1HR0F

Crystal structure of initiation factor if1 bound to the 30s ribosomal subunit
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
101
structure length
101
Chain Sequence
MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLANA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of an initiation factor bound to the 30S ribosomal subunit.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 26
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2000-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01250 Ribosomal_S6 Ribosomal protein S6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1hr0F00
5LMUF 2VQFF 3OTOF 1HNZF 1XNQF 2UUBF 4LF6F 4DV4F 3ZZPA 3T1YF 4JI4F 1HNWF 1IBMF 4JI5F 4DUYF 4LF9F 4LFAF 4KHPF 4B3MF 1G7CB 3T1HF 4JI7F 4DUZF 5LMNF 1N34F 2J5AA 2UUCF 4JI8F 4DV6F 1IBLF 4LF7F 4JV5F 2RJZA 4LF8F 4DV7F 4X64F 4B3TF 1XMQF 2B7BB 1IBKF 4DV0F 1XNRF 1FJGF 2E5LF 1XMOF 5AJ3F 1HR0F 4OX9F 4DV5F 4K0KF 1FKAF 4DR6F 1LOUA 5IWAF 4JI1F 1N32F 4DR3F 4GKJF 1CQMA 4DR5F 4LFBF 2UXCF 4AQYF 2BXJA 4B3SF 4YHHF 4DV1F 4NXMF 2UXDF 1QJHA 4DR7F 4X62F 4JI0F 4JI6F 2KJVA 2B7CB 2KJWA 1IJFB 4X66F 1HNXF 2YY3A 4YY3F 2BVZA 2VQEF 4DR1F 4NXNF 1VMBA 1F60B 4GKKF 4LF5F 2ZM6F 4LFCF 4B3RF 1I94F 1GH8A 1N36F 4LF4F 1N33F 4X65F 4JYAF 4JI2F 1CQNA 2UXBF 4DV3F 2F4VF 2HHHF 3R3TA 1RISA 2UUAF 2UU9F 4DV2F 5BR8F 4DR4F 4JI3F 1G1XA 1J5EF 1IJEB 4DR2F 1B64A
chains in the Genus database with same CATH superfamily
5HATA 4B3OA 2I1RA 2KYXA 4ZCLA 3S6EA 3F0NA 3SI8A 4UT4A 3D68A 1FRJA 2DEJA 3QBCA 2HRUA 4N77A 3LA0A 4NI2B 5A8KB 2NXCA 2ZH9A 2XY5A 4IR1A 1TQLA 3FEXB 3G86A 3HFVA 2GAGC 2W2QP 4FYWB 4OJ1A 3ZZPA 3QGIA 4N56A 1BWEA 2RQMA 1SJRA 2GMHA 2V94A 5KG5A 3THVA 4P71A 3H42A 2V4RA 2XLJA 3LW5C 5L38A 1VJQA 1RT4B 3GFXA 2AF6A 5ETSA 2G9OA 3PW0A 5KG3A 2B51A 1VRUA 4MH8A 4C0OC 5HLFB 2ZJRQ 1N34F 1M5KC 3FJ2A 2HAIA 2EW9A 3BKUA 1VYAA 3W8PA 3M8QB 3AA8A 2UUTA 4ZN1A 4ID5B 3OSNA 4P7TA 4R5PA 4Y28C 4NXNJ 4Q8FA 1Q0NA 3B54A 1DARA 3LP0B 1FRLA 1Y5NB 1XMOJ 5KFDA 4KFBB 5EN1A 5IXUA 3R2CJ 2VG6B 1D9FA 1JQGA 2QSFA 1C1CA 1U49A 2HURA 1UETA 1XMQF 4B3TF 2B7BB 4OMFG 1LW0A 4CRJA 1FXLA 2YWEA 4CO3A 4DV0F 4NLWA 5AXNA 3AD8C 3HULA 2FTRA 2KRBA 1M1KT 3HD1A 2PMZD 1UFKA 3DMJA 2JDJA 3M05A 3UVJB 1D9DA 2FJBB 3PCOB 1J5EJ 1TKXA 3MUTP 3F44A 2IC3B 2ZOGA 4ZKAA 4DL7A 3CE8A 3H5YA 2W9BA 2HQDA 3WQPA 2HNZA 2QTWA 2DH8A 4I2QA 4DF4A 1URNA 1NDPA 3MPUB 4KSEB 3G8TA 3MPDA 1WC0A 5KOWA 3TJ9A 4FF4A 1DQ8A 3PW4A 3KDNA 1SB6A 1SJFA 3LTOA 1PGZA 4JI7J 2WK4A 1CJKA 4AQYF 4B3MF 2CYYA 1U6FA 3GYGA 3PEHA 4B3SF 2QRRA 4KH1B 2YX1A 1F5BA 1MROB 1QJHA 1WDDA 2NPFA 1K73T 1JNRB 1RWWB 2EXUA 4ITSA 1M5HA 4CDIA 1TMMA 5A6PA 4FS1A 4KKOA 1H2UX 1V5IB 2IHR1 1HBNA 1RT5B 3D1OA 2BKNA 4K2JA 4IQXA 3NMAA 5KFPA 4NLDA 4DU8A 2O3DA 4ZLNA 4DUZJ 3LQVA 5C2CA 3W5YA 2G0CA 2C3YA 2IA6A 3R5GA 1WHVA 1BQNA 1TAUA 2V2QA 1FRKA 4GKKJ 1Q8IA 4YB6A 4NZ0A 3MM6A 2LMIA 1R27B 5DQIA 1DQ9A 2DHXA 3DDIA 2BR0A 4KHPJ 3KHHA 1YQHA 2Q43A 1BQNB 3PV8A 4QJVA 3W1YC 3G6XA 3FGVA 3KLGB 4PWUA 3OFGA 2RF2A 1B3TA 4NLVA 3DI6B 3GR1A 3I4PA 1T9VA 3ISNC 2P8IA 4IO1A 4C0HA 2XLKA 1ZAXA 5KFVA 1RAJA 4OYWA 3W61A 2YX4A 5DM6Q 2F65A 2Z57B 1S1UB 4X4OA 2B9YA 4DR2J 1XNQJ 4XAKA 3KK2A 2HVHA 4ZLJA 1RHQB 1WC3A 1S1VB 2NS1B 2A0FB 4DV3F 1FJ7A 3I9ZA 2GVDA 1HYSB 2OO4A 1KFDA 1F9HA 2DY9A 1TL1B 2VKRA 2W2MP 4M5DB 3V81B 2ADCA 4CLZA 4IR9A 1K0TA 5CCLA 3AOCA 1OWXA 3GU0A 2BRKA 3I0SA 3O3LA 4FYYB 4P74A 5FDLA 5KT5A 3CJSA 3KHRA 1L5UA 3QO9A 4KC5A 2KZMA 2ZBCA 1KR4A 1RTHB 2LEAA 4PAAA 2K7JA 5DRKA 2DNQA 4DSFA 3P96A 5I42A 4ILRA 1Q86T 2KXFA 1VI7A 2GIQA 4PXEA 5JVHQ 2J9EA 2LU1A 2LEPA 4ED1A 4LSNA 1U48A 3PR4A 3DYAA 2XY7A 5HMYA 3UPFA 5EWEA 2E5GA 1EQMA 3M9MB 2YNGB 2COLA 2C2RA 2HHXA 3J81Y 4Y00A 4A8QA 2CAJA 4NOHA 2ASJA 1T9WA 1HL6A 2M2BA 2PMWA 3HVTB 4RKUC 3WX4A 5LOQA 4Y2IA 3JAMY 4Q0BA 5H9EJ 2OELA 2F1FA 4O0NA 3Q2TC 3R5DA 2KT2A 4CP5A 4TY8A 3OVAA 4JI7F 2A2CA 1FE4A 4OZ1A 4U96A 4EU0A 2YH0A 3NBPB 4GO7X 4W92B 3UDCA 3TRGA 4J5OA 5T7LA 1RADB 1T8EA 1IN0A 2G1HA 3GFYA 2V68A 3PM9A 1VRUB 5KG7A 1VLOA 2FLNA 4LMZA 3MCOA 1W26A 3A3PB 4HDGA 3C19A 3OVSA 5ETNA 3JQKA 3CMES 4JV5F 3M2RB 5K9FA 4CLLA 3JAMU 3MEGA 2CPZA 5T14A 3T5KA 3AQPA 1JLBB 1S0MA 1SJQA 3RR8A 3DKDA 1BQXA 3QAEA 3R5CA 3CJ5A 4L72B 4MKBA 1RT4A 4P10A 3K8WA 1JB0C 1Q79A 2DR9A 2MY8A 5KFNA 2NSCA 4FXDA 4NXMJ 4Q2LA 4WFZA 3M8PB 3IR6B 1HQUB 1T9TA 2ZD1B 1VRTA 3HI9A 1ACMB 1RT2A 1F9EB 2CJ9A 3GYNA 2DGTA 4Z7YA 4ZVOB 3VGSA 4EWTA 2EK6A 4YEAA 5LSLA 1D09B 4ZVEA 5LSOA 1T9YA 1KLMA 2OD6A 2POKA 3ILOA 3OPKA 5CH7B 5E3AA 2ZH2A 4GKJF 4K0KJ 2GQ2A 3ITHB 3M6WA 1U09A 2V67A 3DRRA 1NKBA 3IP0A 3OR1B 2AJ4A 1SQGA 2UXCF 3V6KA 2NZ4A 1Y4ZB 3HM9A 2B5JA 5ETTA 4ED7A 2DNZA 3GP9A 3Q8UA 3GV7B 2CPEA 2R3VA 1LK7A 2C3OA 3IO1A 1XTZA 2I38A 3PXGa 3AD7C 5C42B 3TZXA 4F8RA 3TYTA 4RX6A 2DR8A 2CIMA 3CJKA 1WHYA 2DGOA 1M5PC 2I9SA 4EO6A 1JKHB 3DCAA 1H73A 2KH9A 3K58A 2BUNA 4ZCKA 1YJ9S 4ED2A 1DURA 1HNXF 2E66A 3BH6B 1ROFA 2NYIA 2EFPA 3N6MA 4PQUA 2QFJA 2GS8A 1FCAA 3AH6A 3R7BB 4ZMMA 4NXNF 2OMLA 1HQEB 4KV8A 2RQKA 3BYRA 1FXRA 3G82A 4QW8A 5B0BA 5I4MA 1RAGB 2W9CA 1O5JA 2BRLA 3BGFA 4NE9C 1RTZA 2UP1A 5ETLA 1KRPA 1RT5A 3ENVA 1XJWB 3G2XA 3BPSP 1PC4A 4QIWD 2RMLA 4C97A 4QWEA 2J7WA 2QLJB 4CO1A 4TU8A 4OI4A 3M9NB 1VQ5S 2DPJA 4K50A 3GSIA 2P2CB 3MI7X 4X65F 3NLCA 2GC8A 2DKOB 3BH7B 1JLCB 3I0RA 5A2QU 3EZ5A 2BE2B 4U9RA 2BABA 1C4CA 4AL6A 1TKZA 3AAWB 4LIRA 4WIQA 2MJUA 3D0IE 5DZ6A 4NASA 4ZPVR 3OLAA 3O5TB 4LRFA 1CBKA 3KTQA 1JXEA 1C4AA 1KQSR 2GW8A 3M6XA 3VHQA 2QT7A 2LEBA 5IT9U 1PCAA 1IR0A 5I42B 1ICEB 1RWVB 5EDWA 1TUVA 1RZMA 1S6OA 2FHJA 2ASDA 4EBEA 4M5KA 2VFVA 3FQKA 2NPIA 3SSSA 4BS2A 3OW2R 1OY8A 5KFXA 1NJIT 4JI3J 5KFEA 1U2RA 4ZLPA 2XI2A 2UVUA 2FC9A 3HP6A 4DSLA 4UUWA 2LQBA 1D9AA 2AJFE 5CCMA 4DV4F 4IOCQ 3RW7A 2DPIA 4IG0A 4AUKA 4WFAQ 1RBAA 4OX6A 2MXYA 4C4WA 3CCSS 4YHHJ 3PG9A 3DFEA 3I5BA 3QJLA 5CHCB 4OI2A 3R1LA 1YG0A 2XC9A 3EDRB 2J6TA 2EVZA 3E8OA 2HNDB 4J9VA 4N76A 1WC1A 2OEKA 4KGMA 4U67Q 2C3PA 4WXWA 4UY8T 1IKVB 2HGMA 2RD5C 4ZVRB 3BBBA 2ZNYA 1VBKA 4RBUA 5KT2A 2G2ZA 3JQJA 3KLHB 3RRGA 1FFWB 3N79A 2L08A 2RRAA 2E9ZA 2P9EA 1HR0J 3R5AA 2DR5A 3NS6A 5GMDA 3DLGA 3NNCA 2ZBPA 1Q1KA 2RJZA 2VH7A 3PJWA 4OIXA 1QLNA 2RKIB 3TANA 1SUQB 1MMDA 2ZZTA 5IQQA 2EC2A 3HFZB 3I4HX 3I5CA 3NCQA 4DV7J 4P2MA 4R25A 2C3UA 3TUIC 2CDQA 2P5VA 3ZTSA 1D3WA 2HIYA 5E33A 4DSEA 5DLFA 1S9FA 3W2WB 2AJQA 3M4XA 3EGNA 1BMQB 2CJBA 3ITHA 4ES3A 1YVFA 2W7PA 1QD1A 3VZIA 2B5JB 3EUNA 4MFBB 1CQMA 4PEOA 1YK9A 4CI0B 3JSRA 4KTQA 5SZTA 3VAFA 3HVAA 3I82A 1ZH5A 4TQRA 2CPXA 4ZCIA 2ZC4A 2VA2A 1B70B 2KZZA 2WVDA 1IKWA 4PUOB 3ZNJ1 1HMVB 2I5JB 1FFSB 3RAXA 1DLOA 3QSYB 2JHEA 3JXOA 4O44B 4B9TA 4F2RA 1HIYA 4FBTA 4LBIA 3LWMA 5IV3A 3R8YA 2HKEA 1P6TA 1UFLA 2B7CB 1O51A 1S6PB 4K4ZA 4S0MA 1DRZA 2DXFA 4IQMA 1HBUB 2KI2A 3CIZA 2RB7A 3W65A 2L41A 2C28A 2FIUA 1JK9B 1WACA 3NXZA 2BVZA 1EQ0A 3FCVA 1VC5A 1JIHA 1VHIA 1TV6A 2CQIA 4NLQA 3EXCX 5CD4A 4WJBA 4QU7A 5L39A 1YJTA 4FPIA 1Y9OA 2QG9B 3MZIA 2XS7A 1H7WA 4N5SA 5ITHA 3S8SA 2WTFA 4RUHA 3BM7A 3DOKA 4JUZA 3ET6A 2HK2A 1A6LA 3EZOA 2MZ1A 3CD6S 3QIPB 2W8LA 2LVWA 4TLRA 1EETB 1S1WA 4YOEA 4DUYJ 4QU6A 2XCPA 4F4WA 3IBCB 3MUMP 1WI6A 1OQ6A 3NY0A 4M5HA 2JLGA 4OYBA 2EWHA 2LXIA 1NAQA 2EBEA 1W2BR 4ZVGA 1PC5A 4DV2F 3C15B 4C8KA 3PTWA 3W66A 1N6QB 5FDLB 3D5MA 4XDCA 1HNVB 2UUAJ 2GV1A 2PE8A 2PI4A 4J9OA 1H72C 3TEGA 2X3GA 1S79A 1NXIA 1TP7A 3R9LA 2M3DA 1JLGA 4DR2F 1B64A 4LVOP 5I3QA 4WF9Q 2VQFF 3UN2A 2B43A 3EM1A 4RBVA 1T3OA 1VFJA 5AXKA 3G6YA 3A8IA 4DV3J 2UUBF 3I32A 2GGPA 4WK1A 3TX8A 4B9LA 2HZVA 2XZDB 3PW7A 1CSJA 3D1QA 1BY9A 4WFXA 2DNOA 2DJWA 1O6XA 2ZBRA 1GX6A 2ADBA 5F0WA 4F0HA 3KJVB 1RAIB 1VOMA 1PG5B 2HG4A 3U02A 3K5NA 1UAWA 4QPTA 1YBTA 4DV6J 2DGUA 3W3SA 3V4MA 2KVQE 1J27A 1RT6A 1B4SA 1XQIA 1EZZB 2QZ8A 1L3TA 1J5OB 3ILJA 4K4XA 3KLHA 3MEEB 3C16A 4LRBA 1FWKA 1WC4A 4PCQA 2DB1A 1NM2A 1RTJB 4I6WA 5B0DA 3AOBA 5F9NA 3E2EA 2LDIA 1QAXA 1N8RT 3H5UA 2CQ0A 1TL7A 5IT0A 1KLNA 5C2GA 2HQCA 4A8SA 2PFFB 3D0GE 4ZPBA 2H5JB 4USJC 4X64F 2IVMA 3HT0A 2XEXA 1KOOA 2H65B 1KN6A 1M0SA 1RWXB 2LDYA 5CZVA 4IG0B 1B99A 4OX9F 4C98A 1N5TA 3HSZA 5D3GB 2HIQA 2RAQA 3C3LA 2BX6A 3Q83A 3LAMA 2FDNA 1Z2ZA 1Y11A 1RK8A 5KFAA 1VC6A 1FKAF 4DR6F 1TKTA 1VISA 2BW2A 2MSSA 3IFEA 4F26A 5L9NA 5KFQA 2R7TA 3DU6A 5HMXA 3DRSA 2JLFA 4QIGA 3H4BA 2CZVC 2R7RA 2ALYB 3CCTA 4I7FB 1E6YB 3O44A 4DPTA 1RI7A 4ECYA 3D6TB 2IA0A 4LBHA 4CH7A 4L74A 2RH3A 1S1TB 2M70A 1MLAA 9RUBA 3GJRB 1QUPA 4ECTA 1FVSA 2AQ4A 4PWDB 1H74A 4NXMF 4QWDA 1RQ0A 4G1QA 4KJIA 4DJBA 1T03A 2JOQA 5HN0A 1WOOA 2F3JA 4YB7A 1HMVA 2I5JA 3MXHP 2R2TA 5HP1A 2F63A 1WKKA 2ZDPA 2P9GA 2ZH5A 2OAUA 4X66F 2HFZA 2YXLA 3DGPB 3ENAA 3AY0A 1QUVA 2WCXA 1RWUA 2E7VA 4HHHA 1HA1A 2HS3A 3UD5A 1YGYA 4O4GB 1WG4A 3AOAA 5AE1A 3K57A 3VALA 4DR1F 2WHOA 2WOMB 3DM2B 5IOLA 1N6QA 4YMEA 1PBAA 4HACB 3MPYA 1HQEA 3D28A 1VJWA 3PR5B 4OHWA 3NWRA 4ZP7A 2XCAA 2GCFA 1CJVB 4YN3B 4YR2A 2FJVA 1I94F 1S12A 1MMNA 1TMJA 2ZJPQ 1FKOB 1CJVA 1WNEA 3M2VB 3PHEA 4QR1A 4LF5J 3MMCB 1H6KX 3IR7B 4FYVB 3DOKB 3I55S 2XMJA 1HPZA 4ZVSB 1RKIA 4E2FB 4ED3A 2AYGA 4JP8A 5KG2A 2HRTA 1M90T 1KWMA 3IAM9 2J9CA 3ZZYA 1U7LA 5F3ZA 3DU5A 5B09A 2JEIA 2WOMA 4OHYA 4UQTA 2OD4A 3A8EA 4Y0FA 3VGVA 5I3PA 2RQ4A 4FPRA 2ZZNA 1N48A 1H3DA 4TY8B 2ZDOA 2JC1A 1HWKA 1FRXA 1U2FA 1JLQA 4B9NA 2B8PA 2CNKB 1WEZA 1LWEB 3KJFB 4IFYB 2QYCA 5D77A 1LNQA 1PSDA 4OLPA 4RO0A 4WFYA 5FIIA 2YNGA 3Q8QB 2CPJA 1DTQA 3RGIA 1ZM3A 2AYEA 2FVCA 2VHGA 2ZH8A 1DY3A 4OLOA 2MZTA 2JH3A 3SCJE 3GZ7A 3D2WA 4DQQA 2QO3A 4UW2A 5IT9Y 1RUSA 2HFOA 1N33J 1Y7PA 1RE1B 2XBPA 2ACYA 3MM7B 4O0IA 4ZVUB 2VPZB 3MR2A 4DL2A 1WWHA 3J7A1 2W01A 3DRSB 4MFBA 1X9WA 4LQ9A 3BGOP 4IRCA 3IA0A 3T1HJ 1B0VA 1S99A 4OI3A 7FD1A 2E7XA 2R2RA 4KH0B 3OFEA 3W7BA 2AMCB 1DQAA 1JJ2R 1XMQJ 5T7LB 1TL4A 2UUCF 3QSIA 3H5XA 1VIOA 3AODA 2HVIA 3M1VA 2JNJA 5E5NA 1NH8A 1S4FA 1HI1A 4UOFA 2R7OA 5HROB 4DL3A 2FVRA 4LF7F 2EEYA 1FERA 4MMOA 3EZUA 3VVUA 2XWYA 1CLFA 1PJ7A 4GO5X 4UQGA 1Y10A 2HWHA 2DIUA 1RT1B 4CH1A 5ETKA 1AROP 1MG7A 3A3NB 1SIZA 5K14B 1GFWB 2JZ5A 1I51B 1T0TV 4ANEA 5B0CA 4HDHA 3BDEA 4P2SA 2CDRB 2E5LJ 1IKVA 3HHEA 3OD2A 3ZTPA 3LGNA 5I3UA 5DZ7A 1KVIA 1Z1ZA 2R7WA 1HHQA 2AZ1A 3LANA 3NCPA 3QGPA 4WWSA 2G13A 2ROEA 4CT8A 6FD1A 3CW2C 3SQOP 4OJHA 2HRYA 4KB7A 3BBCA 3Q89A 3MD3A 3MECA 1HWLA 4RPFA 5CYQB 3UDVA 4DXLA 1OY6A 1IQZA 3GLJA 3BGRB 3O6QA 2CKWA 1OQ3A 3QT5A 3T6BA 3X3UA 2VBXA 5L1KA 2EFQA 4OV1A 3GB0A 5HVHA 2MKIA 5F8HA 3N28A 2C22A 3J7YU 1U26A 3FRZA 2BM0A 5D4PA 4PR6A 4LF6J 2EG2A 2GFFA 4I64A 2IY5B 1PJ5A 2OKQA 3I9V9 2W4CA 4K5SA 1K47A 3VGUA 4C3LA 4F0KA 5HSPA 3G96A 3HSJA 1KP6A 5CYMA 2R7UA 5E3RA 1CJUA 3DC2A 2MGZB 3HJVA 1UA0A 3CJ2A 4ELUA 2RRNA 2O01C 2YX7A 2XY6A 3H5SA 1NDLA 2HHTA 1RB0A 2ZOMA 3A3OB 1NU4A 2ZHAA 1C0UA 2AGQA 4ES1A 1F60B 2CQ3A 4F3OA 4WZQA 4ILMA 1IKXA 4RUCA 2R8KA 3AHPA 1WHXA 3M2VA 1EETA 2HBQB 2BJ8A 1JLFB 2DNLA 5T41A 3DDKA 4E98A 4LVNP 1IM4A 1SVDA 2QLFB 3BR9A 1S1WB 3KJNB 4HH1A 4NEZA 3H4DA 1RLDA 1YRXA 4YB1P 7FDRA 4FF2A 3P49B 1OYDA 1N52B 1RBLA 4UY85 3ET6B 4DX6A 3KUEA 4LF8J 3DRYA 4JI2F 2CJYB 5J1PA 1KOHA 1FRIA 1FNMA 1RAEB 1VS3A 3FEYB 1ZA2B 1OMSA 1YSJA 2FY8A 3Q86A 4YUDA 2MMYA 2VPXB 3R3TA 1RISA 1RWNB 2A6MA 6FDRA 3KYLA 1TV6B 1UMJA 3NWGA 4OZLA 2FJEB 3A12A 5A8RB 5HL7Q 2BOPA 3CNQP 4I0WA 4ENOA 2MYFA 2X1BA 1P9YA 4YDDB 2ZWOA 4UOGA 4FN5A 4NCGB 2KN4A 2DNHA 5LSRA 4UF4A 3IGNA 3BS9A 1T3NA 1N4LA 1AUDA 4EYHB 2BKOA 4LIWA 4USIA 3JYTA 4DQIA 2ZJQQ 1IR2A 5LMUF 2H51B 5L9XA 3ILLA 1WKJA 3DYAB 3M6VA 4C7QA 2D69A 2EPIA 4C8NA 4HYKA 3CPWR 3RTVA 2WZ1A 2DISA 3M8ZA 4A46A 3BZQA 3OTOJ 2A18A 3P5TL 2OPRA 3PZPA 4K59A 2B8QA 3Q0AA 4P73A 4JI5F 3V2UC 2AKWB 4FYDA 1SQFA 4KGXB 2IDEA 1SL1A 1FHTA 4IG3A 2HHSA 3TUPA 1FK9A 4H4MA 3PW2A 3I96A 4IFYA 2LLZA 3C46A 3J7Z5 4DR6J 1NHKL 2D3OR 1S57A 2W1BA 1L3SA 1YDLA 2M4MA 2VC1A 3OL6A 5HLFA 1G3OA 2AWZA 2VJVA 4IRDA 3SMZA 4Q43A 3QWUA 2XYGB 4KBIA 2OPQB 3TA0A 1XMBA 4QIVA 2DNMA 3HXMA 3BGUA 4FXWA 4CO5A 4DV7F 3EX7B 1ITPA 4ZITA 1R31A 3TVKA 3VAGA 3HMJG 1N54B 1XNRF 3W5XA 1VRQC 3K17A 5CAAA 3NGSA 4FF1A 4OHXA 1SUQA 2OHDA 2VFSA 5KFOA 2ZH7A 3PEJA 1XC9A 2HVDA 3M30A 2HMIB 4CLPA 4ELVA 2NR0A 1C1BA 1LOUA 1UFWA 3EVWA 1TK0A 1C2PA 3D0HE 3VCDA 2AYBA 2WSCC 3M1VB 4TQSA 3UCZP 3M6UA 1CC7A 3M7VA 5M2UA 1N56A 2QLBB 3IC1A 3P8BB 4L75A 4ZA1A 4O4GA 4AXJA 1LV5A 4WZMA 3GIKA 3NKYA 1R0BG 5IWAJ 3TI0A 4ATNA 1C0TA 1KDNA 4K7QA 2HZCA 4CLTA 2E1PA 1X8DA 2PIIA 3CIMA 3IM9A 1TVRA 4P52A 4OYXA 4X62F 3IS9A 3HK2A 2HQGA 3ZTQA 1M5SA 2Y8WA 3WC0A 1IJFB 1RAOA 3BO4A 2B56A 1SQEA 2Z4PA 2ZE2B 2HVEA 2F7VA 2YTCA 3QATA 4ICLA 3J80Y 4USKA 2XULA 4A8KA 2IBKA 1WF0A 5DETA 3AB2B 5A2QY 1U0SA 2HGNA 2F8EX 2NXUA 5B0EA 1RWPB 4DR4J 3VZHA 1L3UA 3UD4P 1N5SA 3ZFVA 5AE3A 1BXNA 5HANA 1OSDA 2AJ0A 4A8FA 2R9LA 4F4KA 4B9MA 2WRMA 4O3NA 4LF7J 2IM0A 2MKCA 3MCNA 1WEXA 4FKXA 2PT0A 5LMNJ 2OP5A 3CF5Q 3PO5A 2Y1RI 3KLIA 4KQZA 4ECSA 1S1UA 3CEDA 3AJ1A 2GMJA 2BE2A 2DGXA 2YNHB 5F0UA 2NXNA 1JLCA 3I0RB 2C2NA 5F8IA 1JJHA 1MN9A 4DWIA 2UVVA 2F4VF 1YZ7A 2UU9F 1HPZB 2UUAF 1WD6A 2W2OP 4A47A 3GFHA 1AZSB 3CCES 1OY9A 1RT3A 4I2PA 2R8HA 3L95X 2WVEA 2D3O1 2WSEC 1X9SA 4JI3F 3P6YC 2CRLA 3FC9A 4WYWA 3KJVA 1NK0A 3W9IA 3PRDA 2F9DA 2V9KA 2VPWB 1J2VA 3MMBB 3SDEA 4RZRA 3D66A 2B4UA 2AGOA 4WTYA 2NXJA 1XWLA 1G4CA 1P27B 2AHOB 3CJ3A 3A4TA 3L4BC 4EBCA 4ECQA 3M8WA 1G2EA 2RS8A 2PA3A 3EXYA 4ID8A 1NJZA 5KFKA 2JEFA 1B0TA 3CCVS 4O4RA 3ZZRA 2YWFA 4X4PA 4J91A 2CJXB 3ETMA 1SIWB 4KGZB 1KSPA 2GMLA 3AB4B 2BQ3A 3K59A 2H1YA 3RB0A 4KHPF 3BJYA 4ETZA 1KLMB 1FTCA 4YP3A 4USMA 4V19J 1U6BA 5A0YA 4DPYA 2BEFA 2Y0BB 2V34A 4FZVA 4PKDB 3UR0A 3QMQA 3VAKA 3M8PA 2BJ9A 3RRKA 5FLXU 3ZZ0A 3CO0P 2ZVSA 3CJQA 3GCWP 2IC3A 3VGTA 3MFIA 4LQ3A 1U24A 4P75A 2E1MC 3JS9A 4DPUA 2XZTB 4J9QA 2Z8QA 2ZOFA 4LSLB 2RDJA 4JI8F 2LECA 1FX2A 3MEGB 1YRTA 1SH2A 1FDBA 2JL9A 2MQQA 3QQCD 1K1SA 5EWFA 4E0DA 4LF8F 4EEYA 2DNPA 4B3SJ 4OJ3A 2LQ9A 4MYTA 2N4CA 2V69A 2VG6A 4ER8A 4PXCA 2YWGA 4KFBA 1U8WA 2XMVA 2OPQA 2QMWA 4DV4J 2MKHA 2E1AA 3MEKA 2Q6BA 2VV5A 3ZZUA 2PC6A 4DN0A 2UXDJ 3C2PA 2QV6A 1Q5VA 3EPIA 1Q81T 2IM1A 2XYPB 3G9CA 2RSQA 3DM2A 3HDSA 3TAPA 3AJ2A 5BR8J 4NCBA 1KVJA 4K4TA 2I8EA 1QSLA 4MKAA 3D6HB 3J81U 3PIOQ 4DQSA 2FJXA 2DIVA 1ULRA 5IZHA 4LFBF 3MEDA 5BJRA 1R8AA 1T11A 4IFVB 4NWBA 1X9MA 5KFGA 2B6AA 2LFVA 5A76A 3C16B 5KTQA 1X5TA 3TJ8A 5C7PA 1D1UA 1IBMJ 2FZCB 1I3OB 4O3QA 4DV1F 4A8YA 4LR7A 1R8BA 3TA2A 2R7SA 3J81j 4PXDA 2JEJA 4PUOA 4DR7F 2QE5A 3CTRA 3DHWC 4C0BA 4Z37A 1S6PA 2VZ9A 1T9XA 4USWA 3GCXP 2IYGA 2O66A 2YWHA 3H7HB 1XERA 5CYMB 5HJXA 2PMHA 4CZCA 1QAJA 2ZKUA 3AT1B 4RWXA 3CJ0A 4ED0A 4ICLB 4NCAA 4OZNA 3KHLA 2QL9B 1YJVA 4LRAA 1EKSA 3RG6A 4M8LA 4RU2A 1E6YA 3HVRA 3ULHA 3NOCA 3L3CA 1FWPA 4JI2J 3ETOA 3TWZA 3EE3A 4DEZA 1AYEA 4C2MA 3QO9B 2M88A 2HVZA 2LA6A 2BZ2A 4ZP6A 2OJ3A 4HH0A 4K4WA 4OZ3A 3AJDA 2VG5A 2WVFA 1NK9A 3K5OA 4MYUA 2HPUA 3DLEB 1YLXA 3MCMA 2R7XA 5D8HB 4HVZA 1EP4A 5H9EK 4RJVA 4LFBJ 2B4PA 2VODA 3Q8RB 1QDUB 1NZ8A 3K2YA 1GH8A 2J9DE 5ETPA 5LMUJ 4WFBQ 2H3EB 1KVKA 4ED5A 4OL8A 5J1NA 3KLGA 2NQPA 1JJCB 2D41A 3C15A 1RU2A 2HWTA 3LP2A 3H98A 4DV5J 1TKDA 1PO6A 1TFWA 4LR8A 3VV2B 2F8HA 5THWA 3H40A 1FNXH 2ZUAA 1W2IA 1UVNA 3PYDA 2ILYA 2FLPA 1KQKA 3US5A 2W4DA 3EJMA 5LJ5Y 1WDTA 2VBYA 4YS2A 4HI2A 4U7UK 4NPOA 3LP1B 4LBPA 2R2UA 4EZ9A 3CVKA 4B3RJ 1FKPA 3BGLA 1RKJA 1EHWA 5IC6B 1R0AB 1EKRA 3SFUA 1VQ9S 4DPWA 2B4VA 4TXSA 1R6VA 3OTDA 4Q45A 3SV4A 5ETMA 5JUMA 2D7SA 1UEUA 1D0EA 1LWCA 1GMWA 3PRBA 5G0RB 5E3PA 4DCPB 4P9SA 4ZDNA 3OSPA 5D0GA 1GXTA 4AE5A 1KS2A 1GT8A 1UW9A 3K5LA 4JI4F 1MN7A 3PIPQ 4ECXA 2E9TA 3P3DA 2E9RX 1VQPS 2EG1A 1PILA 4URQU 4DUYF 1EX8A 2GO8A 2V2ZA 2H5IB 2DGQA 1OSCA 1RT7B 2GJIA 2YKNA 3GPAA 1FFGB 5H1SV 2V2VA 1LWFA 5IM0A 4RW8A 1YJ7A 3T1HF 1R7IA 4IDKA 1JMTA 2JLEA 3DMJB 4L3NA 4DV1J 4X4NA 3UCGA 3HJFA 2J0SD 3PY8A 2VDIA 2E1CA 4UZCA 2MLYA 2EC0A 4XDDA 2I0XA 4RLEA 3VQTA 1S77D 3KLVA 3BEGB 3WC2A 1X4HA 1FXDA 2BYCA 3Q2SC 2H54B 5J1EA 1GTHA 3FSXA 3DLHA 1KTVA 3M2UA 2VKZG 4ZVFA 4U7CA 3MEDB 2UZAA 4Q5VA 4F2SA 5IFMA 1LKZA 2AIRB 2DNRA 1V9OA 2DCUB 2MHEA 2X3DA 4QOTA 4AL7A 2WONA 1VK8A 2BM1A 4PWWA 1HFEL 4OZ2A 2Z58B 2VF3A 1RAFB 3MMJA 5K5MA 4QWAA 1QSYA 1ZPWX 1C1CB 1O8BA 2DRBA 2V6AA 3T19A 7AT1B 1UVMA 3J7AN 1C1BB 1X5OA 2ERRA 3C8YA 2BE9B 4PPDA 3VVTA 1XR6A 1RAAB 4J9LA 4IUFA 4LJMA 4JI1F 3PYFA 3UW1A 1ZAVA 1JKHA 2DXEA 4HHUA 2FJDB 4LSLA 4ES2A 1FA0A 3JSBA 3Q22A 1JLEA 3Q8VA 1X4AA 1X4EA 2N3LA 3TZYA 1N32J 2X1FA 1U2CA 2WVCA 4BBYA 3VAMA 1OYEA 1PBUA 4O44A 2AZ3A 4WP3A 4F67A 1NDKA 1XNRJ 2O1PA 3T5HA 3MM5A 2WBMA 2RNEA 1VQNS 3ZZZA 1IKWB 4FNIA 1Z2LA 3UO0A 3MUVP 4JI0F 4J9RA 2CQCA 1VBZA 1R3NA 3JTNA 2H4WB 5E2QA 2XHWA 4C8YA 4F50A 2A6OA 4ECZA 2D3UA 3CCJS 4PQAA 2RE1A 2MGZA 4O3RA 4ECRA 2KFNA 2OIHA 3RBZA 1FF2A 1H2VZ 2CWKA 4OX9J 1ZM9A 2O67A 3UI3A 3UDLA 4YY3F 4OV6A 4HI1A 2J7KA 2RU3A 2FVQA 3K8VA 2BACA 4ZP8A 1RWMB 2XS2A 1R89A 3OTBA 2JWNA 4U6PA 4LF5F 3ZZTA 2DRAA 2VBWA 3MFHA 1REVB 1HBMB 2OI2A 1U1LA 3PKYA 4B9SA 4PWDA 3SDEB 3KLFB 2OPSA 3CCMS 4C8ZA 3EMTA 1F6TA 1FEHA 2HFSA 2VG7B 1N5YA 1UEKA 3UN5A 3AD9C 4F04B 1QAYA 2ATCB 2CPYA 1S0OA 4I2PB 4M5LA 2VQEJ 1AZSA 1HKAA 4NL5A 3GV8B 4LF2A 2YNHA 2ZHOA 4FYXB 1U02A 4N8OA 3OVBA 2J0XA 1FESA 2FC8A 1FVQA 1QY7A 3HPOA 1NK8A 3Q8SB 1NSAA 3N6LA 5DM7Q 1Q7LB 1IVZA 4DL4A 1KFSA 2YQ0A 2MLXA 4TVAB 4CO0A 3L7UA 2NCKL 4JI6J 4LFCJ 4DQPA 4OX7A 2OTJS 5HBMB 2F8MA 2NUUG 3QT8A 4FNHA 1ZS6A 3DLEA 4WK3A 3JSMB 2BMBA 3S1TA 3TO8A 3TARA 5E3CA 3MMAA 2RILA 3WX8A 4Q0BB 2X51A 3BSCA 3I6PA 2UXCJ 1H7XA 1X4FA 1Z4UA 4O3PA 3SIPB 4NEYA 3ENQA 4DDFA 4RW8B 3PFEA 3X1LB 1JXLA 3ENWA 2HK3A 1UCNA 2ZKTA 3CDEA 1RT6B 3H2LA 4M1KA 3TW0A 2XMAA 2G0IA 3G8SA 2PA8D 3T3FA 1J5OA 2Q1LA 1RTDA 1EB0A 2FQQB 2KL8A 5D0EA 1KQGB 1P1TA 3BN7A 2JRSA 3NCRA 1YJRA 3O1LA 2GVDB 4CLSA 1BLUA 2IRYA 3BB5A 1LWEA 4CO4A 2J8SA 3FRYA 4C3MA 4NLYA 3ZO7A 3NOGA 1NB7A 5DGBA 3FEZA 1LFPA 4LRDA 3GV5B 4LSZB 2L3MA 1DZ5A 1C0TB 2OPPB 4H4OB 3H0PA 4NLTA 4IH7A 2QL5B 4YQWA 2M0GB 2HWIA 5KOXA 1R0AA 1NK7A 2DO4A 1TFYA 4CYUB 3D7SB 4OYAA 2ZHBA 2OEJA 3CCZA 2XZWA 3GG1A 1RT2B 4A8MP 1HD1A 3MR6A 1FT8A 1XMOF 1NEEA 2ASYA 3H8YA 2HMIA 1NH7A 2XMWA 3NGKA 4PG7A 3ZC4A 3G71S 4Y2CA 4DG1B 3BREA 4DR7J 3KWMA 1SV5B 2MY7A 3IG1A 3KG0A 2BJ3A 4GKJJ 2I2YA 4K0KF 5DG7A 1BC6A 2RVJA 3PW5A 3RW6A 3HFKA 4R0EA 4ZVTB 2KM8B 4WE1B 5M2PA 2QA4S 1UWBA 5B0GA 5HJYA 2BBEA 3R7SB 3GJSB 3CSKA 2BQRA 4B9VA 1UVJA 4F0MA 1UWAA 2BXJA 2DRDA 4X4TA 2PEBA 4ED6A 1LQ9A 5E41A 5F8NA 4YFUA 2UXDF 3KNAA 4OX8A 4QR2A 4QWCA 5C42A 4X2BA 1F5AA 4IH5A 5EX3A 2Z2YB 3OR2B 1ZTTA 2VC0A 4OYZA 4USTA 3FSYA 3K7RA 1HBUA 5IT4A 3C6TB 3OXLA 1LFWA 4KKOB 4ERDA 1WSRA 3G4SS 3MOJB 4C48A 1VQYA 5HMZA 1MU2B 4PYDA 1Q95G 2V0NA 2FZKB 3OHAA 1CG2A 3DRRB 3FFIB 1EARA 1N0VC 1TR0A 4F3MA 1S1TA 2C2MB 2YNIB 4ANDA 3FBCA 1S0NA 2HNYB 4Y2MA 4CLFA 2KXNB 3MM5B 3U27A 4Q8EA 1WG1A 3BV8A 4CNYA 2IRXA 4EYIB 1ZBTA 4B3RF 3I0SB 2V2KA 1REGX 2D1CA 4BCAA 3MM8B 2MJNA 4QPXA 1F9FA 3JYTB 1OS5A 2CA9A 2KYZA 2R8GA 4DPXA 1SKSA 4HKQA 3GG0A 2XNRA 3QIPA 4HLBA 1S1XA 2E1RA 1N36J 5DO2A 5A8RA 4NLRA 2XO6A 3NS7B 4I4BA 3E3XA 2CQGA 4J90A 3QFHA 4J9KA 4ZPDA 1X5SA 2HHHF 4JYAJ 2HYIB 5HMWA 3C6TA 2MQMA 2WB1D 2N82B 2Z0GA 1JLAA 3D3CJ 3KK2B 3BO3A 2Y9HA 3IBFB 1MSWD 2XSJA 4MIWA 1KHWA 2FVPA 3H25A 2RT3A 5MAOA 2E5JA 3C6UA 3CWJA 4ID5A 5KG1A 2M7SA 3CCQS 2FZGB 2GQQA 4CLKA 4F4YA 1CPZA 2QFIA 3TZWA 3IM8A 2AX0A 4NYZA 1KD1T 3UDEA 2PD1A 4H54A 2NXEA 4TU9A 5BXIA 5KG0A 1U47A 3O8WA 3OTOF 1DAXA 1UPPA 1OPZA 1R8PA 2GO9A 4KY3A 2PGCA 4NZ7A 4RW6A 3RJMB 4EI2A 1RTHA 4UZBA 2HHWA 1ZPVA 4RUAA 1X5PA 5IC4B 4K5RA 3CCRS 5K20B 2JX2A 2Z30B 3CCLS 1RWKB 5RUBA 2X1GA 1HHTP 5A0YB 4DG1A 4ZCMA 2YPZA 4LF9F 5IS2A 5ETRA 4YY3J 1F2HA 4X84A 2GAHC 1XBWA 2AJ1A 4DL5A 5J2NA 4ZP9A 5K8PA 2ACMA 2HHHJ 5L8RC 1S5ZA 2VL1A 4CM2A 5KFFA 2OPPA 2B3TB 3GJTB 4HR2A 3MAQA 2YKOA 4EGLA 1PAEX 2VFUA 3HT3A 3V81A 1JNZB 1NDCA 2BE7D 5KFZA 3W64A 2AEJA 3J7YI 2GGPB 3OHBA 1I94J 1NSKL 1RXOB 2FY1A 2V5HG 4G1QB 1FKPB 3PFOA 5D4LA 3SCKE 3IWLA 3UR3C 3EICA 4GMKA 2BKPA 4EO8A 2VJUA 4J9MA 4EZ6A 5KFIA 5KT6A 3W5ZA 3NRBA 1AW0A 4Q7AA 5CQGA 1IBKF 3BO2A 1HNIA 1SH3A 2MDAA 2MKSA 3UWTA 1NK6A 2VU5A 3M30B 2GQCA 3GQCA 1S7HA 2IDLA 3VR1A 5CD4H 1TKTB 4ZIWA 5GADU 4JI5J 4Q44A 2CQ4A 4A8WA 4NA3A 4DSKA 2G1DA 4L73A 5D3GA 4WU3A 5K14A 5IWAF 2KFZA 4BWJA 5KFYA 2DH7A 2DT9A 2CZ4A 2F5GA 4FBUA 3Q24A 1JWWA 1NCLA 2YH1A 3CCWA 3KOAA 3BDPA 1NMEB 2JVOA 5EWGA 1NZAA 2JJ4D 3P5BP 2U2FA 3DLBA 4ZJLA 4MAKA 1A9NB 4KV8B 3CDBA 4M5MA 2MQLA 2VG5B 1RJJA 2FUG9 4AQYJ 1HBNB 2BJ7A 3LALA 2CPDA 3QNWB 1WTFA 3BQ1A 3V4IB 4OHVA 3QJPA 1W25A 2QX0A 2Y1LB 3VF0B 3OL8A 1AXQA 2J8AA 3DLJA 2OPSB 4QR0A 3SQGA 3MR3A 2KG1A 3OXGA 3N0VA 1SKRA 2UUBJ 1NJYA 2Y1IA 4G65A 1X4CA 5HQMA 4NYPA 4Y6IA 2ASLA 3I5AA 2YY3A 5EUHA 4AT1B 1M1GA 2KT3A 2HNYA 4P7VA 4TLQA 1WOSA 2HFUA 3UVJA 2KFYA 4DR5J 4DLEA 1FI4A 1VCTA 3I87A 2LQJA 3HZEA 1S49A 3PDNA 1AT1B 2VQEF 2ZFHA 4QYZJ 1VMBA 2VB6A 3RAMA 5L46A 3KXDA 1LW2A 1FDDA 2APOA 1VDHA 1U1PA 4X4SA 1GMUA 4PPZA 1K8AT 1TELA 4IO9Q 2BJEA 4LFCF 1CS4A 2L9NA 2MZSA 4OZJA 2ZM6J 3LO3A 5L1JA 3NMRA 1NBEB 1KBRA 3A8KA 3CJ8A 5KFBA 3KFWX 3E01B 2OMOA 1R8CA 3V6JA 2G4BA 1RA6A 4WKYA 1HD0A 1MNEA 2W24A 1CQNA 1D8ZA 5KG4A 4DV2J 4LF4J 3CDAA 2DD8S 3MMCA 1PIEA 4DQRA 3QWPA 1FEEA 1HNVA 2LP4A 2ZEJA 4MJKA 4KO0B 2HZAA 4KAIA 5KFWA 1S97A 2AX1A 1FTRA 3G82B 1EIYB 3BYPA 1U6ZA 3SSQA 3ISND 3OJUA 4F02A 5JJBA 1NNDA 1SXLA 2B9XA 2EFOA 2DR6A 2WW4A 3NAIA 4DV5F 4BLGA 3JTPA 3G6ES 2FHJD 2IAJB 5JVGQ 4TYBA 1FKOA 3HVWA 4C11A 3NGTA 3MTJA 2MKYA 1IBKJ 2PI5A 2DGSA 3M2RA 4NI2A 3GMGA 3I56S 4C8OA 1WJ9A 4IOAQ 2OGUA 1YHQS 1SKWA 1T02A 3BSOA 4LF6F 5AJ3J 1ZAWA 1ZZFA 4RR5A 1QAIA 2BANB 5A8KA 1ZYQA 3H2UB 1JLAB 3TJAA 2EKNA 2CQHA 2ZH6A 5GAGI 2OLWA 2HNDA 3PX4A 2HS0A 1QSSA 2VPYB 4K8RA 3TEHB 2MSTA 2IJNA 5C25A 4DLGA 3GSDA 4M95A 4JV2A 4NA2A 2XO7A 4ZIVA 4JI8J 2HQ3A 4WCEQ 2W2NP 2Y8YA 2FYXA 3RBDA 4IOBA 4O3OA 3C14A 3TUZC 4NYOA 4QYZK 3M2UB 2AU0A 3U7JA 2C2OB 3CCUS 1MWYA 3PHTA 3RBEA 4BHQA 2OH2A 4QIEA 5E0OA 1XEZA 5HK4A 3U1MA 1S4EA 2G2YA 3FSIA 4DR3J 1IBLF 3V4IA 1I1GA 3IRWP 4B02A 3BSAA 3K89A 4JOUA 4KRWA 2DO0A 2HLTA 3RB6A 3SQGB 3L9ZA 3N6NA 1UW4A 2IVYA 4RW4A 3GJQB 1MU2A 4NA1A 4UOCA 1TVRB 3LH2S 3ZTRA 1QM9A 4ZVPB 1TUGB 4DOZA 5KFHA 2FPHX 3KUGA 2CNLB 1RU1A 1RT1A 2CADA 4ECUA 4N47A 4DF8A 2N4DA 1U25A 3Q8PB 3IWXA 2NYHA 2QJ3A 2QL7B 1B7YB 2YKMB 1N32F 3E51A 2GNKA 3CUNA 3ADAC 4DFMA 3ELHA 3TA1A 3NBPA 4UTGA 5HROA 3BSNA 4Y2AA 2OFHX 1CEZA 1X4GA 3F41A 1FJGJ 2VBZA 4XPEA 3KK1B 1RSCA 1UWBB 1VBYA 1RTJA 1U0HB 2HLUA 3MF5A 2K3IA 5ADZA 4WP9A 5E7OB 1YRUA 1FNOA 3RZAA 1S7IA 1NRKA 3EVOA 1IBLJ 3CJKB 1YWXA 3W9JA 1SV5A 3T5LA 2GVZB 3AXMA 2KJWA 1N88A 3HHDA 3NS5A 1S9GB 3W8GA 4PQUB 2AP6A 1LEOA 3HKWA 1NSQA 3Q23A 2AV5A 2DGWA 1RTIB 3LP2B 2QEXS 2Z56B 1GTEA 1MWQA 2HHQA 5FJ4A 3NL0A 1ZZNA 4G3IA 1XK8A 1HW8A 4EUVA 3OBIA 3SSRA 2KRRA 1GAOA 2ZUGA 2KO1A 2MTLA 1KTQA 2E29A 4I6YA 3G6VA 3DDNA 5J2QB 2LKZA 1WEYA 5CYQA 4YR0A 1IR1A 3P45B 1R6YA 3DRXA 2B9EA 4ED8A 4DMZA 3M9OB 3OL9A 2CG4A 2MKJA 2WBRA 4Y2KA 4CO2A 4JB8B 3GYXB 4RNHA 3IRXA 3MM9B 4A8OA 1XR5A 3JB9k 1PJ6A 3DI6A 1LXJA 1RTDB 2CNOB 3RAQA 2CFXA 4GVBA 1FWLA 4J7CA 5MLCV 1ZM4A 2WSFC 5CZXA 3MDFA 3GFZA 3TAQA 3GWCA 3QFWA 4OI0A 4J9NA 4P2FA 4R8UA 3SCLE 1BE4A 2IPOB 4OI1A 1VIXA 1HWIA 2F4FA 1J5EF 4ZHRB 3QT7A 4WPAA 2N3OA 1M5VC 2DHAA 5KFRA 1T05A 1WKLA 1IJEB 1Q5YA 1WHWA 3JSMA 1YKWA 2CQ2A 4IYQA 4NLSA 5ETQA 1U1RA 1NKCA 3QGHA 5AXLA 1RHJB 1VQ4S 3LGHA 4FDFA 1FO1A 1HNZF 1XNQF 3VAHA 3WIVA 3UD3P 5H9FK 3M8SA 1S59A 3D4JA 5EHHA 3HVTA 1BUXA 2Z2ZA 3MM8A 4R0JA 3D6FB 5KFCA 1L3KA 4IG3B 2YNFB 2H9ZA 2MZJA 9ATCB 3SV3A 1SBRA 4DU7A 4Y65A 3V6HA 3RB4A 3FMWA 2A2DA 4LSNB 4LFAF 3SEOA 1G7CB 2WW8A 3UN3A 4A8XA 1UKUA 2XG8A 4AYBD 3JQMA 2QMUB 2LQ5A 1T05B 1Q7YT 1Q82T 3M32A 4HHJA 1FDNA 4W4MA 2IIHA 4ANCA 4DUZF 1XIQA 4R8UB 2JFDA 2QA4G 2XSFA 4ZVQB 2R7VA 2V8VA 3CDUA 3WBZA 1UTAA 2EFVA 2R7QA 5IM0B 1VQ8S 2C2ZB 2IBOA 2BA9A 3WDOA 4DZDA 5FLXY 4RNOA 1YX2A 2AEMA 2MHNA 3QYYA 1DLOB 3K5MA 4DV6F 1YJNS 3CULA 1U1MA 4NMLA 4C3KA 1JLQB 1DTTA 2H5EA 5C24B 3Q8YA 4DFPA 4YDXA 1HWUA 4IKAA 5B0AA 4EK2A 1LW0B 5KFTA 4PYAA 4EFAC 3SZ2A 1X0FA 1H38A 3KUHA 2MLZA 5G0RA 5JMNA 4ECVA 3TVYA 2E5LF 2HHUA 5F41A 3MAHA 2ZITA 1NSPA 5G4DA 4DL0C 2FB0A 3TQ1A 1VQKS 4W90B 4H4KA 3SCIE 4KYZA 4AFFA 2OSQA 5D0RA 1GEHA 1HQUA 1Y3KA 2ZD1A 4WE1A 2MZQA 4B3MJ 2PO4A 5HQLA 5LL6d 2SXLA 3IAS9 1EJ7L 4OHZA 1RTIA 3DXSX 3DRPA 4DCOB 2IM3A 3L09A 4DR5F 1SJ4P 3DLGB 4JI0J 1BWVA 1JLFA 2AT1B 4G1PA 1H0HB 2NUHA 3D1HA 4PABA 3NEKA 1H2TZ 4PG4A 4YHHF 1X0PA 4AXIA 4PG8A 2B9WA 3M8YA 5DDOC 3GILA 4IRKA 3NNAA 1IXKA 2P6SA 1YTYA 1UPMB 1TU0B 2Q3PA 4CQ1A 1R43A 1U0HA 3MAAA 3OJSA 3HHLB 3RB3A 4DBQA 5F8JA 4MIBA 3DGPA 2NLWA 1V6HA 2DYAA 5F9LA 4M94A 2DR7A 2JVRA 1V3ZA 2BJ1A 3PYGA 3HO1A 4U7UD 1R8HA 5GAEI 2AYMA 1UZDA 3WHIA 3CB4A 1X31C 2DEIA 4EMDA 2XGPA 3CMAS 3IBWA 1CJKB 1HNZJ 1PAUB 2XI3A 3CMQA 4OI6A 1QVFR 2HS4A 2CQPA 4XO0A 3KNGA 4PXBA 4L76A 2DHGA 2K8GA 1JX4A 4NLPA 4XK8C 3R7NB 3ZXWA 2K1RA 3FQLA 4XTTA 2C42A 2BV3A 2HBRB 1TL5A 2CQBA 2DNNA 3FUYA 4DPOA 3N01A 4CT9A 2EFGA 2M8DB 1N36F 1RA7A 4I6AA 2P6TA 1UJ6A 4OZ0A 3IMQJ 1S6QB 4A48A 3IS9B 1RT7A 2YKNB 4NMXA 3GTYX 4QQBA 2QC3A 4Y34A 4WBFA 1CC8A 4N8NA 2DHSA 4HT5A 5K8NA 1TL1A 3OTCA 4M5DA 4CLYA 5BR8F 3THTA 2JEGA 4XPCA 3H90A 1NO8A 3DHXA 2KHCA 4MK7A 4RNFA 3CXCR 5J2PA 5HBMA 1MMLA 3B4MA 1CJTA 1QE1B 5J2NB 3OUYA 2IYIA 3QT6A 3B78A 3HCXA 3W9HA 1IWGA 4DX8H 3CC4S 1U4BA 2CWXA 3DOLA 3TNVA 2IJRA 1LXNA 1QTNB 2XB2D 2K2PA 5D0HA 5HAOA 2BANA 2YKQA 4KPCA 1CVJA 4HEA9 1HLWA 2KU7A 4WYLA 3PX6A 2R8JA 3IR5B 3EGVA 3IXQA 4ZLLA 4RW6B 4FVCA 3PYEA 4TN2A 1VC0A 4X4QA 4OQJA 2BJDA 2D9PA 4F4XA 3T1YF 5J2MA 2UVWA 2V8PA 2FD2A 1BQMB 3BQ2A 4RW7A 5DLGA 1WUUA 1OPIA 1IQTA 2GHVC 3CJTA 5HO4A 1B7FA 2HBZB 5L1LA 5CA5A 4ZN3A 2RU9A 1YBUA 5E3QA 1S0VA 5JXSA 4NLGA 3T9NA 2RS2A 1S6UA 1CULA 3HHKA 4KGVB 5DG8A 4FKYA 4C6AA 2U1AA 2XMTA 3ILIA 3CO9A 3VAJA 1URRA 2J5AA 1MWZA 3PVXA 3QLHA 4FF3A 4C9DA 2CZ9A 2E44A 2GIRA 3W62A 4NX9A 4G6VB 3TP2A 2IMOA 3RBXA 2ILZA 3ONQA 4DS5A 3DNCA 2CUYA 1RHRB 1S9EB 4M5NA 4UUXA 3VWSA 4CH0S 4XIUA 4K2XA 1BD6A 4RU9A 1DTTB 5C24A 2A10A 3O2IA 1Q53A 3W2WA 2LA4A 4LF1A 3OL7A 1UA1A 3QJJA 1FJGF 3NG8A 1T03B 1JLBA 4I2QB 3T1YJ 4GC6A 2XS5A 2W9BB 3DOMB 1T7PA 3RR7A 3BN4A 3W2VA 3MOZA 3FKBA 4ZOSA 1S48A 1UZHA 1VHFA 3HHNB 3GIMA 4Z2XA 2WAQD 4DR3F 3SFGA 2DXDA 1U45A 4D3HA 1BHNA 1P1LA 2F4VJ 4LT6A 4B08A 2ZZMA 1WG5A 4ZPTR 3I31A 3WIUA 2VICA 1RLCL 2J0WA 2K7KA 5KFSA 2VUGA 3TQEA 1KC8T 1ZA1B 4QW9A 4HACA 1NPPA 2Y3YA 3TR5A 1L3VA 4BC7A 4HL9A 3EYZA 3LP0A 1Y00A 2IRUA 1FD8A 2M52A 4USVA 2HFNA 2KKHA 3N5BA 2FHMA 2JC0A 1HHSA 2WVBA 3KLIB 3HX9A 4KHRA 1UJ5A 5ETVA 5BYRA 3UFCX 1DBDA 8RUCA 2QA1A 1LK5A 2WONB 3GIRA 3HLUA 5D4OA 5DS7A 5BYQA 5GMEA 2F9JA 2CNNB 5DQGA 3TVZA 3FZ2A 1GNKA 4FXVA 4RBTA 2VIHA 3DLLQ 3KDOA 5AT1B 1WI8A 2IVFB 1IKXB 2W25A 4DSIA 2MZRA 3GONA 4GRSA 4H4KC 4A4JA 3EGWB 4MT1A 3TOQA 1IUJA 1KEKA 2ZE2A 3N9UC 4ZPAA 3HHLC 2ZM6F 3GIJA 4ZHRA 1I5OB 2BW7A 2GX8A 2PFDA 3GR0A 3H2VE 3NP5A 2F40A 1NJWA 2OFGX 1Y3JA 2MPUA 5M2RA 1NHVA 2HSEB 2QSWA 5B7WA 4LF4F 4GVBB 4K4YA 5AE2A 5J2QA 5FD1A 1CJUB 3TX0A 1TKZB 3IRXB 1Y5LB 3MM9A 4ALZA 1T94A 1NHUA 3V5RA 2R8IA 1HYSA 3DN9A 3BKTA 3TAMB 5KFUA 1UEVA 4QWBA 2R2SA 3B8HA 1H98A 4KT0C 2G0JA 3FBBA 4NRTA 1SH0A 3QAUA 4RWWA 1ZM2A 3MR5A 4WU2A 1JLGB 5DDRC 1NK5A 1HI0P 3D6MB 2DH9A 2J7UA 2N7CA 3HF5A 1F3VA 5BYSA 1RWOB 5KT3A 1Y5IB 1TL7B 3SBMA 3MM6B 2J6SA 1YJUA 4NLOA 2M8HA 3IWNC 2V8HA 5L1IA 3SXLA 2KB2A 3U1NA 2C2KB 2XNQA 2W9CB 3ICLA 1SI9A 3MEEA 3NGRA 4ZS6A 4MIAA 2RHSB 2AEFA 2ZBQA 2KXHA 1HQ2A 2W2PP 2UXBJ 3R27A 2O5DA 2DNGA 2QLXA 5J2MB 1RACB 3MMAB 3PJXA 5LM7E 2EI5A 1GXUA 1RT3B 2D9OA 3KJQB 1HBOB 1Q8BA 3K5PA 4HT7A 4OYIA 3OV7A 1WF2A 1K9MT 4PG6A 1IBMF 1TL3A 1Q78A 3G87A 4JBCA 1QTMA 4JV1A 2VOPA 4OFZA 2DCLA 2YPYA 3FBFA 5J2PB 2C1EB 2NSBA 5KT4A 2C3MA 4RNMA 1VQSA 2M9KA 4F7VA 5F8GA 4MKYA 5A8WA 2QIFA 1VQ7S 3TAMA 1OIAA 2YVSA 3DOLB 3R6GB 4G1IA 2NREA 4DX5A 1DFDA 2Y0SD 1Q8LA 4RNNA 1FK9B 4H4MB 4H4OA 2ZH3A 2J76E 1TAQA 4KPYA 2VQFJ 3NNHA 2BOAA 2QYGA 4MTPA 4P2XA 5KFJA 5D4NA 3GE9A 2YKMA 1YZ6A 2H48B 3LPEA 2EFNA 2LXUA 6AT1B 2W9AA 3VAIA 1P9QC 1YI2S 4OJGA 2YKPA 1HNIB 1RHUB 1GK8A 3J80U 1AFJA 2V50A 4LFAJ 5B08A 2OUGA 2PDAA 3MM7A 3CC2S 1VQ6S 3CD0A 3BF4A 3N5FA 4URGA 4ETXA 4YR3A 4RW9B 3W2VB 1HW9A 4P72A 2KVIA 1S72S 1PYOB 4J9UE 4TYAA 1M5OC 1VRTB 2VDHA 3FCHA 1TKXB 3KKFA 5KAKA 5DG9A 4DCJB 4I67A 1ZETA 2Z2LA 1RABB 1MW7A 2QLWA 4M5GA 4OYOA 3RU0A 4F25A 5GMKa 2XQCA 3KMQA 3QIDA 2E5IA 2YNIA 2HFVA 2M5YA 4OZ5A 4JV0A 3FBEA 3LOUA 5HQ8A 4TKTA 5F3TA 5C25B 5IV4A 2XM3A 3L7OA 2B6AB 2VFTA 2CJQA 2QGFB 2XMMA 4IFVA 1NJXA 1RBOB 3A8JA 2MKKA 3T5JA 2KG0A 3C14B 3QPIA 3PACA 5HVFA 2RQCA 1A0OB 3OQ2A 4TY9A 3UNGC 1IM6A 3T41A 3F56A 4R5PB 4QYRA 2DVIA 2GIFA 3OR2A 2KM8C 2V4JB 2OEMA 5K8OA 2B4OA 4CLWA 2N7YA 4URSA 3EGZA 1K0VA 1WOPA 3UE2A 4ECWA 5CABA 1IWAA 1KNZA 2HHVA 1FD2A 3BPDA 3NGUA 1WC6A 3QGGA 3ZNUA 2CPFA 2LXFA 1RAHB 2CPHA 3U1LA 1C0UB 4J9SA 2MQPA 1KONA 2UUCJ 1S76D 4GC7A 1N5VA 2L9DA 3DOMA 3PJ9A 4J37A 2GZOA 4ZJQA 4J9PA 2IAJA 2ZNZA 1B0PA 3QZ8A 3R97A 2MQNA 3FDSA 2FVSA 3KLEB 1DJ0A 4PG5A 4P6QA 4CNZA 4B3OB 3WZ0A 4GKKF 2KTQA 4M63A 3T6JA 2W8KA 5KFMA 4DL6A 1UVLA 1CJTB 1QE1A 2NZCA 2UV8G 4U95A 1S1XB 2LU2A 1GX5A 3E01A 1OJ4A 3H59A 2QMXA 1Q16B 1RYRA 2BQUA 1R0CB 1N5QA 1VQOS 4V1Ak 5GAHI 3EVMA 2RIJA 4F4ZA 3GIIA 4F36A 2V4QA 2UUWA 4LUBA 1FE0A 4C8LA 5SUHA 2DBBA 5GVQA 1X60A 3MGJA 1FX4A 3FVYA 3OLBA 2YQ1A 3KLEA 4X65J 2OTLS 1E6VB 1WSVA 4ZPCA 5B0FA 4ZJOA 1G1XA 5F8MA 3LUYA 4OYPA 2Q6CA 2HW3A 2W4PA 3FFIA 3MMBA 3LPYA 1LWFB 3D54A 2UU9J 1SC3B 4WKRA 2RHQB 3POTB 2FGCA 3BQ0A 4FVMA 3AXKA 3HSDA 1FRHA 2J6UA 4Z7CA 2JSXA 2JFKA 3IGVA 3W63A 2GHWA 4F4AA 5EX0A 2Y1JA 1F3FA 4JI4J 3LGMA 4BC9A 2XMUA 3T1AA 3KHGA 5LT5A 1U1NA 1V5VA 2KT5A 2W7AA 3S7RA 1LWCB 2C2DA 2DNKA 5F8LA 4PZVA 5A6WA 4X4RA 1FDAA 4TU7A 2XLIA 2VD3A 4GVLA 2CJAA 1XN9A 1F5CA 1NB2A 3D67A 1HBOA 3QZ7A 2ROPA 3IG1B 5DQHA 3LP1A 2HHPA 3TUJC 5GAHU 3QRQA 2E5HA 5H9FJ 1UP1A 1UL3A 2B0GA 2YBVA 5EGYA 1SKUB 3UQSA 5HVGA 3RRHA 2BDPA 5J1EB 2AGPA 2CQDA 2HEKA 1K44A 3OT9A 5GADI 1DHMA 4KE5A 3CJRA 4X66J 3RUBL 2XGQA 2UVRA 2LCWA 4MKVA 4DR1J 1NUEA 1WF1A 1Q8KA 3TZZA 1IKYB 3QRRA 1YBAA 3CC7S 3BKFA 3S01A 3DRPB 3LWLA 4CCHA 2ATLA 2V9WA 2GA7A 2G2OA 1BGXT 1NLKL 1TUWA 2K06A 3CD7A 4WP8A 4RW9A 1A7GE 1PYSB 2DNYA 4LREA 1KHVA 1RCXB 1DTQB 2K3KA 2W7OA 2Q79A 4CLUA 3JSYA 1D8YA 2GJ2A 1VR6A 3PNIA 4DHVA 1SJ3P 3W60A 2EKYA 5GAEU 5AJ3F 4U8YA 1HR0F 3DLKB 3H20A 1FJEB 2VOOA 2FLOA 5KFLA 3SYZA 3MURP 2GHPA 4DFJA 1G6BA 1RCOB 3B4DA 3DLKA 1SCJB 5DGAA 2CPIA 3K0JA 3OR1A 1PYTA 2ZH4A 2KDOA 2ROGA 5U47A 3ZTOA 1HWJA 4KGKA 3T9ZA 4NZ6A 3ZZOA 3BGRA 3NAHA 4M5JA 4CM0A 2RF2B 2FGOA 4CTAA 2AW0A 4K4VA 1IBCB 4YB5A 4N41A 2LYVA 4DV0J 1SPBP 5LXYA 4B3TJ 4LF9J 1F2GA 3HHLA 2AJ2A 4TNOA 3FNNA 4PRFA 3HSGA 4I68A 3EPGA 1M1HA 1SJ1A 4KIAA 5KT7A 4JI6F 1S9GA 2EBGA 2DGVA 2YKAA 3UCUP 1VQMS 2KJVA 1TTHB 3N4WA 4FP9A 1SL2A 2ZBIA 4OYMA 2CJKA 2CVIA 2H4YB 4AD6A 2ZVIA 3VQSA 2RUGA 1JLEB 1HARA 1V3SA 2RDIA 3EWGA 2ALZA 3C6UB 2VA3A 4DFKA 2ABYA 1EP4B 4CWBA 1N0UA 4M5IA 3AFGA 1I6JA 4X4VA 1TK5A 1KQFB 4I56A 4DS4A 2L9WA 4DSJA 5KG6A 4O23A 1VQLS 1NKEA 2FHOB 5GAGU 4MK9A 2HQFA 3VTIA 2VASA 3DGVA 4I1TA 2L48A 4DI6A 2XHCA 8ATCB 3J7ZT 2CXEA 1VLYA 2OPRB 2CG8A 2QA2A 1HBMA 2YQ3A 4N7TA 2FLLA 3THPA 2UXBF 1K1QA 2ZH1A 4L6V3 1ELOA 3OFFA 3KG4A 1AFIA 2RRBA 2XTJP 1E6VA 3OTEA 4NRUA 3V6DB 1ZOTA 5D78A 4RL1A 1V3RA 1VGYA 4W98A 1YITS 4NCGA 1ZTWA 4ZPWR 3A13A 3OXFA 1X7VA 2A3JA 1AUSL 2WB4A 5IQ6A 4NLUA 1S10A 2DY1A 2DHHA 2XYHB 3A1YG 3ISZA 3M32B 3QLHB 4MK8A 5LXRA 5DDPC 5DDQC 1U8SA 3BR8A 2PN6A 2VONA 3KG1A 1RP5A 1SC1B 2D74B 4KR0B 1U1QA 1CULB 4X64J 3M8QA 2V8GA 2XWXA 2YNFA 3FZBA 3MHYA 1NPKA 3MWBA 1N34J 1S1VA 4DX7A 2MEWA 2YWKA 2PSZA 2FJAB 3R1HA 2QN6B 4QIFA 3FMBA 4K4UA 1OO0B 2IJFA 1HNWF 3BBFA 1W7WA 4RW7B 1T95A 4CIOA 3MPVA 4I69A 2PEHA 2RKIA 2Z2MA 2C2EA 1GXLA 3AQOA 4WXOA 5CYJA 5A8WB 3DXBA 4JV5J 2RUSA 2HAFA 1RDRA 3MTKA 2YWWA 1U1KA 1VK3A 3MCSA 4X4UA 1TL3B 4KO0A 5LMNF 1BQMA 2HBYB 2R42A 1F0XA 4C11B 1EAYC 4CTAB 1UVKA 4V19X 3F73A 2FJWA 2IFXA 3R6LB 3KK1A 1UJ4A 4L3KA 4USHA 2KHDA 1GQEA 1SC4B 3LF0A 3R2DJ 1TK8A 2V4JA 4LRCA 5HI7A 1P8GA 1PKUA 3LAKA 3CDWA 4F3QA 2J0QD 1WTBA 3G8QA 4IH6A 2E7WA 2V63A 4DN9A 1APSA 3OFHA 4ELTA 4CYUA 4HTIA 1F1BB 1S9EA 4NLXA 4B17A 5C5JA 1WORA 2HQIA 3CT9A 5K8MA 8AT1B 1GMWD 1HNWJ 5CXTA 4RW4B 1YIJS 4O3SA 3MD1A 4ZK7M 5HP1B 3R5BA 3MR7A 4K4SA 2DITA 3IN5A 1RHKB 3FK4A 1GMVA 5LJ3Y 1LW2B 4UOHA 4IDKB 5ETOA 3MECB 4USUA 5I3UB 4QCLA 2K1RB 1HI8A 1SC6A 1XR7A 3PRVA 4ZVHA 3RYLA 1U1OA 2HNZB 1SL0A 2Q66A 2EK1A 3L7PA 4QZVB 3HZGA 4E8UA 4JI1J 1RHMB 2MQOA 2R4FA 4I7FA 5AXMA 2IMWP 2GVZA 1IKYA 2J9DA 2RDDA 4C8MA 2LQ8A 5D6GA 4ILLA 3D9BA 2ZWPA 2DTJA 4LR9A 4WFNQ 2CVEA 2P9CA 3HKZD 3M8RA 4EBDA 3UNYA 2CQ1A 2IM2A 1Q4RA 2XSJB 3JTOA 3MAAB 3CJ4A 1JXVA 4HTJA 4BWMA 1AA1B 4FS2A 2HGLA 2MQ8A 2X7IA 4DZ6A 3HD2A 2VFRA 2UV8A 3OUYB 2AD9A 1JJ4A 4B9UA 3PKMA 2ZC3A 1VBXA 3CGIA 1MROA 1FRMA 1NPRA 1TZ0A 2D3ZA 2XMKA 3KMSA 3PO4A 5D15A 3MPWA 3FCWA 2A1BA 3AA9A 4X62J 3KLFA 3POTA 2VG7A 1S6QA 5DJBA 3B6BA 2OSRA 1O0PA 1UVIA 4KHMA 3D3BJ 3C66A 4WIIA 1N33F 4D3GA 2X1AA 4Y3CA 1REVA 3NGDA 3EDQB 2I6WA 3QRPA 4JYAF 4WTOB 1FJCA 3CD5A 4ED4A 1LWXA 3V6DA 3R5JB 1N5YB 1HNXJ 3HHLD 2GJFA 4DUTA 1WC5A 2V8DA 1YJWS 1RYSA 1T9UA 1NK4A 1QVGR 4QBUA 4BDPA 4DR4F 1RGVA 1X4BA 1Y0HA 4AL5A 3KK3A 1X4DA 2FHKA 4RUBA 3PX0A 2DK2A 1AB8A 1CS4B 3B82A 3P4UB 1KKHA 4U8VA 4Q2MA 3KK3B 2MB0B 1WELA
chains in the Genus database with same CATH topology
4B3OA 2I1RA 2KYXA 4ZCLA 3S6EA 3SI8A 1FRJA 5A8KB 2HRUA 4N77A 4IR1A 2XY5A 2ZH9A 4K50A 1TQLA 3FEXB 3G86A 4OJ1A 3ZZPA 3QGIA 4N56A 1BWEA 2RQMA 1SJRA 2GMHA 2V94A 5KG5A 3THVA 2V4RA 2XLJA 3LW5C 5L38A 1RT4B 3GFXA 2AF6A 3PW0A 2G9OA 5KG3A 2B51A 1VRUA 4MH8A 4C0OC 5HLFB 2ZJRQ 1N34F 1M5KC 3FJ2A 2HAIA 2EW9A 3M8QB 3AA8A 2UUTA 3OSNA 4ID5B 4Q8FA 4P7TA 4R5PA 4Y28C 1DARA 3LP0B 1FRLA 1Y5NB 5KFDA 4KFBB 5EN1A 5IXUA 2VG6B 1D9FA 2QSFA 1C1CA 1U49A 1UETA 1XMQF 4B3TF 2B7BB 4OMFG 1LW0A 1FXLA 2YWEA 4CO3A 4DV0F 4NLWA 5AXNA 2FTRA 2KRBA 1M1KT 1D9DA 2PMZD 3DMJA 2JDJA 3M05A 2FJBB 1TKXA 3MUTP 3F44A 2IC3B 2ZOGA 4ZKAA 4DL7A 3CE8A 3H5YA 2W9BA 2HNZA 4I2QA 2DH8A 4DF4A 1URNA 4KSEB 3G8TA 5KOWA 4FF4A 1DQ8A 3PW4A 1SB6A 1SJFA 1PGZA 2WK4A 4AQYF 4B3MF 2CYYA 1U6FA 3PEHA 4B3SF 2QRRA 2YX1A 1F5BA 1MROB 1QJHA 2NPFA 1K73T 1JNRB 5A6PA 4ITSA 1M5HA 4FS1A 4KKOA 1H2UX 2IHR1 1HBNA 1RT5B 3D1OA 4IQXA 3NMAA 5KFPA 4NLDA 2O3DA 3LQVA 2G0CA 2C3YA 1WHVA 1BQNA 1TAUA 1FRKA 1Q8IA 4YB6A 4NZ0A 3MM6A 2LMIA 1R27B 5DQIA 1DQ9A 2DHXA 2BR0A 3KHHA 1YQHA 2Q43A 1BQNB 3PV8A 4QJVA 3G6XA 3FGVA 3KLGB 4PWUA 3OFGA 2RF2A 4NLVA 3DI6B 3GR1A 3I4PA 3ISNC 4IO1A 4C0HA 2XLKA 1ZAXA 5KFVA 1RAJA 5DM6Q 3BSOA 2YX4A 4X4OA 1S1UB 2HVHA 2B9YA 4XAKA 3KK2A 1S1VB 2NS1B 1FJ7A 4DV3F 3I9ZA 1HYSB 2OO4A 1KFDA 2VKRA 1TL1B 4M5DB 3V81B 2ADCA 1K0TA 4IR9A 5CCLA 1OWXA 2BRKA 3I0SA 3O3LA 5FDLA 5KT5A 1L5UA 3KHRA 3QO9A 4KC5A 2KZMA 2ZBCA 1KR4A 1RTHB 2LEAA 5DRKA 2K7JA 2DNQA 4DSFA 3P96A 5I42A 4ILRA 1Q86T 2KXFA 1VI7A 2GIQA 4PXEA 5JVHQ 2J9EA 2LU1A 2LEPA 4ED1A 4LSNA 1U48A 3PR4A 3DYAA 2XY7A 5HMYA 3UPFA 5EWEA 2E5GA 3M9MB 2C2RA 2YNGB 2COLA 2HHXA 3J81Y 4Y00A 4A8QA 4NOHA 2ASJA 2M2BA 1HL6A 4RKUC 3HVTB 4Q0BA 3WX4A 4Y2IA 3JAMY 5H9EJ 3Q2TC 2F1FA 3R5DA 2KT2A 4TY8A 3OVAA 4JI7F 2A2CA 1FE4A 4OZ1A 4EU0A 2YH0A 3NBPB 4GO7X 4W92B 3UDCA 3TRGA 4J5OA 5T7LA 1T8EA 1IN0A 3GFYA 3PM9A 1VRUB 5KG7A 4LMZA 2FLNA 4HDGA 3OVSA 3CMES 4JV5F 3M2RB 5K9FA 3T5KA 3MEGA 2CPZA 5T14A 3AQPA 1JLBB 1S0MA 1SJQA 3RR8A 2IA6A 1BQXA 3QAEA 3R5CA 3CJ5A 4L72B 4MKBA 1RT4A 3K8WA 1JB0C 1Q79A 2DR9A 2MY8A 5KFNA 2NSCA 4FXDA 4Q2LA 4WFZA 3M8PB 3IR6B 1HQUB 2ZD1B 3HI9A 1VRTA 4DV5F 1RT2A 2CJ9A 3GYNA 4EWTA 4ECYA 2DGTA 5LSLA 2EK6A 4YEAA 4ZVEA 5LSOA 2OIHA 2OD6A 1KLMA 2POKA 3OPKA 5CH7B 5E3AA 2ZH2A 4GKJF 2GQ2A 3ITHB 3M6WA 1U09A 1NKBA 3DRRA 3OR1B 2AJ4A 2UXCF 3V6KA 2NZ4A 1Y4ZB 3HM9A 2B5JA 4ED7A 2DNZA 3GV7B 2CPEA 1LK7A 2C3OA 3IO1A 1XTZA 2I38A 3PXGa 5C42B 4F8RA 3TYTA 4RX6A 2CIMA 3CJKA 1WHYA 2DGOA 1M5PC 2I9SA 4EO6A 1JKHB 3DCAA 2KH9A 3K58A 2BUNA 4ZCKA 1YJ9S 4ED2A 1DURA 1HNXF 2E66A 1ROFA 2NYIA 2EFPA 3N6MA 4PQUA 2QFJA 3AH6A 1FCAA 4ZMMA 4NXNF 2OMLA 1HQEB 4KV8A 2RQKA 4QW8A 1FXRA 5B0BA 5I4MA 2W9CA 1O5JA 2BRLA 3BGFA 2UP1A 1KRPA 1RT5A 3ENVA 4QIWD 1PC4A 2RMLA 4C97A 4QWEA 2J7WA 4TU8A 4CO1A 3M9NB 4OI4A 2DPJA 1VQ5S 3MI7X 4X65F 3NLCA 2GC8A 1JLCB 3I0RA 3EZ5A 2BE2B 4U9RA 2BABA 1C4CA 4AL6A 1TKZA 3AAWB 4LIRA 2MJUA 3D0IE 4ZPVR 3OLAA 3O5TB 3KTQA 1JXEA 1C4AA 1KQSR 2GW8A 3M6XA 2QT7A 2LEBA 1IR0A 5I42B 5EDWA 1TUVA 1S6OA 2FHJA 2ASDA 4EBEA 2VFVA 3FQKA 2NPIA 3SSSA 4BS2A 3OW2R 1NJIT 5KFXA 5KFEA 1U2RA 4ZLPA 2XI2A 2UVUA 2FC9A 3HP6A 4DSLA 4UUWA 2LQBA 1D9AA 2AJFE 5CCMA 4DV4F 4IOCQ 3RW7A 2DPIA 4IG0A 4AUKA 4WFAQ 4OX6A 4C4WA 2MXYA 3CCSS 3DFEA 3I5BA 3QJLA 5CHCB 4OI2A 3R1LA 1YG0A 2XC9A 2J6TA 2EVZA 3E8OA 2HNDB 4N76A 4KGMA 4U67Q 2C3PA 4WXWA 4UY8T 1IKVB 2HGMA 2RD5C 2ZNYA 4RBUA 5KT2A 3KLHB 3RRGA 3N79A 2L08A 2RRAA 2E9ZA 2P9EA 3R5AA 2DR5A 3NS6A 3DLGA 1Q1KA 2RJZA 2VH7A 3PJWA 4OIXA 1QLNA 2RKIB 3TANA 1SUQB 1MMDA 5IQQA 3I4HX 3I5CA 3NCQA 4R25A 2C3UA 3TUIC 2CDQA 2P5VA 1D3WA 5E33A 4DSEA 5DLFA 1S9FA 3W2WB 2AJQA 3M4XA 3EGNA 2CJBA 3ITHA 4ES3A 1YVFA 2W7PA 3VZIA 2B5JB 3EUNA 4MFBB 1CQMA 4CI0B 3JSRA 4KTQA 5SZTA 3VAFA 3HVAA 3I82A 1ZH5A 4TQRA 2CPXA 4ZCIA 2ZC4A 2VA2A 2KZZA 1IKWA 4PUOB 1HMVB 2I5JB 3RAXA 1DLOA 2JHEA 4O44B 4B9TA 4F2RA 4FBTA 3LWMA 1P6TA 1UFLA 2B7CB 1O51A 1S6PB 4K4ZA 1DRZA 4IQMA 1HBUB 2KI2A 3CIZA 2RB7A 2L41A 2C28A 2FIUA 1JK9B 1WACA 2BVZA 1VC5A 1JIHA 1TV6A 2CQIA 4NLQA 3EXCX 4QU7A 4WJBA 5L39A 1YJTA 1Y9OA 2XS7A 3MZIA 1H7WA 4N5SA 5ITHA 3S8SA 2WTFA 4RUHA 3BM7A 3DOKA 4JUZA 2MZ1A 3CD6S 1A6LA 3QIPB 2W8LA 2LVWA 4TLRA 1EETB 1S1WA 4YOEA 4QU6A 2XCPA 4F4WA 3MUMP 1WI6A 1OQ6A 2JLGA 1W2BR 2EWHA 2LXIA 1NAQA 2EBEA 4ZVGA 1PC5A 4DV2F 4C8KA 1N6QB 5FDLB 3D5MA 4XDCA 1HNVB 2GV1A 2PE8A 2PI4A 4J9OA 2X3GA 1S79A 1TP7A 2M3DA 1JLGA 4DR2F 1B64A 4LVOP 5I3QA 4WF9Q 2VQFF 2B43A 4RBVA 2UUBF 1T3OA 1VFJA 5AXKA 3G6YA 3I32A 2GGPA 4WK1A 3TX8A 4B9LA 3PW7A 1CSJA 3D1QA 1BY9A 4WFXA 2DNOA 2DJWA 1GX6A 2ADBA 5F0WA 3KJVB 1VOMA 2HG4A 3U02A 3K5NA 1UAWA 4QPTA 2DGUA 3W3SA 3V4MA 1RT6A 2QZ8A 1J5OB 1L3TA 4K4XA 3KLHA 3MEEB 4PCQA 1VQ8S 2DB1A 4I6WA 1RTJB 5B0DA 3E2EA 5F9NA 2LDIA 1QAXA 1N8RT 3H5UA 2CQ0A 5IT0A 1KLNA 4A8SA 2PFFB 3D0GE 4ZPBA 4USJC 4X64F 2IVMA 2XEXA 1KOOA 1KN6A 1M0SA 2LDYA 5CZVA 4IG0B 4OX9F 4C98A 1N5TA 5D3GB 2HIQA 3C3LA 5KFAA 3LAMA 2FDNA 1Z2ZA 1VC6A 1RK8A 1FKAF 4DR6F 1TKTA 2MSSA 2BW2A 3IFEA 4F26A 5L9NA 5KFQA 2R7TA 3DU6A 5HMXA 3DRSA 2JLFA 4QIGA 3H4BA 2CZVC 2R7RA 3CCTA 4I7FB 1E6YB 3O44A 1RI7A 2IA0A 4CH7A 2RH3A 1S1TB 2M70A 1QUPA 4ECTA 1FVSA 2AQ4A 4PWDB 4NXMF 4QWDA 1RQ0A 4G1QA 4KJIA 4DJBA 1T03A 2JOQA 5HN0A 2F3JA 4YB7A 1HMVA 2I5JA 3MXHP 2R2TA 5HP1A 2ZDPA 2P9GA 2ZH5A 2OAUA 4X66F 2HFZA 3AY0A 1QUVA 2WCXA 1RWUA 1HA1A 2HS3A 3K57A 1YGYA 4O4GB 1WG4A 3VALA 5AE1A 4DR1F 2WHOA 2WOMB 3DM2B 1N6QA 4YMEA 3MPYA 1HQEA 3D28A 1VJWA 3PR5B 4OHWA 4ZP7A 2XCAA 2GCFA 4YR2A 2FJVA 1I94F 1MMNA 2ZJPQ 1FKOB 1WNEA 3M2VB 3PHEA 4QR1A 3MMCB 1H6KX 3IR7B 3DOKB 3I55S 2XMJA 1HPZA 1RKIA 4ED3A 2AYGA 5KG2A 1M90T 3IAM9 2J9CA 3ZZYA 1U7LA 5F3ZA 3DU5A 5B09A 2JEIA 2WOMA 4OHYA 4UQTA 2OD4A 3A8EA 4Y0FA 5I3PA 2RQ4A 4FPRA 2ZZNA 1N48A 1H3DA 4TY8B 2ZDOA 2JC1A 1HWKA 1FRXA 1U2FA 1JLQA 4B9NA 1WEZA 1LWEB 4IFYB 2QYCA 5D77A 1PSDA 4WFYA 4OLPA 5FIIA 2YNGA 3Q8QB 2CPJA 1DTQA 1ZM3A 2AYEA 2FVCA 2ZH8A 4OLOA 2MZTA 2JH3A 3SCJE 3GZ7A 3D2WA 4DQQA 2QO3A 4UW2A 5IT9Y 2HFOA 1Y7PA 2XBPA 2ACYA 3MM7B 4O0IA 2VPZB 3MR2A 4DL2A 1WWHA 3J7A1 3DRSB 4MFBA 1X9WA 4LQ9A 4IRCA 3IA0A 1B0VA 1S99A 4OI3A 7FD1A 2E7XA 2R2RA 3OFEA 3W7BA 1JJ2R 1DQAA 5T7LB 1TL4A 2UUCF 3H5XA 1VIOA 2HVIA 3M1VA 5E5NA 1NH8A 1S4FA 1HI1A 5HROB 2R7OA 4DL3A 2FVRA 4LF7F 1FERA 4MMOA 3EZUA 2XWYA 1CLFA 4GO5X 4UQGA 2HWHA 2DIUA 1RT1B 4CH1A 1AROP 5K14B 1SIZA 2JZ5A 5B0CA 4HDHA 3BDEA 4P2SA 1IKVA 3HHEA 5I3UA 3LGNA 1KVIA 1Z1ZA 2R7WA 3LANA 3QGPA 3NCPA 2G13A 2ROEA 4CT8A 6FD1A 4OJHA 2HRYA 4KB7A 5CYQB 3MD3A 3MECA 1HWLA 1IQZA 3BGRB 3O6QA 2CKWA 1OQ3A 3T6BA 3X3UA 5L1KA 2VBXA 3NNCA 2EFQA 4OV1A 3GB0A 2MKIA 5F8HA 3N28A 2C22A 3J7YU 1U26A 3FRZA 2BM0A 5D4PA 4PR6A 2EG2A 2GFFA 4I64A 2OKQA 3I9V9 2W4CA 4K5SA 4C3LA 3G96A 5CYMA 2R7UA 5E3RA 3DC2A 2MGZB 1UA0A 3CJ2A 4ELUA 2RRNA 2O01C 2YX7A 2XY6A 3H5SA 2HHTA 2ZOMA 1NU4A 2ZHAA 1C0UA 2AGQA 4ES1A 1F60B 2CQ3A 4F3OA 4WZQA 4ILMA 1IKXA 4RUCA 2R8KA 3AHPA 1WHXA 3M2VA 1EETA 1JLFB 2DNLA 5T41A 3DDKA 4E98A 4LVNP 1IM4A 3BR9A 3T5HA 1S1WB 4HH1A 3H4DA 1YRXA 4FF2A 7FDRA 3P49B 4UY85 1N52B 3DRYA 4JI2F 5J1PA 1KOHA 1FRIA 1FNMA 1VS3A 3FEYB 3IG1A 1YSJA 4YUDA 3KYLA 2MMYA 2VPXB 3R3TA 1RISA 6FDRA 1TV6B 1UMJA 3NWGA 4OZLA 2FJEB 5A8RB 5HL7Q 2BOPA 4I0WA 2MYFA 2X1BA 4YDDB 4FN5A 4NCGB 2KN4A 2DNHA 5LSRA 1T3NA 3IGNA 3BS9A 1N4LA 1AUDA 4EYHB 4LIWA 4USIA 4DQIA 3JYTA 2ZJQQ 5LMUF 5L9XA 3DYAB 3M6VA 4C7QA 2EPIA 4C8NA 4HYKA 3CPWR 3RTVA 2DISA 4A46A 3BZQA 2A18A 3P5TL 2OPRA 3PZPA 4K59A 3Q0AA 4JI5F 3V2UC 4FYDA 1SL1A 1FHTA 4IG3A 2HHSA 1FK9A 4H4MA 3PW2A 3I96A 4IFYA 2LLZA 3C46A 3J7Z5 2D3OR 1L3SA 2M4MA 2VC1A 3OL6A 5HLFA 1G3OA 2AWZA 4IRDA 3SMZA 4Q43A 3QWUA 4KBIA 2OPQB 3TA0A 1XMBA 4QIVA 2DNMA 3HXMA 3BGUA 4FXWA 4CO5A 4DV7F 3EX7B 1R31A 3TVKA 3VAGA 3HMJG 1N54B 1XNRF 4FF1A 4OHXA 1SUQA 2VFSA 5KFOA 2ZH7A 3PEJA 1XC9A 3M30A 2HMIB 4ELVA 2NR0A 1C1BA 1LOUA 1UFWA 1TK0A 1C2PA 3D0HE 3VCDA 2AYBA 2WSCC 3M1VB 4TQSA 3UCZP 3M6UA 1CC7A 5M2UA 1N56A 3IC1A 4ZA1A 4O4GA 4AXJA 1LV5A 4WZMA 3GIKA 3NKYA 3TI0A 4ATNA 1C0TA 2HZCA 1X8DA 2PIIA 3CIMA 1TVRA 4X62F 3IS9A 3HK2A 1M5SA 3WC0A 1IJFB