 5F8IA 4M63A 1T03B 1XR6A 1FDBA 1JLCB 5DJBA 1U0SA 2RRBA 4FYXB 1F9HA 4IFYB 5BXIA 3EVOA 2XB2D 1T9UA 3UD4P 1Q5VA 2YWWA 1PAUB 1HBNB 2XMVA 4KIAA 4U6PA 4CIOA 2WVBA 1VHFA 5A8KA 4ED7A 4I6AA 1HQEB 5HQMA 1NDPA 4C97A 3T41A 2RT3A 1F5BA 1FX2A 3TAMA 1F3VA 2DCLA 4Q5VA 4UOFA 4DFMA 3KDOA 3M8QA 3UDEA 2ZE2A 3GZ7A 1QE1B 3HHLC 4RNOA 1DAXA 4LF4J 1S5ZA 5L1IA 2CPFA 4CO5A 3GFXA 2W1BA 4OX6A 2APOA 4DUZF 4PYAA 2XMJA 3KMQA 1KWMA 1M1HA 1YBTA 2RSQA 3FQKA 1T02A 3CW2C 1P6TA 3TARA 1XWLA 5FIIA 2LFVA 1TAUA 1PJ6A 4A8OA 3CE8A 3Q2TC 2O67A 4QBUA 2V2KA 3LQVA 1Q7YT 1VRTB 3DRXA 1X5PA 1OPIA 2YX1A 3Q24A 4JI2J 2E66A 2AGQA 4RNMA 1S1UB 1X8DA 2IM3A 1VQ8S 2OEMA 1VK3A 3ZC4A 4X4RA 1RWKB 3NOCA 2MTLA 5K14A 3EPIA 3EUNA 1U09A 2XS7A 1LNQA 3IBWA 2B8QA 2HRUA 5KFYA 1SQEA 2G1HA 4ILMA 1K1QA 4ENOA 3M8PA 3PG9A 3UE2A 5HO4A 2VQEJ 1XC9A 1GAOA 3WX8A 2KZZA 2CPEA 3K5NA 1X5OA 1JNRB 3G82A 3MURP 3H7HB 2B43A 3NXZA 1X9MA 4DI6A 4A8QA 1HNXJ 5FDLB 4DR4F 1S57A 5GADU 3D6MB 1JIHA 2B4VA 2R2RA 1G3OA 4EYIB 1U1MA 4ETZA 3QGGA 5A8WB 4QU7A 3M9OB 5AJ3F 1MN7A 3R5AA 1UWBB 4IQMA 3EXCX 5CABA 2HGNA 2YX7A 4TU7A 2FJEB 1TUWA 3ETMA 3NGUA 2V4QA 1CVJA 1D8ZA 3PRDA 4RW7A 3TAPA 4UZBA 4Y2AA 3SXLA 3PX4A 1I6JA 3QYYA 3UO0A 5IC4B 4BWMA 4DCOB 1HARA 2UXCF 4CM0A 1URNA 3NOGA 2C1EB 5HANA 2GIFA 5C2CA 4Q0BB 2A2DA 2FVRA 3HMJG 1N56A 1XNQF 1N5VA 4IG0B 1BC6A 1YWXA 3VGVA 3P5TL 4KJIA 3BGRA 4HDGA 2Z2ZA 1TKXB 3ZZPA 2HS4A 3RUBL 2EVZA 4ECQA 1DQ9A 1EP4A 3H40A 4I56A 3VGTA 3TRGA 2V94A 2X7IA 3TZZA 4P74A 2HVZA 1D9DA 4LF5F 4LRAA 3E01A 4A8KA 4N7TA 2ZNYA 4HHHA 3OQ2A 2XLIA 1S1XB 4DN9A 2XM3A 1IBKJ 3DGPA 4F2RA 3ZZOA 2FJVA 4M5IA 1RQ0A 3CUNA 2AYEA 5GAEI 2DNPA 5H1SV 2CIMA 1FWKA 2M52A 2H48B 3X1LB 4O4GB 4UQTA 3R7BB 4BDPA 4QWEA 3EPGA 3R5DA 2I0XA 5D0GA 2E9TA 3W62A 3MDFA 4FYDA 2LA4A 3DM2A 4ZVTB 1W26A 3GG0A 4ETXA 3IR5B 1T9VA 1N32J 2CQ0A 4JI4J 1RHKB 2PEHA 1Y5NB 2HRTA 1HQUB 2ACYA 4A8YA 3BO3A 2VA3A 1ELOA 2B5JA 4RL1A 2HNYA 2WSCC 1RLCL 1FXRA 4ZVRB 3FEZA 5BR8F 1T03A 3NEKA 4N47A 3GFHA 1Y5IB 3C6UB 4QR0A 1HI1A 2MZRA 2F3JA 4IFYA 4DMZA 1VIOA 3AY0A 2OTLS 1UCNA 3R5BA 3BZQA 2MSSA 2JFDA 4JV5J 1VQMS 1GH8A 3UDLA 1HBNA 1VJWA 3AJ2A 1NB7A 2BZ2A 1X4BA 2DGQA 2Z30B 4YDDB 2VPXB 3SV3A 1VIXA 3I87A 4DJBA 4X84A 4KO0B 1ZBTA 1S0NA 2IY5B 2XMUA 4YB1P 2GVZA 1R8BA 4AXIA 3DLJA 2DGVA 5B0FA 2XLJA 1WC0A 2CRLA 5J1PA 1R43A 3QWUA 2EG2A 1YK9A 3D6TB 2JEIA 4C8NA 1S0MA 2GJIA 5KG4A 2VBXA 4JI0F 2E5LF 2AF6A 2OFHX 2W4DA 3CCSS 2QLWA 4TQSA 1XMBA 1KP6A 3CJTA 1N0UA 1VRTA 1O5JA 1K44A 1MWZA 2E7VA 1PBUA 4IYQA 4V1Ak 4LSZB 4HI1A 2DT9A 3PRBA 4JP8A 1S1UA 1Y5LB 3UFCX 2K7JA 3A8JA 3EGWB 3QIDA 3CO9A 4EK2A 1Y9OA 2RB7A 3TX0A 2VIHA 4QZVB 3IP0A 1MN9A 3NCQA 4C6AA 2GJFA 5B0EA 2FY8A 2HFSA 2YNHB 1N0VC 5HLFB 1S6PB 3QRRA 1VQ4S 2J7UA 5GAHU 3ICLA 5JMNA 4CT8A 3AQPA 4F4XA 1ACMB 2HWTA 5FDLA 2H51B 1ULRA 2OI2A 1F2GA 1OQ6A 2C2OB 4G1PA 2Y0SD 3T1YJ 2EKNA 2CNOB 5KFXA 4YY3J 2AJQA 5A8WA 2VQFF 2MKSA 4QPXA 1RWMB 4URGA 3G86A 4LRFA 2BDPA 3R97A 1UWBA 3B4MA 2XHWA 3FGVA 5B09A 1WI8A 4L6V3 4LR8A 3CEDA 2OGUA 1KVKA 1QAYA 2LQ9A 1BUXA 1VI7A 2DH8A 2M70A 3KJNB 3SMZA 1FVQA 3JSBA 1JQGA 4DQIA 2IMWP 3A8KA 4ZVQB 4OYOA 4OHXA 3NCRA 1MSWD 2R8JA 3V4IB 4ATNA 4F04B 3O1LA 4LF9J 4DSJA 7AT1B 2WVCA 2DKOB 1NJXA 1TKXA 3Q22A 3OD2A 1Q0NA 2DGXA 4LFBF 2Z2LA 3KK1B 2BE7D 4X4OA 3LP0B 4DV0F 2HMIB 3DLEB 3ISND 4DV6F 1RISA 1KEKA 4EU0A 1S1XA 3M30A 3QAUA 5DGAA 2E1RA 2YWKA 4Q2LA 2YNGB 5A8RA 1QSSA 1E6YB 5CZXA 2OELA 3GFZA 3MECA 3FMBA 1RWOB 4RUCA 2D3O1 2SXLA 2NXUA 4ED1A 2BQUA 3M32A 1IM6A 4O4GA 4YEAA 1YZ6A 4PRFA 4O3NA 3MUMP 2JVOA 3DLKA 1S10A 3CJ8A 2W4PA 3H20A 4JI1F 3N79A 4ECXA 4MTPA 2QMUB 3G71S 3NWGA 5F0UA 3PW2A 1RAFB 2AWZA 2ZC3A 2U2FA 1CJUB 2R42A 3ISZA 1VQPS 3VGSA 1HQUA 1RT4B 1Y3JA 2JL9A 2J5AA 3MOJB 4KHRA 2HHSA 2ZZMA 4WCEQ 2E7XA 4P2FA 3DHXA 2NPIA 4ZVHA 3H98A 2EI5A 3O3LA 2BE9B 2MLZA 2YKOA 5EGYA 1OSCA 5AXKA 4ZVEA 1Y7PA 3GIKA 3HSGA 3UVJB 2QLJB 2DNHA 3CJ3A 4ZVOB 2V63A 1UFWA 2NR0A 2BX6A 2QL9B 3DMJB 1M5SA 3Q89A 4P2MA 5LMNF 3MTJA 5C25B 3ITHB 3DDKA 5CYMA 5IT4A 1I94F 1VC0A 3OHBA 2DB1A 2HEKA 2OPSA 1Y10A 1W7WA 4D3HA 3DRRB 3J7ZT 2B9WA 1UVNA 1C0TB 4DR7F 3GIRA 4KKOB 3UN2A 1SI9A 4DV7F 1F3FA 4L75A 1WSVA 4NCGB 1WF2A 1WWHA 1HBUB 4RPFA 2JFKA 2Y1IA 3DXBA 1VBKA 4R0JA 2KL8A 1RT1B 5CZVA 3MAHA 1RU1A 1WKKA 3W2WB 2HZVA 3IWXA 2H4WB 2Z56B 2LECA 3PVXA 1Q81T 1PJ5A 2B51A 3UW1A 2XY7A 3ZTOA 1KFSA 4ANCA 3BGOP 3OW2R 1YJUA 4NLVA 3BN7A 5KFPA 4LFAJ 5IWAF 4OI0A 1RYSA 1PC4A 2F1FA 5DQIA 2XEXA 3P6YC 2M3DA 3MFHA 4WFNQ 5D3GB 1WG5A 2B7BB 1QVFR 3NNCA 2YNHA 3FVYA 3DI6A 4X65F 3SYZA 3PO4A 5A6PA 3MM6B 2AW0A 1L5UA 3SDEB 1FK9B 3ZTSA 4M5LA 2VG6A 2HZAA 4EBCA 4YR0A 4HL9A 2HVDA 3ENQA 3I32A 3BKUA 2HFNA 1XJWB 3RR8A 5DDQC 1HQ2A 3P8BB 3TZYA 4H4KC 3WC0A 3TQEA 2XHCA 1VISA 4U67Q 3RBDA 1IKYB 4USHA 3KHGA 1B0PA 4PWDB 3JB9k 4OI1A 2X1AA 1N33J 3VHQA 3BS9A 4Y2KA 1YJ9S 4WFBQ 1AA1B 2IM0A 2HFZA 2COLA 2VKZG 1U1LA 5HJYA 1U2FA 5IM0B 4ED8A 3ILJA 5DM6Q 8ATCB 4IG3B 3T9ZA 9ATCB 2F4FA 4NLSA 2ATCB 3OFGA 3Q83A 2H4YB 3IXQA 3MEEB 1N36F 4DQRA 3RJMB 2KM8B 4ID8A 2V9KA 4JYAJ 3LW5C 3QT8A 5JUMA 4OYWA 4B3SF 3KK1A 2LEPA 4GC7A 2UVRA 5B0BA 4Y6IA 1V6HA 1BQNB 2KVQE 1H7XA 2KJWA 4CO3A 4H4MA 4NX9A 3RB4A 2J9EA 2YNGA 3ULHA 1CJTB 3W5YA 1E6YA 3IS9B 1WOSA 1U45A 4V19X 3HT3A 4B9NA 2E1AA 1VQ7S 4KT0C 1CS4B 1NSAA 4H4KA 1FCAA 1YBUA 3OBIA 3HVTB 2XWYA 5KFOA 1UA1A 5CCLA 1R0CB 1NJWA 4X62F 4EMDA 3H2UB 4DXLA 4ECRA 4KBIA 5AE2A 1HBMB 2RKIB 4CH0S 2HW3A 1TFYA 3FK4A 5E3CA 1VQ5S 1CJUA 3LUYA 5GADI 3JYTA 5ETMA 1KVIA 3VWSA 5FLXY 5IS2A 1RT4A 4RW6B 1EQ0A 2DXDA 1SL2A 3R27A 1RTIB 2BEFA 1VQ9S 2YVSA 2HBZB 4LR7A 4ZVPB 2C2RA 4MYUA 1X0FA 1QVGR 1RABB 1HPZB 2CPXA 2GFFA 1R6VA 2HLUA 3T3FA 4NZ0A 3THTA 3R1LA 2JLFA 4YDXA 4X4UA 4AT1B 3CD7A 3QSYB 1JK9B 4BC7A 2X1GA 3THPA 2QA1A 2F8HA 3MM9B 4LREA 4NLWA 3HKWA 3I9V9 5L9XA 3QJJA 2DHSA 1KSPA 7FDRA 5C25A 1C1CB 2DXFA 2R3VA 3ITHA 2R8HA 1FE4A 2B8PA 4QQBA 3DLBA 4B3OB 4QCLA 2LA6A 1SL0A 3DRRA 3K5OA 2GC8A 5E41A 4DR6J 2IVFB 4WBFA 1N6QB 5HVHA 4KGXB 1ZTWA 3EDRB 1Q16B 2LDYA 1CQMA 4K4VA 2FLNA 4NCGA 4OYAA 1BXNA 4F0MA 1WEYA 4ZVUB 1RT1A 1UEUA 1GEHA 1V5VA 3MR5A 2JJ4D 3R6LB 4OI4A 4DV3F 3O2IA 2CQBA 4J9SA 4CI0B 4DX5A 2QYCA 1TL4A 1F0XA 2HBRB 1VGYA 1GK8A 2O66A 2V69A 1WF0A 1LQ9A 1JWWA 2JEJA 3R2CJ 2FTRA 2OSRA 2UUTA 3LAMA 4QIEA 5D3GA 5I42A 3MWBA 2KM8C 4X64J 4B3TF 1Q4RA 3HD2A 4CLYA 1NXIA 3CJ5A 3MM6A 4QR1A 3DC2A 2CQ3A 3HZGA 1WACA 1FK9A 4J9KA 1X0PA 2UXBF 2ZBCA 2IAJB 1F9FA 4X4SA 3DKDA 5HJXA 4DR3F 1TKZA 3KUEA 3AXMA 3RR7A 2QLBB 3G6YA 5F8NA 2KB2A 3CNQP 2KFYA 2CQHA 1LWCA 2BR0A 2OH2A 3JSRA 4WFYA 2NUUG 3MM7A 4JI6J 2MLYA 2HQCA 4PWDA 2KN4A 3N6NA 2F9DA 1SKSA 4LVNP 1VQ6S 5J1EA 4OJ1A 2MMYA 5DS7A 2DGUA 3QFWA 4EO6A 2VPZB 3PTWA 2OKQA 1ZPWX 2IJRA 2MQMA 4ZCMA 3M6UA 4USJC 2XSFA 1NSKL 5IM0A 2AEFA 2ASLA 4N56A 5THWA 3PHEA 1RWPB 3OL8A 4IG3A 2M0GB 3HJVA 2QA4S 5LM7E 2V8PA 2B56A 1ZAVA 3MEEA 1N4LA 5EX3A 1A9NB 3ZZ0A 3MR2A 3DRYA 3F73A 4DF4A 4USIA 1N5SA 1SKUB 3EZOA 3HHDA 4DUYJ 2GQ2A 4FNIA 4DX6A 3RAMA 1FRLA 3MEDB 2ZKTA 3A1YG 3JSYA 4WZQA 1CJTA 2K1RB 4LF6J 3OXFA 1H38A 3IS9A 2YH1A 4AFFA 4ZN3A 4OX9J 5DDPC 2DNMA 3IBFB 4W92B 1CS4A 3CD0A 3PACA 4USTA 4ZPAA 1Y4ZB 4DF8A 2HHHF 1HD1A 4RR5A 4O23A 2DPJA 3TEGA 5GAGI 4DSLA 5EDWA 4K2JA 2FY1A 2PC6A 4I67A 2VB6A 3PX6A 4ZVGA 3ZZUA 1BGXT 3J7Z5 4HT7A 5GAHI 2CZ9A 1HBMA 3W7BA 1L3VA 2RKIA 1WEXA 2MZTA 1Z2LA 4ECTA 4IH6A 4ELUA 2XZWA 3EMTA 3AHPA 3BH7B 2XC9A 1XMOF 4RW4B 3CCTA 3RGIA 5DG9A 5J2NA 1SKWA 4RUAA 5D77A 3UN3A 1KQGB 1N52B 4IFVB 3D3CJ 2NCKL 4CNZA 1D1UA 3H5UA 2YX4A 3OJUA 3B78A 5E5NA 1YZ7A 3I4PA 4DPXA 2MDAA 4ED6A 4MKVA 2KFNA 1VLYA 3PW5A 3RB6A 4B17A 3TVYA 3N5FA 4PCQA 2R8GA 4QWDA 4KHPF 8RUCA 1TL7A 1R6YA 4IOAQ 5IT9U 3CULA 4B02A 1U0HB 3HVWA 2DYAA 4NXMF 2XYHB 2JDJA 1WDDA 4U7CA 1NO8A 3AJDA 2QSWA 4RW9B 2QC3A 1ZM3A 3CJQA 1EKSA 1JLBB 1OWXA 2IHR1 4LFCF 4Q45A 4ZLLA 4MYTA 4CTAB 5U47A 2EPIA 2WVFA 4ER8A 1N5YA 1M5OC 4BS2A 2F7VA 5HAOA 1AZSA 3ZTPA 2RDJA 3C16A 2MZSA 3BV8A 2B9XA 1N6QA 3J80U 3X3UA 1S59A 4M8LA 2LQ5A 3W9HA 2QJ3A 3F0NA 3OV7A 3W3SA 3PIPQ 3CCWA 4DEZA 1A6LA 3K89A 2WSEC 1SJRA 3RZAA 2QO3A 4ZLPA 3CO0P 3ADAC 2KT2A 2NUHA 3HFKA 3W2VA 2FDNA 2J9DA 2R2UA 2H65B 2HS0A 2B6AA 3ET6B 2Y1JA 2QIFA 4PYDA 4DV2F 2I38A 4C48A 2BYCA 1RI7A 1JLGB 2ROGA 4C8MA 2G2ZA 4OZ0A 4BC9A 5DRKA 3MAAB 4AE5A 3UCUP 4I7FB 4QU6A 3DDIA 2GQQA 2Q6CA 2CPDA 5KT7A 1Q53A 2WOMB 3I9ZA 1LK7A 4K4YA 1J2VA 3HDSA 5FJ4A 5D8HB 2YWEA 1YLXA 3MMBA 1CQNA 4NEYA 2IAJA 3A3OB 4QWAA 4X4PA 2AKWB 2K06A 1SH3A 1RE1B 2LXFA 3BB5A 2XCPA 1HMVA 4I68A 2Z4PA 1FJGF 3US5A 3GYGA 4WFXA 4HH1A 2VODA 3MZIA 4OLPA 3PW4A 5KG0A 3JTPA 1SL1A 3GPAA 3LPYA 3BSCA 3CJ4A 3CCRS 4CO1A 2RF2B 2JNJA 1HWLA 4MKYA 5HP1B 5J2PB 1DBDA 2J0XA 1Y11A 2KI2A 3QZ8A 2X3DA 1U49A 1LWEA 3QZ7A 4NLOA 4OYZA 4WP8A 2IVYA 1SJQA 4PQUB 4NEZA 4IO9Q 4UZCA 2YKMA 1AFIA 1B99A 2BJ9A 2QYGA 1JNZB 3H59A 2MHEA 4HACB 1SQGA 4LBIA 5KFWA 4LRCA 2B4UA 3FDSA 3PXGa 4FNHA 4CLKA 3UD5A 5KFJA 4CO4A 1HNZJ 3MPVA 3N6LA 1JLQB 2W9CB 3OL6A 2WB4A 2NSBA 1CLFA 3L4BC 2F4VJ 3LGHA 2P6SA 5B7WA 3MEDA 1RYRA 2DR6A 5DZ7A 2PO4A 4ZCLA 2FJXA 3W1YC 2E1PA 3OLAA 4DV5F 1R0BG 4CLFA 1JLEB 2BJDA 1C2PA 1SJFA 2FJDB 3N9UC 1RTHA 4H4OA 5KFRA 5M2PA 3GMGA 4JOUA 4R0EA 4OHZA 2N4DA 5E7OB 3G6XA 2KJVA 4MFBA 4G6VB 5LT5A 3HHEA 2MY7A 3LP2B 4AL5A 3D68A 2UXDF 4DV1F 4RW4A 3N0VA 1OIAA 1KTVA 4IR1A 4U8VA 5B08A 1FX4A 4V19J 1NJZA 2GW8A 4DFKA 3GJQB 3BKTA 2VHGA 1LK5A 4IFVA 2XI3A 1Q86T 1NJIT 2JLGA 4KTQA 2P9EA 3K5PA 3A13A 2XSJB 3P4UB 4ZLJA 2FHMA 3POTA 1XIQA 2IBOA 5RUBA 2XMAA 2C28A 4RKUC 1UZHA 1RUSA 2CVIA 3HO1A 2V4RA 5DQGA 3K8WA 4WYLA 5HMYA 1HA1A 5HQLA 2GO9A 1YHQS 4DCPB 1LXJA 2PFFB 3BO2A 4CO0A 3G9CA 2UUBJ 1UPPA 2PI5A 1RHRB 1YRTA 4KGVB 3JAMU 4LF7J 4OLOA 4P7TA 4CTAA 1FFWB 2MEWA 1SH2A 1IWAA 2KT5A 2V8VA 2IDLA 1HR0F 4I2PB 2MY8A 1ZH5A 1RDRA 3M6XA 4ZDNA 3Q2SC 3UN5A 4L73A 1TL1B 2KG1A 2GIRA 3EICA 4ECZA 1S9FA 5T14A 1MWQA 2ZDOA 4YUDA 3FKBA 4ECUA 4NZ6A 3K5MA 1WKLA 2V4JB 2IIHA 3BBBA 2EG1A 1CULA 2B4OA 3D5MA 4KYZA 3D0GE 3LOUA 1WNEA 3DRSB 1JLGA 3VAFA 3D4JA 4XK8C 3MM5A 4Z7CA 3TA0A 4DR1J 2R8KA 2FGCA 1WELA 4E8UA 1RWVB 2H5JB 4USVA 4CWBA 4ED4A 3UDCA 2BMBA 4A8XA 4C0BA 2WOMA 4FF3A 5CHCB 4K7QA 3OPKA 2L08A 3D66A 1NPRA 2BJ1A 1RAOA 3O8WA 3P96A 2C2ZB 4JI3J 1CSJA 3D7SB 4MT1A 3KWMA 2FC8A 4N41A 4USKA 1QDUB 4ELVA 2HLTA 3HHLD 1VDHA 2H9ZA 1HNWJ 2A3JA 3S6EA 3CPWR 1ZZNA 2RHSB 1RU2A 1YX2A 3KNGA 1ZA2B 1S97A 5D4OA 2ZH2A 2YWFA 2CJXB 1F2HA 1RBOB 5IQ6A 4DSFA 5E3PA 2NXEA 2QL7B 2G0CA 2RF2A 2UZAA 1YRUA 3UNYA 2MSTA 4KGZB 4CLZA 5HSPA 4RO0A 1I51B 2UV8A 2ZD1B 3DRPB 3HPOA 4NLQA 1T7PA 1CBKA 2W7PA 4Y0FA 1WHYA 2CPJA 2CZ4A 4PQUA 2DJWA 1CC8A 1FKAF 2Z2YB 2EW9A 1EIYB 1NK9A 3G8QA 2ZHBA 4RWXA 3MPYA 1NSPA 2MQNA 1TP7A 1OJ4A 2HVIA 4MK8A 4HACA 4TN2A 2OP5A 1GQEA 1GFWB 3R5CA 4ZHRB 4CT9A 1G7CB 4AD6A 2KHCA 4J9PA 3MEKA 2A2CA 4G1IA 5KG3A 2ASJA 4PUOA 3KTQA 4FBUA 4QPTA 4ED5A 4W4MA 1NHUA 2CVEA 1SJ3P 2VONA 1H73A 2ZUAA 2X3GA 3KHHA 5GAEU 3PYDA 2C22A 2AP6A 3ZO7A 1HWIA 2G9OA 2GHPA 4LQ3A 1WC3A 1U1KA 3GB0A 2Y9HA 4CLPA 1JLEA 3GE9A 4X4TA 1U1OA 4KGKA 4DZDA 2QLFB 4KQZA 2AEJA 4FYVB 4NCBA 3HI9A 2PI4A 3C6TA 2CQ2A 2XCAA 3LWMA 2BKNA 2QL5B 3M9NB 2CQCA 1WOPA 2IRYA 4NLTA 1UKUA 4QW8A 4NXNF 4D3GA 4O3PA 1Z2ZA 3LP2A 2KH9A 1X9WA 4F2SA 3FNNA 1NEEA 4WF9Q 1M5HA 1RTJA 1P1TA 2DRDA 4F0KA 5KTQA 5D0EA 4OYMA 3MR6A 2UUAJ 2XSJA 1JLAB 2R8IA 3M7VA 2ADCA 1CJVB 2HFUA 1NKBA 4YR2A 1AW0A 3CCMS 1X4EA 3RB3A 4FKYA 2ASYA 4F4YA 3FBCA 1HNIB 3MGJA 5CYQB 2XMTA 4J9RA 3VAIA 2D7SA 5LL6d 1JKHB 4DR5J 4ZIVA 2VF3A 3H5XA 2HNDA 3C3LA 3ENVA 4WU3A 1WC6A 1RBAA 4K0KF 3LTOA 5C24B 4I2PA 1HWKA 4FXWA 3C46A 2W2PP 3D0HE 2WVDA 3IM8A 2KDOA 4YB6A 1XBWA 4LUBA 4FN5A 2IM1A 1YQHA 4RNHA 3GTYX 3NGTA 2C3UA 3EJMA 2I5JB 2FC9A 1WHWA 4ES1A 4J9MA 3L7PA 1KHWA 1CJKA 2G13A 4DR6F 2ASDA 2GA7A 3BF4A 3DRSA 1RTDB 2K3IA 2DGTA 2VG7B 2L9WA 2WZ1A 2R7RA 1QUVA 2G0JA 4DPTA 3S7RA 3HKZD 1UVJA 3WX4A 4JI5J 2GV1A 3TO8A 5EX0A 3U1MA 3UD3P 5GMDA 2YY3A 3MTKA 2VOOA 3LP1B 2MYFA 2PEBA 4KB7A 3CDEA 2O5DA 1LW2B 4PAAA 2C3PA 1S99A 3T1HF 2BANA 3RRHA 1H0HB 2A1BA 4UF4A 1FESA 5EWEA 5GVQA 5HVGA 4ZPCA 3N6MA 2M4MA 1VBYA 3PYFA 3MPDA 3Q8SB 5A8KB 2R7QA 4YFUA 3ZZRA 4HTIA 3K59A 2MXYA 1WF1A 3KG0A 2QV6A 3M8QB 4NLGA 2MZ1A 3E2EA 3O5TB 2CJBA 2EFOA 2ZITA 2BM0A 3UI3A 5DG8A 3NGRA 2DTJA 4DFPA 1H2VZ 3EVMA 3QGPA 2VZ9A 1P8GA 3KJVB 2OSQA 3OSPA 1VC5A 4B3MF 2LU2A 4EI2A 3AH6A 1PYSB 3OUYB 3DGVA 3EE3A 3V6DB 1R0AB 3OR2B 2V9WA 4ICLB 3PDNA 1FD2A 1DZ5A 2DH7A 4J37A 4DV4J 5F8JA 2VBYA 3M9MB 4IH7A 2EFPA 2OEKA 1RT3B 2UUCJ 1FDNA 5K14B 4GKKJ 5K9FA 2XLKA 2GAHC 1HIYA 1RT6A 2CDQA 4IRCA 2NYIA 4PPDA 3AA9A 1FDAA 4GC6A 4MIBA 2JEFA 4QIGA 4W98A 3M8PB 4NLYA 2EFVA 5IXUA 1MWYA 1FNXH 1KC8T 3GJTB 3G82B 4AXJA 2W25A 1HWUA 4NLUA 2P8IA 1UL3A 4RX6A 3FEXB 4NLRA 3TA1A 1LOUA 3FC9A 6FD1A 4I6YA 4LF1A 1T9XA 4ZS6A 3PEJA 1FKOA 3SCLE 4KV8B 1YSJA 1MW7A 2D3UA 3KLFB 3GIMA 2LLZA 4WFZA 1RK8A 3W66A 5KFIA 3WIVA 2M9KA 5ADZA 3R8YA 4ZPDA 4RW7B 3GIIA 3OR1B 3JQJA 3QRQA 4X4QA 1QAIA 1CJVA 3UDVA 4PR6A 2FJAB 2V2VA 2P9GA 2Z2MA 1JXEA 3PJWA 2M8HA 4JI8F 3I5BA 3TVZA 1HNIA 1RXOB 2LU1A 4Y2CA 5I3QA 2KT3A 2LXIA 5CYQA 2KXNB 3BGRB 1FJCA 2VASA 2ZDPA 3TQ1A 1JXVA 1JKHA 3MOZA 2FZCB 1EP4B 3OTDA 2IYGA 4N8OA 5CYJA 4DSIA 3H5YA 4C4WA 5T7LB 3CCUS 1QY7A 3M2VB 1P1LA 2FVCA 3MM8B 3DGPB 3TZXA 3Q8UA 4P71A 1GMVA 3EGVA 1X5SA 3D0IE 4FDFA 3NG8A 4ZP8A 2RDDA 4R8UA 2CJYB 2I5JA 2W2OP 1IVZA 2V8GA 2AZ1A 4UY8T 1UJ4A 3D1QA 5IOLA 2WRMA 3IAM9 1ROFA 4J9QA 2L3MA 2DISA 2VC1A 5DLGA 1X31C 2JLEA 2ZM6F 3BR8A 2VG7A 1ZZFA 1X9SA 4XDDA 4ZJLA 2DR9A 1FO1A 4WKRA 2E5JA 1L3UA 4YHHF 1EAYC 2B5JB 4RJVA 2ZH5A 2MQLA 4GRSA 3LP1A 5E33A 1RSCA 2C3OA 4XTTA 2JX2A 3QT7A 3BYRA 3N28A 1NKEA 4DUZJ 5F9LA 3RAQA 1LW2A 4YQWA 4G1QB 1AXQA 3W60A 4O44B 4CDIA 4XO0A 1LW0B 2LEBA 4USWA 3FSYA 2PFDA 2PDAA 1SVDA 3RU0A 1R8HA 1U26A 1XR7A 3M2RA 4EO8A 2W24A 4NL5A 1U25A 3JXOA 1F5CA 2GVZB 2A10A 3NAHA 1YTYA 3BR9A 3Q8RB 3KKFA 2UVUA 2PMHA 4PXEA 4YS2A 1V3SA 3IBCB 2NREA 3IFEA 1FRKA 4MKBA 1I3OB 2VFVA 3T5KA 2MGZA 4RUHA 2YKQA 2J0WA 3OXGA 4M5GA 1RBLA 4Y34A 3GP9A 4AQYF 3L9ZA 2KO1A 1N34F 3KJVA 1X5TA 2DBBA 5I3UA 3O6QA 2A0FB 4PXBA 2NZ4A 4H54A 4IRDA 3BGUA 2H3EB 3OUYA 2VA2A 2N4CA 1NJYA 1R0AA 3V6DA 3OR2A 1S0OA 4IH5A 4ICLA 5JXSA 1RA6A 4FF2A 4DR4J 2XG8A 2HK2A 3H4BA 3RB0A 2KHDA 4O0IA 2O3DA 2C3MA 4HLBA 3MCSA 2QFJA 5A2QY 1TUGB 1RT3A 5AJ3J 3SSSA 2XMKA 3J81Y 4M1KA 2FQQB 4M95A 2LQ8A 1SXLA 1HHSA 2MZJA 3RW6A 2B0GA 5ETKA 1J5EF 3U27A 3C2PA 2ZVIA 1UVMA 2HHPA 4P2XA 4WWSA 3RG6A 1FJEB 4DUTA 2UXCJ 1QAJA 3VAGA 1VFJA 2HBQB 2G4BA 3A4TA 1EQMA 4OV6A 3S8SA 1H98A 4UOHA 1XNQJ 1GMWA 3MEGB 2HS3A 4Q44A 2LQBA 4KV8A 4DR2F 3K0JA 2DR8A 2CG4A 4ZP9A 3KLFA 2GJ2A 3PEHA 2DY1A 4NYPA 3AB4B 3VCDA 3OFFA 1S9EB 5L38A 2XWXA 1GX5A 2QN6B 2OLWA 2WSFC 4LF5J 2UUWA 1MMNA 3OR1A 2AJ1A 2BKPA 4NOHA 2FZKB 4TXSA 1UAWA 3BPDA 1QAXA 1IBMJ 3FCHA 1IQZA 2CPZA 1AFJA 2H54B 5KT2A 3K8VA 1M0SA 1T3OA 1VR6A 5DQHA 1RT2B 4EUVA 4ZP7A 3J7YI 3H2VE 4ZPBA 3EDQB 4EGLA 1ZM4A 2K7KA 1GMUA 1AB8A 3AXKA 4WZMA 5T7LA 4CCHA 2LYVA 2E9RX 1S6QB 1S48A 5B0CA 4M5JA 3M2VA 3QBCA 1TVRA 2NXNA 3MM8A 2D69A 1IBCB 1ZA1B 2AJ0A 4J90A 1Q1KA 3M30B 2FVPA 1NZAA 2NS1B 5A8RB 1XNRF 1Q8BA 4O0NA 2Q43A 2X1FA 2NXCA 3NMRA 5C2GA 3MECB 3TUJC 1S9GB 2PGCA 1KFDA 5IC6B 3S01A 3VTIA 2BXJA 5BR8J 3EYZA 1NDLA 1SJ1A 3M32B 4NLDA 1S7IA 2EFNA 2CNLB 2ZWOA 3DLKB 4DL0C 3DN9A 2WONB 3V6HA 4DBQA 2C2MB 2GMHA 2XY6A 1REGX 1UW9A 4EZ6A 2VFSA 4DL4A 3GONA 3WIUA 1WSRA 5K5MA 4O4RA 2IJNA 3BH6B 2IRXA 1KONA 3R1HA 5L1JA 1M5KC 1NK7A 3PKMA 5KFSA 5DDOC 1N48A 3QIPB 3SQGB 2HBYB 1RAGB 2YPYA 2VFUA 4DN0A 3NGSA 1HI8A 4F02A 4U96A 4G1QA 1UA0A 3QO9A 5F41A 4O44A 3H2LA 1K47A 2QLXA 3ZTRA 4BBYA 1LW0A 3LPEA 4JI0J 1NK5A 1IBLF 1DRZA 2E5LJ 5ETQA 3PR5B 4CNYA 2RUSA 3EVWA 5ETNA 3V81B 2VD3A 5KG6A 1S4FA 2Y0BB 1EHWA 1QTNB 3I0RA 1LXNA 4LSNB 1S72S 1FNOA 2Q3PA 2VU5A 3MMCA 1SCJB 2AJFE 4I69A 5BYQA 4R5PA 2W2MP 1SV5A 5CYMB 1M1GA 4M5DB 2OPSB 4TY8B 5KT5A 1VJQA 2I8EA 5DG7A 1FWLA 4OZ5A 3BSNA 5DDRC 4CH7A 4LF8F 1EKRA 5G0RA 1DTTB 4PG7A 4XDCA 3KFWX 2R7OA 2G1DA 4ILLA 4A4JA 2CJKA 1QUPA 1D0EA 5D0HA 2VG5B 4P6QA 4X4NA 1APSA 2VQFJ 2HQIA 3CCQS 1IR2A 3Q0AA 3OHAA 3VR1A 4B3RF 1RHQB 3OTOF 2V5HG 2HHWA 2MHNA 2DGWA 5LJ5Y 5GAGU 1ZAWA 1ZS6A 2ILZA 4P10A 3PW0A 3DI6B 4USMA 2GMJA 5F9NA 3MCNA 2XNQA 1NHKL 3R5JB 2AEMA 4C0HA 2OFGX 2VG6B 2J7WA 2V2ZA 3TUPA 1S79A 2NLWA 2CWXA 4OL8A 2O01C 3MEGA 5LSRA 5J2MA 2V8HA 3W8GA 2EFGA 4ZP6A 3DFEA 4ZIWA 1HBOB 5LSLA 4LFBJ 3PNIA 4NASA 3UCZP 1LKZA 1D3WA 4PZVA 4UY85 1S9EA 4DZ6A 1U47A 1UEVA 1TL3B 1AUSL 5KFNA 3FQLA 1B3TA 3A12A 4WIIA 4AYBD 3RTVA 2AV5A 2H1YA 3KDNA 3RYLA 2RNEA 3FUYA 3RBZA 4UOGA 4ECVA 1R8CA 3D3BJ 1N5QA 3TOQA 2IM2A 4X66F 4FPRA 1O0PA 3DLLQ 3GU0A 2HGLA 2UVVA 5MLCV 1QSYA 1R8PA 2GMLA 2B7CB 4YR3A 1F5AA 2D9OA 2MQPA 1RT2A 2CJQA 4J9UE 3WHIA 2CG8A 4C3LA 1NDKA 4JI1J 4WTOB 5HQ8A 2IBKA 2VJUA 5LSOA 2KYXA 1S6QA 4UQGA 1TL5A 2BJ8A 1EX8A 1S1WA 4TU9A 4N76A 4H4MB 5KFAA 2V2QA 2IYIA 3CJ2A 2XS2A 1UTAA 1S9GA 2XZTB 4ALZA 4IRKA 4FF4A 2HFOA 2HNZA 1VHIA 3W61A 2XTJP 4I4BA 4WYWA 4Z2XA 3HFZB 4OI6A 4L3KA 1LV5A 1T9WA 5D4PA 2CZVC 4OZNA 2WONA 2CDRB 3AQOA 2J6UA 1DY3A 4KH0B 4M5MA 1JJCB 1X4DA 1VRUB 5DZ6A 2EC0A 2YBVA 3JYTB 4GKJF 3IG1A 1NU4A 3BREA 2HZCA 3QIPA 5LMNJ 3SQGA 3PJXA 1AUDA 1FRMA 1I94J 1FEHA 1IN0A 3WZ0A 1RB0A 1MU2A 4M5KA 5IQQA 4JV2A 4QYRA 3J7AN 3LWLA 2XBPA 4DR7J 3WBZA 1KD1T 1YIJS 3QGHA 2RS2A 4DV7J 4YB7A 3FBEA 4OYBA 3D67A 4BWJA 4FS2A 3QJPA 2Z8QA 2D74B 4ZCIA 1FTCA 2ZBRA 3V81A 4JI7F 1OY8A 3QQCD 1AT1B 1G1XA 3W65A 4LSNA 4MIWA 2ALZA 3HX9A 3EX7B 3SCJE 2WCXA 4M5DA 4TY8A 2GAGC 4Q2MA 2UP1A 2RQKA 3GILA 2J9CA 4C98A 3E51A 4TNOA 1L3SA 4NA1A 2LXUA 1NZ8A 4X65J 1DTTA 1P27B 2MJUA 4FVCA 1GX6A 1R8AA 1OY9A 3CCJS 3C19A 2VG5A 1X4GA 2BRKA 3MMAB 3ILLA 4J7CA 4ZPTR 2DXEA 1Z4UA 2CJ9A 4ES2A 2YKNB 5IFMA 3TR5A 3MPUB 1U6BA 4KPCA 1BLUA 3TW0A 2G0IA 4OX8A 4A8SA 2PA8D 5I42B 4B08A 4EYHB 4MJKA 4MK7A 2L48A 3DYAB 3GSDA 1URRA 4YMEA 5HBMB 1Z1ZA 4WP3A 3Q8VA 1K0VA 3D54A 4WJBA 4Y00A 2HHUA 1Q78A 1TKZB 1YVFA 2FLPA 2ZBIA 1W2IA 2YH0A 2B9EA 2CWKA 3G8SA 5L8RC 1LWCB 2VPWB 2DEIA 2BKOA 1N36J 1RHUB 3MD3A 3OTEA 1HBOA 5B0DA 4B9LA 3E3XA 3MM7B 1A0OB 3BBCA 4B3SJ 4TQRA 3DU6A 2DRBA 1TL3A 2ZH3A 4WFAQ 3CDBA 3T19A 1Q8LA 2YQ1A 1VS3A 5J1EB 2BW7A 3AB2B 4DG1B 1D8YA 3CC2S 4OFZA 1ZM9A 1S0VA 4YP3A 1C1BA 1R89A 4EBDA 3HSJA 2DHHA 3MXHP 2AT1B 4ECWA 4PWWA 1VCTA 1LWFB 3QPIA 2BBEA 1EETA 1NB2A 1IKXA 3PM9A 2J76E 2ZOFA 2X1BA 4C8KA 2D1CA 3PW7A 3VV2B 3FBBA 1VRQC 4NWBA 3SFUA 3I0SB 2DO4A 5FLXU 4DPYA 3AOCA 2RJZA 3NL0A 3MCMA 1WD6A 3CD6S 3JTOA 5K8OA 1S1VB 3I4HX 1LWXA 1DJ0A 3VAKA 5LMUJ 1XERA 1CC7A 4B9UA 1XQIA 5M2UA 1VQOS 1KTQA 1TU0B 3H25A 3WQPA 1PILA 2HWHA 1FD8A 4PWUA 3LH2S 5D15A 1XMQF 1I1GA 2VDIA 3RAXA 2UVWA 3FSIA 4DOZA 1T95A 3W64A 3AJ1A 3G96A 1RADB 4ZVFA 3DOKA 4QR2A 4CQ1A 2VL1A 3VGUA 1TAQA 5M2RA 2CPIA 1VRUA 1TELA 3M6WA 2XO7A 3RRGA 1F60B 4E2FB 4DQSA 2F8MA 3KK3B 4DQQA 1FRXA 3MCOA 2UU9F 1TR0A 4RBTA 1X4AA 3CIZA 5ETRA 3R5GA 2RMLA 5J2NB 4KRWA 1WUUA 3IM9A 5KFLA 4LQ9A 3AAWB 3KLGB 3VF0B 2QRRA 3I31A 3CJRA 4I2QB 1PIEA 3GV5B 2GQCA 4FP9A 3DDNA 5AXLA 1MMDA 2IDEA 1TKDA 2R7VA 1U6ZA 2KXFA 1DTQB 2NSCA 4UOCA 1TL7B 3I82A 4XIUA 1ZYQA 2VKRA 2VFTA 4OZ1A 3VVUA 4K2XA 1IXKA 4KE5A 4P7VA 4DV3J 1UJ5A 1ZPVA 2CADA 1YJRA 3OTBA 3RBEA 1GT8A 5HMZA 3CJSA 2AYMA 4IOBA 5ETPA 4E98A 2FVSA 2WBMA 2DNNA 1N5YB 3KG4A 4DWIA 4Q8EA 2QMXA 3IWNC 1AZSB 4F0HA 3C16B 1HI0P 1VQYA 4UTGA 1R7IA 2XS5A 1S77D 1KQFB 2ZEJA 4B3TJ 4LF4F 3MUVP 3MAQA 4OYIA 3W2VB 5KG2A 1KR4A 2B6AB 2UXBJ 1YJTA 3IRXA 1NK6A 4X4VA 4DR3J 2Y8YA 5T41A 2JEGA 2CQPA 3MMAA 1O6XA 4J91A 3PIOQ 4URQU 3QFHA 3OVAA 2LP4A 2YKNA 1SUQA 5ETLA 4FXVA 2CNKB 3HHLA 3VQTA 3FFIB 4ZPVR 2BV3A 3DLGA 1SIZA 3KNAA 4JI2F 1S49A 1IWGA 5EWFA 3CMES 3DYAA 4HDHA 3M8YA 2OPRA 5HBMA 5J2QA 1UZDA 4B9VA 3MMBB 2B3TB 4P72A 3P45B 5KG5A 3NCPA 3C8YA 1FRIA 2MKYA 1HYSA 4F4WA 2W2QP 2EKYA 3HCXA 1IR1A 1LFPA 4QOTA 4L74A 2VQEF 1HMVB 5AE1A 2CQIA 3QT5A 3V6KA 1NK8A 1FI4A 3HULA 2Y1RI 4RLEA 2PIIA 4WIQA 3VZIA 2MKHA 2RHQB 4DQPA 2RE1A 1WG4A 1R3NA 1HNXF 1G6BA 5L46A 1OYDA 5HL7Q 1QTMA 1NHVA 4DG1A 3T5HA 3V6JA 1TMJA 1DHMA 3IMQJ 3W9JA 3HFVA 1Q7LB 3H42A 1LWEB 3R3TA 2JZ5A 2RQCA 1PGZA 2HHHJ 1JJ2R 1LWFA 2IC3B 1NCLA 2W01A 2YKMB 3I96A 4K5SA 5DO2A 1FDDA 3HJFA 2O1PA 2OPQB 1V5IB 4U95A 1WC1A 1H2TZ 4HHJA 3QJLA 1GXTA 3I0SA 5EWGA 1FEEA 1IBMF 1U8SA 2Z57B 5BYSA 1VQNS 1S1VA 1Q8IA 2CFXA 1DFDA 3BDPA 4S0MA 2OJ3A 3RBXA 1XMOJ 2AYBA 4Y2MA 4EFAC 1RCXB 1NUEA 3W5XA 2DGSA 1NK0A 1Q82T 2G2OA 1KRPA 2J0SD 2RU3A 3RW7A 1PO6A 3NMAA 2W8KA 3ILIA 3GV8B 1NDCA 3BGFA 1A7GE 1IBKF 1G4CA 2AYGA 1RTHB 1M1KT 4H4OB 1Q95G 1U1NA 4ITSA 1NLKL 3LANA 4F3MA 1N54B 4MK9A 4KHPJ 2JOQA 3M2UB 2OUGA 4MFBB 1GTHA 1ITPA 1JLCA 3KK3A 3O44A 4DL7A 2P5VA 3BGLA 4NXMJ 1KS2A 3KK2B 2MJNA 7FD1A 2FHJA 3PR4A 3HP6A 3SSRA 4LFCJ 1T05B 5KT3A 2UV8G 5HMXA 4RW8B 1HQEA 2AQ4A 3KLGA 1WC5A 1M5PC 2DK2A 3U1NA 1N32F 3H0PA 4I2QA 3MFIA 2JSXA 4JI4F 1UVLA 3POTB 1O8BA 3M6VA 4TVAB 3FSXA 5AXNA 1QE1A 4GO5X 1OQ3A 3IRWP 3K7RA 1DTQA 5FD1A 2JRSA 3TI0A 5AE3A 2MLXA 3H90A 1QLNA 1T0TV 4OYXA 1GNKA 1WI6A 2QT7A 3GR1A 3OL7A 2EK6A 3A8IA 1E6VB 1HFEL 4PXDA 4ED3A 2QX0A 4EEYA 2M5YA 2J8AA 4A48A 3NP5A 1FKPB 4JV5F 4DV2J 1VQKS 1ZTTA 3N4WA 1VOMA 1V9OA 3HLUA 1JX4A 2POKA 3C15B 2DNGA 1U1PA 3KUHA 3THVA 6FDRA 3T9NA 3DCAA 3SQOP 3G4SS 2KU7A 3GCWP 2ACMA 1BMQB 2QMWA 2DNZA 4NMXA 1IQTA 1SH0A 2XGQA 1JLFB 4NLPA 3NS7B 2FHOB 4DPUA 2C2NA 4FPIA 1RAAB 1CULB 2DHXA 3FCWA 4C11B 3QAEA 2MKIA 5SZTA 3MM5B 2DNQA 4RUBA 4CRJA 3NY0A 4PXCA 2N3OA 2V34A 1J27A 1FJGJ 3AOBA 3FFIA 4IOCQ 5H9FK 2VFRA 3E8OA 2MQ8A 2EBEA 4YN3B 1Y3KA 2XY5A 3MI7X 4FVMA 2HVEA 1B64A 1UFKA 3MF5A 1KQSR 4KAIA 3F56A 3LALA 5ITHA 5HI7A 1G2EA 3A3NB 5KT6A 2IA0A 3AOAA 3FEYB 5CD4A 3N01A 1T8EA 3L7UA 3IAS9 5KT4A 4ZITA 3TNVA 1T3NA 2LVWA 1NNDA 4TYAA 5L39A 1V3RA 5EUHA 4CLTA 4CYUB 4UT4A 4Q0BA 2R7UA 2YPZA 4U9RA 3K5LA 2NYHA 1SBRA 4N8NA 4ELTA 3T1YF 4IG0A 1KVJA 4YY3F 4OHYA 3IGVA 2B4PA 3ZXWA 4OQJA 5KFZA 4FBTA 4URSA 2HK3A 3AT1B 1D9AA 3SCKE 1FJ7A 4DV5J 3HF5A 2IC3A 3TJAA 2AZ3A 4LRDA 1MLAA 3PHTA 2OPQA 3NGDA 2WBRA 1SC6A 2QSFA 4KY3A 4ZPWR 4PUOB 2CAJA 4DS5A 1TFWA 3B6BA 4PG4A 4I1TA 4J9LA 2RVJA 3V4MA 3CIMA 1M5VC 4LF9F 3JQKA 4OZLA 1QJHA 3JSMB 1YG0A 2UXDJ 1RJJA 4I64A 4DV1J 1WTBA 2DNLA 4CO2A 1JMTA 2EK1A 3DXSX 4RBVA 3CDWA 1B7YB 3D1OA 1S1TB 1X60A 2VBZA 3W63A 2VOPA 3EM1A 2D3ZA 4GO7X 1UFLA 1H3DA 1L3KA 2AGOA 5KFQA 3BSAA 1WC4A 3BEGB 2XYPB 4X2BA 3C6TB 2PMWA 3MR3A 2OMOA 1T11A 3M2UA 1SKRA 2WB1D 2PSZA 1VMBA 2YQ0A 1C0UB 1RKIA 1C4AA 4ZOSA 3C6UA 4LT6A 3U02A 2G2YA 3KK2A 1KKHA 4L76A 4CLWA 4OI3A 4E0DA 2IFXA 2YXLA 1T05A 1RTJB 1FFGB 4RW8A 2OIHA 5LXRA 3FRYA 1HR0J 2J6SA 1KOOA 4KO0A 1YBAA 2VICA 1YI2S 1FT8A 2M8DB 1SPBP 3ETOA 5CA5A 3CSKA 3NS5A 1CPZA 4WTYA 4OIXA 5KFGA 2CNNB 1YJNS 3M1VB 3Q8PB 1E6VA 2CPYA 2HG4A 2L9NA 1FKPA 2DCUB 1VBZA 2OMLA 2W9BB 4FKXA 1VK8A 1UWAA 2HNDB 3BYPA 1KQKA 3CCVS 5HVFA 3C15A 3CCLS 4K4UA 1RWWB 3GSIA 4PABA 2QFIA 3J81j 5BYRA 5DETA 5F3TA 3SCIE 3OJSA 1PJ7A 4ZK7M 3TJ8A 1X4CA 1WORA 5K20B 3C14B 4OJHA 4K59A 1JLFA 2RD5C 1B70B 3SFGA 2QTWA 1PBAA 3L7OA 2R7XA 1CJKB 4K4XA 2EC2A 3UQSA 4C11A 2ZH1A 2GX8A 3HXMA 1TTHB 3CWJA 4DU8A 4CLUA 3FCVA 5HLFA 1S6PA 2AX0A 2WK4A 4RWWA 1DQAA 4ZA1A 4HT5A 1N5TA 4N77A 1WJ9A 1KBRA 4ERDA 1Y0HA 3A8EA 3D9BA 5IT0A 3TAQA 3AD7C 4NA3A 4WE1B 1PSDA 4LFAF 2BANB 3CMQA 4HR2A 5E3AA 4P75A 2JWNA 3ILOA 5K8NA 1TUVA 3QATA 2BE2B 3TYTA 2MKKA 2FHKA 3PV8A 4A8FA 1RHJB 1IJEB 3LA0A 5H9FJ 3G6VA 1GMWD 1U24A 1K1SA 4CYUA 4EWTA 3M8ZA 3P49B 1RZMA 5CAAA 3JS9A 3ZNJ1 4F4AA 4FF1A 3V4IA 1SJ4P 1RCOB 4KH1B 2LDIA 4XPCA 5A0YB 5KOWA 2FPHX 1U1QA 2HURA 1RP5A 4MMOA 5LXYA 4C9DA 5D4LA 2PN6A 1B7FA 2R7TA 2R7SA 4F4ZA 1DLOB 2EBGA 3LP0A 2E5GA 2Y1LB 4PG5A 3PKYA 2ZOGA 2Q66A 2HMIA 4OZJA 1N33F 3DLEA 5KFEA 3J7YU 3CDAA 5HN0A 4Z7YA 3OFHA 1IUJA 4C0OC 2BJ3A 4LBPA 4B9MA 2ZOMA 4WK1A 4NXNJ 2IJFA 2I1RA 2CQDA 2K2PA 3JSMA 1OS5A 9RUBA 2NXJA 2VC0A 1VQSA 4XPEA 4W90B 1RT6B 1K73T 4JYAF 2Z58B 5JVGQ 2BJEA 2HAIA 1NBEB 2M7SA 5SUHA 4P73A 4F3OA 1S1TA 3ZFVA 3FBFA 1SC1B 2KKHA 2JH3A 4L72B 2WAQD 2OPPB 1PYTA 3CC4S 3R7NB 4FYWB 1TQLA 4J5OA 5LMUF 3HT0A 4MKAA 4M5HA 4OZ2A 1C0UA 2V6AA 3B54A 5A6WA 1FKOB 5KFKA 4ES3A 2W9AA 4JBCA 5B0AA 3W8PA 1EZZB 3FMWA 3BQ1A 1PG5B 2V50A 4ZJQA 4K0KJ 2KVIA 4KHMA 2BQ3A 2OD4A 3UVJA 1RKJA 1O51A 3B82A 3D6HB 2HIYA 5F8HA 4IUFA 3Q86A 5GMEA 3GLJA 2IPOB 3GR0A 3DMJA 1JB0C 4HEA9 1FRHA 3HSDA 1YJWS 2OD6A 4ZVSB 3UR3C 2WW8A 1WTFA 1XR5A 2RQMA 4JV1A 2J0QD 3M1VA 4CH1A 1QD1A 2MKCA 1C0TA 3HM9A 2L9DA 1PCAA 3D28A 5KFMA 4KKOA 2W9BA 1FE0A 5DLFA 2FJWA 4KSEB 4OI2A 2VUGA 2ZH8A 2CA9A 1HBUA 3KLEB 4CM2A 3IN5A 1RAHB 3Q8QB 5KAKA 4P52A 4Q7AA 2LKZA 1S76D 2Y8WA 3VZHA 4LJMA 5KFCA 1R31A 3W2WA 2CPHA 5K8MA 3BQ2A 4DX8H 3KG1A 3HVAA 3C14A 2ZFHA 4R8UB 2XULA 2F5GA 5AXMA 3T1HJ 1KNZA 4LMZA 3QRPA 4OV1A 4XAKA 3I5AA 2DIVA 3FRZA 4NMLA 4RNFA 4F26A 1ICEB 2DIUA 3MHYA 3EGZA 2HHVA 3OVBA 3BJYA 2MPUA 3AA8A 3SDEA 2XGPA 2RS8A 2PE8A 4PG8A 3D1HA 4OJGA 5D6GA 4NCAA 1OY6A 3AODA 2DEJA 2CYYA 3H5SA 2HHTA 1MG7A 2RRAA 4IO1A 4A47A 3KOAA 2EWHA 4WE1A 4A8MP 3D6FB 2E1MC 4O3OA 3KXDA 1IKYA 3DU5A 4C8OA 5A76A 2BE2A 2ZH7A 4X64F 2DR7A 2N7CA 2AHOB 2BABA 1X4FA 4PEOA 4B3MJ 4KFBB 3M2RB 1DURA 1K8AT 4Q43A 5EHHA 2DGOA 2RUGA 4CLSA 4C8YA 1UPMB 2I9SA 1GXLA 2QA2A 4O3RA 1K9MT 5CQGA 5A0YA 3V2UC 4NE9C 1YKWA 4Y65A 2MGZB 2WW4A 4JI6F 2YNIB 2NQPA 1W2BR 1DLOA 3IO1A 2GO8A 4DLGA 3K58A 2ZH9A 1CEZA 3K17A 3N5BA 5C42B 4EZ9A 1U8WA 1BQNA 2DRAA 5I3UB 1KN6A 5JJBA 1T94A 4KPYA 3U7JA 1YDLA 4ZJOA 4ED0A 1ZOTA 3GIJA 4HH0A 3OLBA 4A8WA 3K57A 4OZ3A 3DNCA 2DNKA 4NYOA 1ZM2A 2DNOA 4ID5B 5IV4A 4FS1A 1IKVB 1WG1A 2DNYA 1U6FA 3ISNC 3I55S 2ERRA 3HVTA 3LAKA 4DS4A 2FLLA 1BWVA 3P5BP 1SC4B 2HHQA 1YJVA 3T6JA 3FJ2A 1PKUA 2CXEA 1OPZA 5AT1B 2YNFB 2OPPA 4DUYF 3NAIA 1F9EB 4I0WA 2OEJA 4RW6A 1HWJA 3IC1A 4OJ3A 3TEHB 4LF6F 2C2DA 1RTIA 1T9TA 5D4NA 2IVMA 4UW2A 2OO4A 4OX9F 5K8PA 2E29A 3TANA 4JI8J 2GGPB 1WHXA 3QLHB 3FZ2A 1RACB 3MPWA 3R7SB 1BE4A 2HGMA 2XNRA 1BWEA 1HPZA 3BN4A 3AFGA 2RIJA 2KYZA 1UJ6A 3M8WA 4QWBA 1HNVB 2W7OA 4NYZA 2BOAA 1Q8KA 2AMCB 6AT1B 1S6OA 2AGPA 1KHVA 2ABYA 4HKQA 4QW9A 1I5OB 1S4EA 3LF0A 3QNWB 5HATA 3MM9A 2FLOA 2A18A 4PQAA 1U7LA 3R9LA 4A46A 3PO5A 1YJ7A 1C1CA 1X4HA 3M05A 3PYEA 5F8LA 5KFHA 3CJKB 3TVKA 1NSQA 1U1RA 3D2WA 4B3OA 1PC5A 3KLIB 3LO3A 2A6MA 2FYXA 5F3ZA 3U1LA 3HVRA 2N82B 4NI2B 2ZM6J 4QYZK 4DCJB 4K8RA 1H7WA 4DHVA 4DFJA 1TVRB 3KLEA 2V68A 5KG1A 2Q79A 2FUG9 1RAIB 4WK3A 1LFWA 4TKTA 4YHHJ 2U1AA 4RZRA 2RQ4A 4WKYA 5IT9Y 4ANEA 2ZBPA 1IR0A 2ZNZA 5C5JA 2I2YA 1FNMA 4J9OA 5ETTA 3A3PB 4ZLNA 2JHEA 4CLLA 2XQCA 5KFFA 1HHTP 1ZAXA 4IDKB 5ETSA 1FTRA 1Q5YA 2WHOA 4ILRA 3ENWA 4ANDA 1BY9A 3G8TA 3ZNUA 3IR6B 5ETOA 1SC3B 4F36A 3ONQA 3J80Y 4O3QA 1RWUA 2KZMA 3T6BA 3F44A 4QIFA 2HAFA 4RBUA 3NBPB 4N5SA 3GYNA 1BHNA 2VBWA 4M5NA 4MAKA 2N3LA 3KUGA 1VC6A 4M94A 4TLQA 3H8YA 2XI2A 5I4MA 4IKAA 2R2SA 2DO0A 2Q1LA 5HK4A 3QO9B 4DPWA 4C3KA 3OT9A 1K0TA 3DOMB 1TK0A 2DHGA 4I6WA 1R27B 3CD5A 1TV6B 4AQYJ 4DSKA 4TU8A 1N34J 2ZHOA 4KFBA 5CH7B 1XTZA 4HTJA 2F9JA 2PT0A 1KOHA 2W2NP 2DITA
chains in the Genus database with same CATH topology
3I0RB 4OHXA 3GV7B 1HNIB 3B4DA 4K2XA 1IXKA 3NCRA 4KE5A 3MMCB 1MSWD 3MGJA 2ZH4A 2DNRA 4P7VA 1UJ5A 5CYQB 2R8JA 1ZPVA 2XMTA 4ATNA 3V4IB 4R5PB 1JJHA 3O1LA 1SV5B 1YJRA 3OTBA 4J9RA 3VAIA 2D7SA 3RBEA 5LL6d 1GT8A 4DSJA 5HMZA 1NJXA 1JKHB 1NH7A 1TKXA 3Q22A 2AYMA 2DGXA 4LFBF 3H5XA 2HWIA 4IOBA 1RT5B 4AL7A 2Z2LA 2HNDA 3C3LA 3ENVA 5KFUA 4E98A 4WU3A 2FVSA 2WBMA 2DNNA 1FERA 4X4OA 3KK1B 1N5YB 4K4ZA 3KG4A 4DWIA 4Q8EA 2QMXA 2YNIA 3LP0B 4G3IA 4K0KF 4DV0F 3IWNC 2HMIB 3DLEB 5C24B 4I2PA 1HI0P 1HWKA 4W90B 4FXWA 3ISND 5C42A 4DV6F 2DPIA 3C46A 1VQYA 1RISA 3D0HE 3BSOA 1FF2A 1R7IA 2XS5A 1S77D 1KEKA 1KQFB 1S1XA 2KDOA 4EU0A 4YB6A 1XBWA 3M30A 3QAUA 1V3ZA 4LUBA 2E1RA 2YWKA 5G0RB 5DGAA 4Q2LA 2YNGB 2AJ4A 4FN5A 5A8RA 2IM1A 1QSSA 3L3CA 1YQHA 1E6YB 5J1NA 3MUVP 4RNHA 3NLCA 5CZXA 3KMSA 3GFZA 4OHWA 2K1RA 3MECA 2C3UA 2CQGA 3MAQA 5KG2A 3W2VB 3FMBA 1KR4A 2B6AB 2I5JB 2FC9A 4RUCA 1YJTA 1WHWA 3IRXA 1NK6A 4ES1A 5L1KA 4X4VA 2SXLA 2NXUA 4J9MA 3L7PA 1KHWA 4ID5A 2P6TA 5T41A 4ED1A 5L1LA 2JEGA 3NNHA 2BQUA 2CQPA 3M32A 3MMAA 4IQXA 1UVIA 1IKVA 4O4GA 4YEAA 2M88A 4PRFA 4O3NA 3VALA 3MUMP 2G13A 4DR6F 3PIOQ 2ASDA 2JVOA 3DLKA 4URQU 3T5LA 1S10A 3OVAA 2YKNA 2GA7A 2BM1A 3BF4A 2W4PA 2ROEA 3H20A 1SUQA 5E0OA 3DRSA 4JI1F 1RTDB 2GHWA 2OAUA 2K3IA 2DGTA 3N79A 4C2MA 2VG7B 4ECXA 4FXVA 4MTPA 3G71S 2L9WA 3NWGA 3DLHA 1J5OB 1JJ4A 3HHLA 3VQTA 2CKWA 4C7QA 1QUVA 3FFIB 2F40A 2R7RA 5F0UA 4ZPVR 2BV3A 2AWZA 3DLGA 3PW2A 2ZC3A 1SIZA 3S7RA 3HKZD 4TYBA 3PZPA 1UVJA 2U2FA 3KNAA 3WX4A 4JI2F 1HNZF 1S49A 2GV1A 3F41A 5EX0A 2YNFA 3TO8A 3U1MA 5EWFA 3UD3P 3ISZA 1VQPS 1MROB 3CMES 3DYAA 4HDHA 2YY3A 1HQUA 1RT4B 3MTKA 2F4VF 2VOOA 1Y3JA 2IA6A 2OPRA 3LP1B 5CXTA 2JL9A 5HBMA 4RU9A 2MYFA 4AUKA 2J5AA 3MOJB 4KHRA 5J2QA 4KB7A 3CDEA 1BQXA 4B9VA 2HHSA 3MMBB 2WTFA 2O5DA 2B3TB 2ZZMA 5KG5A 2JVRA 4WCEQ 1LW2B 3NCPA 2GGPA 2C3PA 3QLHA 4DL3A 1S99A 3T1HF 3C8YA 1FRIA 2BANA 2E7XA 3RRHA 1HYSA 5J2MB 1H0HB 3DHXA 4F4WA 2NPIA 3MD1A 2HRYA 2EKYA 3OFEA 4EBEA 2A1BA 3GFYA 4ZVHA 1FESA 1LFPA 3H98A 4QOTA 5EWEA 2EI5A 5GVQA 3O3LA 2IRUA 4ZPCA 3N6MA 3UR0A 1X7VA 2VQEF 2YKOA 2M4MA 4C8ZA 1FRJA 1HMVB 5EGYA 1VBYA 3Q8SB 5A8KB 1OSCA 2R7QA 5AE1A 4YFUA 2CQIA 3V6KA 4DDFA 1IM4A 3ZZRA 5LJ3Y 1HW9A 1HNVA 4HTIA 5AXKA 1NK8A 3K59A 2Y1RI 4RLEA 3EZUA 4ZVEA 2PIIA 2MXYA 1OO0B 3VZIA 2MKHA 1Y7PA 4CZCA 4DQPA 3GIKA 1WF1A 3KG0A 2RE1A 1WG4A 2D41A 1R3NA 2QV6A 3NGKA 3GQCA 3M8QB 1HNXF 2DNHA 1G6BA 3CJ3A 4NLGA 3CVKA 5HL7Q 3KYLA 1QTMA 5KFBA 1NHVA 3L09A 5CD4H 3NKYA 3TX8A 1U48A 4DG1A 3T5HA 1UFWA 3V6JA 1DHMA 2MZ1A 2NR0A 3E2EA 1Q7LB 3DMJB 1M5SA 2VPYB 5LMNF 3O5TB 3MTJA 2CJBA 5C25B 1LWEB 3ITHB 5IZHA 1D9FA 3DDKA 5CYMA 5IT4A 1I94F 2EFOA 4RW9A 3R3TA 1VC0A 2ZITA 1JLBA 2BACA 3OHBA 2JZ5A 2BM0A 3UI3A 4LVOP 2DB1A 2H5EA 1TK5A 4LF4F 2OPSA 3OSNA 4Q8FA 3P6YC 2RQCA 5DG8A 1PGZA 2DTJA 3CJKA 4D3HA 3DRRB 4OX7A 4DFPA 4IR9A 3J7ZT 4HVZA 1H2VZ 2B9WA 1UVNA 4WXOA 1JJ2R 1LWFA 2IC3B 2YKMB 3I96A 3KLIA 4K5SA 5DO2A 2LMIA 1C0TB 4DSEA 1FDDA 3QGPA 4DR7F 3HJFA 2DHAA 4KKOB 4L3NA 2VZ9A 4TY9A 1P8GA 2O1PA 3KJVB 2OSQA 2OPQB 1SI9A 2LQJA 3OSPA 4DV7F 1VC5A 4B3MF 1H2TZ 2LU2A 2MZQA 3AH6A 2RH3A 4NCGB 1WF2A 1WWHA 4HHJA 4TLRA 3OUYB 1WEZA 1GXTA 1HBUB 3I0SA 3QJLA 1TKTB 3CT9A 2JFKA 1IJFB 2Y1IA 5EWGA 1FEEA 2ZKUA 3V6DB 3DXBA 1R0AB 1IBMF 1U8SA 3OR2B 4R0JA 2V9WA 1RT1B 3C66A 4ICLB 3ZZZA 4ZKAA 1S1WB 3PDNA 5CZVA 3PFEA 4JV0A 2FD2A 1RT7B 1FD2A 3MAHA 3RRKA 5BYSA 2KRRA 1DZ5A 1GTEA 2DH7A 3M8SA 1VQNS 1S1VA 4J37A 3W2WB 1Q8IA 2CFXA 5F8JA 1DFDA 3IWXA 2VBYA 2LECA 3PVXA 1Q81T 4PG6A 3BDPA 2B51A 3UW1A 3QGIA 4IH7A 3M9MB 2UUBF 2OJ3A 2XY7A 2EFPA 5MAOA 1RT3B 3UCGA 1FDNA 5K14B 2AYBA 3IA0A 3OTCA 5K9FA 1KFSA 3CTRA 1HW8A 4Y2MA 4EFAC 4R25A 3OW2R 2XLKA 1YJUA 4NLVA 3SSQA 4LF7F 3BN7A 2BA9A 5KFPA 1RT6A 2CDQA 2DGSA 4NZ7A 1NK0A 4IRCA 1Q82T 2HNZB 1KRPA 5IWAF 2J0SD 2NYIA 1UW4A 3AA9A 4PPDA 4I7FA 5L9NA 1PC4A 2RU3A 4C3MA 5KG7A 1FDAA 4GC6A 1RYSA 4MIBA 3SI8A 2F1FA 2GCFA 2XEXA 5DQIA 2M3DA 3RW7A 3MFHA 2ZH6A 1PO6A 4WFNQ 2JEFA 4IDKA 4QIGA 5D3GB 1ZETA 1WG5A 3NMAA 3JAMY 2W8KA 3M8PB 4NLYA 2EFVA 3GV8B 5IXUA 1MWYA 3GWCA 2B7BB 4QYZJ 5DM7Q 3BGFA 1A7GE 1IBKF 2AYGA 1RTHB 2ZUGA 1FNXH 1QVFR 1KC8T 1M1KT 3NNCA 4H4OB 1U1NA 2YNHA 3FVYA 4ITSA 2R7WA 2N7YA 4AXJA 3DI6A 4X65F 3SYZA 3PO4A 3LANA 5A6PA 2W25A 3MM6B 4F3MA 2AW0A 1M90T 1N54B 4MK9A 1L5UA 1HWUA 4NLUA 3SDEB 2JOQA 3K2YA 3M2UB 1UL3A 1FK9B 4B9SA 2Q6BA 4RX6A 3PY8A 4MIAA 2VG6A 3FEXB 4NLRA 4EBCA 2DVIA 3TA1A 1LOUA 1UETA 4YR0A 2ATLA 4MFBB 4HL9A 1GTHA 6FD1A 4I6YA 3IG1B 3ENQA 3L95X 1JLCA 5F0WA 2XMWA 3I32A 4OMFG 3V5RA 4LIWA 1SIWB 2HFNA 3O44A 4ZS6A 3KK3A 3PEJA 4DL7A 2P5VA 3NBPA 1YRXA 3BGLA 1FKOA 3SCLE 1KS2A 4KV8B 3KK2B 1YSJA 2MJNA 3RR8A 1MW7A 2D3UA 7FD1A 2IMOA 3KLFB 4KR0B 5DDQC 3GIMA 3HK2A 2FHJA 5G4DA 3PR4A 2LLZA 4WFZA 3HP6A 3SSRA 1QSLA 1RK8A 1T05B 3CB4A 4H4KC 5KT3A 2UV8G 5HMXA 1MU2B 3IGNA 4QIVA 4RW8B 3WC0A 1HQEA 2AQ4A 4LIRA 4DR1F 4U67Q 5KFIA 3KLGA 2M9KA 5ADZA 2DK2A 3U1NA 1M5PC 1N32F 3RBDA 1IKYB 4USHA 4I2QA 4ZPDA 1B0PA 4RW7B 3MFIA 3KHGA 4PWDB 2E5HA 3GIIA 2JSXA 3JB9k 2KXHA 2HIQA 4OI1A 4JI4F 3DOMA 2X1AA 1UVLA 3POTB 1O8BA 3TP2A 3M6VA 3BS9A 3OR1B 4Y2KA 1TV6A 3FSXA 5AXNA 3OXLA 4X4QA 1QAIA 1YJ9S 1QE1A 4GO5X 1OQ3A 2VH7A 3IRWP 4WFBQ 3K7RA 4K4TA 1DTQA 5FD1A 3SV4A 2IM0A 2FJAB 4PR6A 5HP1A 2JRSA 4GMKA 2HFZA 2COLA 2P9GA 5J2PA 3TI0A 2VKZG 2Z2MA 1JXEA 5AE3A 1U1LA 4ZMMA 1QLNA 4JI3F 2L41A 1U2FA 5IM0B 3PJWA 2M8HA 4ED8A 1GNKA 1WI6A 4JI8F 3I5BA 5DM6Q 1YITS 1KLNA 2QT7A 3TVZA 3GR1A 3OL7A 1HNIA 2EK6A 2LU1A 4IG3B 1E6VB 4Y2CA 5I3QA 2KT3A 1P9QC 1HFEL 4PXDA 3T9ZA 4ED3A 4EEYA 2LXIA 2B9YA 5CYQA 2KXNB 3VAMA 2M5YA 2J8AA 3BGRB 4A48A 1FJCA 2QE5A 2VASA 4NLSA 2ZDPA 3NP5A 1FKPB 3TQ1A 1HNWF 4JV5F 4OI0A 3OFGA 1N36F 3IXQA 1DQ8A 3MEEB 1VQKS 3JTNA 4BHQA 1ZTTA 1JKHA 2DD8S 4DQRA 1JXLA 2EFQA 3MOZA 1EP4B 3N4WA 3OTDA 4B9TA 2KM8B 1VOMA 1V9OA 3HLUA 2IYGA 2VV5A 1RT5A 4ID8A 1JX4A 2V9KA 4N8OA 5CYJA 2POKA 3LW5C 2DNGA 5JUMA 2E9ZA 1TZ0A 4DSIA 4B3SF 3KK1A 3H5YA 4ECUA 3IWLA 2X51A 5T7LB 2LEPA 4C4WA 1Q79A 1U1PA 2CJAA 3THVA 4GC7A 2UVRA 6FDRA 5B0BA 3CCUS 1QY7A 3M2VB 4Y6IA 3T9NA 3SZ2A 3DCAA 1P1LA 2PD1A 2AD9A 1B0VA 2FVCA 3MM8B 3G4SS 2KU7A 1V6HA 3T1AA 1BQNB 1FA0A 2W8LA 4WXWA 1JLQA 2W9CA 2D9PA 1H7XA 2KJWA 2F8EX 4H4MA 4JUZA 1IKWB 4CO3A 4NX9A 4C8LA 1N8RT 3RB4A 2J9EA 3PX0A 1KLMB 2YNGA 3ULHA 1H2UX 1E6YA 1X5SA 2QMWA 1FXLA 3D0IE 2DNZA 3IS9B 1IQTA 2ZHAA 3CC7S 1SH0A 2XGQA 1SB6A 1U45A 1JLFB 3HT3A 3NG8A 4NLPA 4ZP8A 4B9NA 2E1AA 4V19X 1VQ7S 3S1TA 4NPOA 4KT0C 2FHOB 4R8UA 4DLEA 4RU2A 2I5JA 1U2RA 2V8GA 4H4KA 1XEZA 1BD6A 1FCAA 1HD0A 2DHXA 4UY8T 1UJ4A 3D1QA 4C11B 5F8GA 5E2QA 2WRMA 3IAM9 3QAEA 4FXDA 1ROFA 2MKIA 3G6ES 3OBIA 2C2EA 3HVTB 2KTQA 2XWYA 4Y28C 4KC5A 4J9QA 2L3MA 2QZ8A 1GXUA 2DISA 5KFOA 5HROB 2VC1A 5DLGA 5SZTA 1UA1A 5CCLA 2JLEA 3MM5B 3MUTP 1NJWA 4X62F 2DNQA 2ZM6F 3BR8A 3H2UB 4PXCA 2VG7A 4ECRA 4KBIA 5AE2A 2RILA 1ZZFA 2N3OA 1X9SA 4XDDA 1J5OA 1HBMB 2RKIB 1NRKA 4CH0S 3FFIA 4IOCQ 2HW3A 1TFYA 2DR9A 2ZJPQ 1FO1A 3TA2A 4WKRA 2VFRA 5E3CA 1VQ5S 3LUYA 3E8OA 2E5JA 5GADI 4PPZA 1L3UA 2EBEA 1Y3KA 2XY5A 3JYTA 3MI7X 4YHHF 4FVMA 1MROA 1KVIA 3VWSA 4MH8A 3BO4A 5FLXY 2B5JB 2ZH5A 5IS2A 1RT4A 4RW6B 2MQLA 5CCMA 3P3DA 3LP1A 5E33A 1B64A 1SL2A 3J7A1 2GNKA 3KLHB 2C3OA 4NA2A 2JX2A 3R27A 1RTIB 1RGVA 3MF5A 2AX1A 3N28A 1NKEA 1KQSR 1VQ9S 4KAIA 2YVSA 4F3QA 5F9LA 3RAQA 2PA3A 1LW2A 5E3RA 3F56A 4FZVA 4YQWA 3LALA 2C2RA 5ITHA 4G1QB 5HI7A 3BQ0A 4MYUA 5B0GA 3T5JA 1G2EA 5KT6A 1AXQA 2IA0A 4K5RA 1X0FA 3FEYB 4O44B 3N01A 1T8EA 4AL6A 4XO0A 2R9LA 1QVGR 4O3SA 2W7AA 2YWHA 3GYXB 3IAS9 1LW0B 1OSDA 5KT4A 1HPZB 3TNVA 2LEBA 1T3NA 2LVWA 2CPXA 2GFFA 3FSYA 2PMZD 1NNDA 2PDAA 4TYAA 3RU0A 2HLUA 2E44A 1R8HA 3T3FA 5L39A 1REVB 4NZ0A 3THTA 3R1LA 1U26A 2JLFA 1XR7A 4YDXA 3I5CA 3M2RA 3QWPA 4EO8A 2W24A 4X4UA 4NL5A 1V3RA 1U25A 5EUHA 3CD7A 4Q0BA 2KG0A 2R7UA 2FHJD 2ZZNA 1F5CA 4U9RA 1XK8A 2HPUA 1UP1A 2C42A 2Z0GA 1JK9B 4BC7A 3K5LA 1SBRA 2X1GA 4Y3CA 2RDIA 2QA1A 3THPA 2A10A 4N8NA 4ELTA 3LGNA 3NAHA 2F8HA 4WU2A 1YTYA 3MM9B 3T1YF 3BR9A 2ILYA 4IG0A 1KVJA 4NLWA 3I56S 3HKWA 3I9V9 5L9XA 4YY3F 3QJJA 3Q8RB<