1HR0F

Crystal structure of initiation factor if1 bound to the 30s ribosomal subunit
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
101
structure length
101
Chain Sequence
MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLANA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of an initiation factor bound to the 30S ribosomal subunit.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 26
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2000-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01250 Ribosomal_S6 Ribosomal protein S6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1hr0F00
4DR5F 2KJWA 5IWAF 4JI1F 4JI0F 2VQEF 4X66F 4DUYF 4DR6F 4LFCF 1LOUA 1QJHA 2HHHF 3T1HF 1XNQF 4LF7F 4B3RF 4AQYF 1N36F 2UXCF 5LMUF 1IJFB 1F60B 1N32F 2B7CB 4YY3F 4JI6F 2VQFF 4DV3F 4LF4F 1J5EF 1B64A 1XMOF 2BXJA 1N34F 1HR0F 4DV7F 4DV0F 1IBLF 1G1XA 4X65F 4DUZF 4NXMF 4DR4F 4OX9F 2UUCF 2UUAF 4LF6F 4X62F 2RJZA 4JYAF 1GH8A 2KJVA 3T1YF 1XMQF 4GKKF 4JI3F 4GKJF 2F4VF 3OTOF 1FJGF 1G7CB 1I94F 3ZZPA 2YY3A 2UXDF 1VMBA 4DV4F 4KHPF 1N33F 4JI2F 4DV5F 4LFAF 2UXBF 4DV1F 4LF9F 1RISA 4DR1F 5LMNF 1IBMF 2UU9F 4DV6F 4JI5F 4K0KF 1IJEB 4LF5F 4B3TF 1IBKF 1CQMA 2ZM6F 2E5LF 4JV5F 4X64F 1HNZF 1FKAF 1HNXF 4DR3F 2B7BB 4JI7F 5BR8F 2J5AA 1HNWF 3R3TA 4LFBF 4JI8F 4DR7F 4DR2F 5AJ3F 1XNRF 4NXNF 4LF8F 1CQNA 4JI4F 4YHHF 2BVZA 2UUBF 4B3SF 4B3MF 4DV2F
chains in the Genus database with same CATH superfamily
1SC6A 4XDCA 4DPXA 2YKAA 1DQAA 2XMVA 3A8JA 1V5VA 2HS4A 4ZVEA 2R8JA 3MD3A 4LFCF 2R2UA 4NA1A 4OQJA 2RF2B 3RRHA 2CZ9A 1DLOB 1VBKA 2EFGA 2YWWA 4YR3A 3M6WA 3P6YC 4CNZA 5LOQA 3D2WA 3ZC4A 2ZH7A 2XY7A 2JEFA 4KPYA 3M9OB 2F8MA 4B3RF 5KG3A 3IBCB 3TNVA 2EK6A 4OLPA 4JBCA 2V4JB 2B7CB 3EWGA 1XMOJ 3IWNC 2W2MP 3DOKA 5A76A 3DDNA 4LF4J 2YH0A 2RHSB 1AYEA 5KFRA 4D3HA 4O3NA 3IRXB 1SL1A 2FYXA 4FYWB 3FEYB 3CDAA 1AA1B 1HPZB 5KT2A 4DLEA 3RB3A 3D28A 4HH0A 4CLFA 4IO9Q 2XZWA 2UVVA 4DQPA 3OXLA 2ZJPQ 1B7FA 2DR9A 5HBMB 4OZ5A 4TU7A 1U1OA 4N56A 1DARA 1KQSR 5A0YB 1BWVA 1VRUA 3I0SA 1VIOA 3F56A 4M1KA 3P3DA 1ZM3A 1U2FA 1RU2A 3CJ4A 2FZCB 3QT8A 2CNLB 4ZITA 4YR2A 2BR0A 1SV5A 1TUGB 1GMWA 4OX9F 3ZTPA 1TTHB 5MAOA 2WBMA 4IRKA 2B8PA 4FN5A 5EUHA 1XMQF 3MM9B 3T6BA 2E9TA 2XULA 3OVBA 4LVNP 4ERDA 3MM5B 2G4BA 1G2EA 1WORA 5D4LA 5A6PA 1R31A 4QPTA 2CG4A 5JUMA 1K9MT 1D3WA 4WYLA 1NPKA 1ZAVA 4OZ3A 5HMXA 1B70B 3TAQA 2WCXA 1RHMB 3OVAA 4W92B 1PJ5A 1GX6A 2M70A 3IR6B 1VRTB 3RYLA 4J9KA 3GQCA 5HL7Q 4LFAJ 1OIAA 2CJQA 4K50A 1S59A 1WHVA 2ZOGA 4DX8H 1FX2A 2KYXA 3FEZA 1MROA 3H7HB 1BQMA 1X4HA 3MEDA 4FZVA 4KPCA 2P5VA 2UXCJ 2Q66A 2HGNA 3QRQA 3DLEB 2K7KA 5K5MA 3SQOP 3KUGA 4N76A 2PGCA 3VGTA 4ZLJA 3JB9k 4ZIVA 2B5JA 3WBZA 1IKXA 5E41A 4YB5A 5DS7A 1SI9A 4ED7A 1AUDA 3VCDA 4DV6F 2YWFA 3MPVA 2X1FA 2VA2A 4LF6J 3HJFA 1MWYA 1IKVA 2FLNA 1U02A 3SCIE 2MKJA 4WJBA 2AGQA 2I5JA 1F1BB 4I0WA 4ZJOA 1ZOTA 3CD0A 4UZBA 4MH8A 2K06A 3AQOA 4C3MA 4N41A 1IBCB 4ZPTR 4N77A 2ASYA 1DQ8A 3DLEA 4HHJA 4LSLB 5D0EA 4IFVB 4P6QA 3I0RA 4KGXB 3W62A 2QLXA 3PYEA 3MZIA 1D1UA 2EFPA 3O6QA 4C8ZA 3E2EA 3N6LA 4IR1A 3C66A 5BYRA 5HROA 3HXMA 2OAUA 4DR1J 4DR7F 4LFBF 4IH7A 1UPMB 2VC0A 2RD5C 3U27A 4Z7YA 3NG8A 4PXDA 3DOMB 1S76D 1RCXB 3BV8A 3SFUA 3UDVA 4O44B 4CLYA 4EYHB 3GYXB 2HLTA 4NXNF 4EUVA 2RQCA 3NGRA 3V4IB 4DSFA 3D0HE 1RT1B 2DH7A 2V5HG 3EMTA 3NWGA 4U67Q 3SSQA 4RW6B 3G71S 1JKHA 1Z4UA 2PEBA 2WVFA 4I67A 3NCQA 3DM2B 5E33A 3TO8A 4F26A 1F5BA 2AJFE 4WBFA 4FF1A 5G0RA 4FYXB 2NYHA 3GONA 1RLCL 5ETRA 3TZZA 1LOUA 4GKKJ 3W61A 1T11A 3D7SB 5HANA 3KK1B 1T3NA 1KFSA 4MFBA 2JHEA 5KFJA 3NBPB 5IT0A 3QSYB 4BWJA 3JYTB 4LIWA 3RBXA 1NKBA 5G4DA 1XNQF 5J2QB 3VR1A 1N36F 2DGXA 1H0HB 2DNPA 3QBCA 4IG3B 2HLUA 3GSIA 2Y8YA 2C3UA 5I3UB 5DGAA 1U1KA 2DITA 2HAFA 3UN3A 3SSRA 1PILA 1BD6A 1JLGA 4KKOB 3UD4P 3W5YA 3WIVA 4OYOA 5JXSA 4AL7A 4KQZA 4KE5A 4LF1A 5L1LA 1U1MA 5I3QA 3I5AA 3JYTA 2L3MA 4DSLA 3CJ5A 1B7YB 2XSFA 2EKYA 3M8QB 3NNCA 1T7PA 1ZS6A 3PY8A 2HHUA 3EYZA 3MD1A 1VQNS 2YQ0A 1CJKA 2GJIA 2L9WA 2VODA 2LXIA 1N36J 5JMNA 1H2TZ 1X60A 4CTAB 2EFVA 1ZZNA 1NJIT 2O3DA 3VZHA 1ULRA 3UCUP 1ZH5A 2W7OA 2XWYA 1WOPA 3K59A 3TUPA 4MK9A 1RTZA 2MGZB 1PC5A 2FB0A 2GMLA 3BKUA 4WP8A 5DDQC 2BQ3A 3DGVA 2ILYA 3T1YF 3BO2A 4OHYA 2M88A 2ZC4A 2MZSA 2V69A 5IV3A 5IC4B 1NDPA 1RHQB 4OMFG 4L75A 1C1CA 3CMAS 3DHWC 4F4AA 3KKFA 4WFAQ 3JSMB 1NPPA 2A6OA 4I2PB 2I8EA 2J6TA 1DTQB 4LQ3A 4FXWA 3KK3A 1B99A 1BXNA 3EJMA 3P8BB 2LEAA 2OSRA 3HHLB 3VQTA 1L3UA 3DRRB 1CJUA 3NKYA 2FZGB 2BJ7A 2GCFA 2RKIA 1UZHA 4I7FA 4J9UE 4X4SA 2MGZA 2OMLA 3EVOA 1OSDA 1W2IA 2KRBA 2HNDA 2MZQA 2DR6A 2QA1A 5DETA 3N6NA 2ZJQQ 2N7YA 2HQCA 2Y0BB 2D74B 1P6TA 2PMZD 1N4LA 2LQ9A 1TKTB 4F2RA 3CCWA 1RAGB 3SCLE 3KYLA 2K3IA 4WCEQ 3QFHA 5GAHI 5LMNF 5HVGA 3Q8PB 4KIAA 1LW2A 4X4UA 3M8QA 3GU0A 1G6BA 4P2SA 3PW0A 5CH7B 3K89A 2ZH5A 4PPZA 3ET6A 3LTOA 4CO4A 3TJAA 2E9RX 2AX0A 2JL9A 3BZQA 1RKJA 2YKPA 3K5NA 2DGSA 4ZDNA 2FJWA 1JJ2R 2D9OA 3FCWA 2APOA 2YXLA 4X64F 1MSWD 4K4WA 2HVIA 1PC4A 4CWBA 2WZ1A 5EWFA 3KHHA 4PQUA 3R6LB 1RDRA 2Z57B 4I69A 1I3OB 2L48A 5DRKA 1MW7A 4JI5F 2KZZA 4PAAA 4Z7CA 4Q45A 3Q89A 5EN1A 3MOZA 2IA0A 1HL6A 1WF1A 2XI3A 5JJBA 2OUGA 2AHOB 2J7UA 5E3RA 1WKLA 4RZRA 3OLBA 1PKUA 4IFYA 4NLTA 2BMBA 1CVJA 1FFSB 3ULHA 2MY8A 3MAAA 1NK9A 2M4MA 4M63A 4ZIWA 5ETTA 2CPDA 5LMUJ 2BQUA 3PZPA 3KK2B 2MQ8A 4Z37A 1UWBA 3LP2B 4DSJA 3FBFA 1RT1A 5ETQA 5KFPA 3OR2B 3BSCA 1FJCA 3QMQA 5K8PA 4JI5J 4RBTA 4J7CA 4LSNA 1NHVA 4O44A 1FDAA 4WP9A 1UW9A 2ZKTA 1JQGA 1N0UA 4I64A 4ZP9A 3FNNA 3WDOA 1VK8A 1WC0A 2CVEA 3BDPA 2VBXA 5CXTA 4B17A 5L8RC 2DNNA 2YKOA 1S4FA 3B4MA 4EYIB 2HBRB 3H90A 2J8AA 1TMMA 1RWKB 3PDNA 3K58A 1U1LA 4DFKA 4LF7F 3RR8A 2VZ9A 3PKMA 4LREA 2IA6A 4G1PA 4NEYA 2RNEA 3Q2SC 4C0HA 4NLSA 2M7SA 3SIPB 2MXYA 3QGPA 3IG1B 3P4UB 3EZUA 4YY3F 3FMWA 4IKAA 2VQFF 2RDDA 1R43A 4ZVQB 4MTPA 1VDHA 1ICEB 2LA6A 3HFZB 5D3GB 3GILA 4CRJA 3G96A 3RR7A 4AT1B 1PYOB 2DO4A 5GMKa 2D3ZA 3AD8C 3AB4B 5EWGA 4ECXA 3ITHB 4RW8B 4OI4A 3BEGB 3RW7A 3ICLA 4UW2A 2HWHA 4MYUA 3R2DJ 1WHWA 4KHMA 1SKRA 4IG0B 1BE4A 3MUMP 2X3GA 1S48A 2XEXA 3TANA 2POKA 4F2SA 4DR4F 3Q8QB 1OY8A 2B0GA 1JLFA 3MDFA 3ILLA 3WZ0A 2YTCA 2R42A 3W8GA 4AXJA 4W90B 1RTIA 1HWUA 1T9WA 1Y10A 2LU2A 4XPCA 1GT8A 1RHJB 3SMZA 1U09A 3HO1A 4UT4A 5E3QA 3I4PA 4DN9A 1U4BA 4IH5A 4L73A 3BJYA 3BDEA 3I82A 5K20B 3PRDA 3PACA 2C42A 4LRFA 5GVQA 4DFMA 1OYDA 3AXMA 1I1GA 1BHNA 2LXUA 1U0SA 4ZVTB 4DZ6A 3OL7A 3TWZA 4A47A 1FWPA 4C48A 2MPUA 4FPRA 4RUBA 1F5AA 3H2LA 4LVOP 5F8LA 1L3TA 2D3UA 2C2ZB 3ZZOA 3G87A 2KO1A 4LFAF 3L95X 3TZWA 3LALA 1WG4A 2XMAA 4PRFA 4FF4A 2MLYA 2CPHA 2XSJA 4KT0C 4YP3A 2CQCA 3GP9A 3IR5B 4UOHA 1N5SA 3LGMA 3TR5A 1M90T 1VRUB 4K4YA 2MLXA 3PW4A 2DNHA 1RT7A 1U0HA 3I5CA 4A8KA 4ZLLA 1H7WA 1RWOB 2V2VA 3PHTA 1XMQJ 5GAGU 2VASA 4O0IA 1X4BA 1WC6A 3FFIA 2M8DB 4OYWA 4I56A 3LWMA 4OZLA 2VJVA 3JTOA 2JEJA 2QT7A 5KG0A 1MLAA 2O5DA 4U8VA 4DHVA 3HHLD 2FGOA 4DEZA 5ETVA 1YK9A 4B3TF 3BSNA 4DX7A 4Y00A 2M9KA 3EDRB 2BJEA 2JC1A 3HSZA 3DOKB 3ISND 2E9ZA 3L7PA 1RAFB 2H51B 2VONA 4CH0S 4I2QB 1KS2A 3VAJA 1RU1A 2EBGA 2XSJB 2ATLA 2CDRB 2QSWA 5HQ8A 1HBUA 4OHVA 4PXEA 4ED0A 3QGHA 2RU9A 4M5HA 2KXFA 3SZ2A 3A3NB 2RUSA 4Q8FA 1NSQA 3G82A 4LF2A 3T9ZA 1WG5A 3JAMU 1U6BA 1EZZB 2ZM6J 4PXBA 3TEGA 2QEXS 1W7WA 1NB2A 3N6MA 1R8CA 2B51A 2RSQA 4ZPWR 1ZPWX 3W5ZA 2R8IA 3M6UA 4U8YA 3M9MB 3QATA 1LW2B 1XNRF 3M30B 1DJ0A 3TX0A 4DFPA 5AJ3J 1HNXJ 4JOUA 5CYJA 1S12A 3D6MB 3RGIA 2VPXB 1JLFB 2XTJP 5IT9U 5K9FA 1I94J 3LAMA 3KMQA 3DRSA 4C9DA 4A48A 4DR6F 4LMZA 1DTTA 3HMJG 3HHLA 4ELTA 1QJHA 3JTNA 2ZH9A 2M52A 3MEEB 3GJQB 3HT0A 3P96A 1PAUB 1SH3A 2HNZB 1NUEA 3HSGA 3P49B 3SDEA 3V5RA 5KFOA 1EETA 2LKZA 4NLWA 4UQGA 2B9XA 4L6V3 4NASA 4PR6A 6FD1A 4RU9A 2J0SD 3PTWA 1KN6A 1JJCB 1ZA1B 5IV4A 5DZ7A 4DU7A 2IM2A 1WHXA 1PGZA 2DR8A 1HHQA 4NXNJ 4NLGA 1UFLA 1YJRA 3IO1A 3POTA 1Q5VA 4ZVFA 4LRBA 5DQHA 4DR2J 2CA9A 3T5LA 1IKVB 2DHAA 4F3QA 7AT1B 1VBZA 2VFSA 2OSQA 4NLUA 1FJGJ 2W2PP 3ELHA 2Y1JA 1K73T 4BS2A 3MR7A 2HVEA 1IKXB 2BACA 4USTA 4FS1A 1CEZA 1FWLA 4AFFA 1M1KT 1EX8A 5B0BA 1TL7B 3H5SA 1SJRA 4TLQA 5H9EJ 2Q6CA 4IDKB 4TYBA 1IVZA 4P2MA 4QZVB 4WK1A 1SKSA 3GZ7A 4DL7A 4OYMA 2OPQA 3DXSX 2NXEA 3GJRB 2B4UA 3R1HA 4X62F 5KFXA 2A2DA 2WONA 4OJ1A 2H48B 1FFGB 2HQIA 1C1BA 4QWEA 4UTGA 4RW9B 4CI0B 3UQSA 2DR7A 1QVFR 4H4MA 4YS2A 4KO0B 4OX8A 2BANB 2MQMA 3T41A 1K0TA 2JVRA 4DV4F 4O23A 3RBZA 2V8DA 2WONB 1BMQB 1M0SA 1NNDA 4RNHA 5G0RB 4FF3A 1KLMB 4K8RA 4DV5F 2BE9B 2F9DA 2JH3A 1CJTB 2ZBCA 4I6YA 4F50A 3D6FB 1AT1B 1BQXA 3V81A 3LPYA 3MGJA 4RW6A 3W2WA 5F0WA 4TQRA 3CJ8A 1P8GA 2HMIB 2IAJB 1OPZA 1A9NB 3MPWA 1U45A 3W60A 5AXNA 3R7SB 1IBMF 1TKXB 3K2YA 5BR8J 2X1AA 5CZXA 3SCKE 4RUAA 2E5GA 2IM3A 4XTTA 3VV2B 2PMWA 2V8HA 1YKWA 1YBUA 1TL1B 4ZP6A 1U8SA 4BHQA 2K7JA 3C15A 4OJHA 1GMUA 5T41A 2AZ1A 4TY9A 2C2MB 3BGUA 3GV7B 4JV2A 1NZAA 1YBTA 2RB7A 4ZP7A 2P8IA 1NB7A 2AKWB 4LF5J 4LSLA 3PW7A 4ED2A 2GA7A 4RW4B 5F8IA 4OI0A 3ILJA 2I1RA 3H59A 1WJ9A 2UUWA 3MAHA 1FCAA 3HKWA 1X9SA 2VDIA 3C15B 2RKIB 2UZAA 3BN4A 2HPUA 4I7FB 1J2VA 2OEJA 5D78A 3D3CJ 2BKOA 4DV1J 1FE0A 4F02A 2XWXA 4MT1A 2HRUA 3VGUA 2R8GA 2MKYA 4ZHRA 4MMOA 4DFJA 2CADA 3J7YU 3DRPA 3WC2A 2XNQA 4E2FB 4UOFA 5CHCB 2KT2A 2IYIA 2Q43A 2DGTA 2LQ8A 2BVZA 2NUHA 2WW8A 3ZZYA 2GVZB 4CO3A 2MY7A 3VGVA 1WOSA 2Q1LA 1U7LA 3I31A 4WFXA 3PX0A 3J7YI 4LUBA 5IWAF 2ALYB 3MEDB 2QA4S 3SI8A 1FERA 2VG6A 4HI2A 2CJ9A 3QQCD 3NRBA 3Q8UA 2E7VA 4CT8A 3H40A 2ZZNA 1MN9A 3GFZA 2C3OA 4UQTA 4QPXA 2R2TA 4ELUA 4NE9C 4O3PA 3CCJS 3QWUA 1QE1A 3D4JA 5FIIA 2DBBA 4GMKA 4KO0A 4U9RA 4ZVGA 1HKAA 3IS9B 3SXLA 3MM7B 2HWIA 4PCQA 4KB7A 5M2RA 1EIYB 3R5AA 1YJTA 1UCNA 1WDDA 4B9UA 1RWUA 4LF8J 2V68A 5FDLB 3J80Y 2EXUA 1Q79A 2VUGA 1B4SA 2RU3A 4M5KA 1RT6B 1LWEA 3R5JB 4AD6A 4Q44A 5K14B 4B3TJ 1KVIA 4OYAA 2ROEA 5KT3A 2HNYB 4YDDB 1N52B 4WFNQ 4P9SA 1WC5A 3LF0A 4NLXA 3UPFA 1WF2A 2MEWA 3NXZA 3VAFA 2GAGC 5HP1A 1RTDA 3CD6S 5IQQA 3NAHA 4R5PA 4DV7J 4OYZA 1XNRJ 2XO7A 3KK1A 1A0OB 1J27A 2B6AA 1HBMA 3GSDA 2JLFA 4Y34A 2QLFB 2W24A 5AXMA 2BW7A 2ZBIA 3M9NB 1G1XA 1SIZA 1DHMA 2AJ1A 2IMOA 1Y00A 2VV5A 3A4TA 3JSRA 4F4ZA 2V4JA 3OR1B 4WFYA 2FZKB 1F9FA 4H4KA 3CO0P 2NXUA 1H98A 3D6HB 3SCJE 1IUJA 2B8QA 1PG5B 1RT3A 5C5JA 4CO1A 1ITPA 2XNRA 4C97A 2CPXA 4ED5A 2VBYA 3KDNA 1XR6A 3OLAA 3PJWA 5D0RA 4X65J 5F3TA 2OD6A 1FI4A 4DL0C 1UMJA 3HHKA 2OELA 4ER8A 1NK8A 3LOUA 3RAQA 2N3OA 1KVJA 2A3JA 3NGSA 4X4OA 3QSIA 1VBYA 2R4FA 1D9FA 5DQGA 3ZTRA 5KFKA 1R3NA 5AXKA 3BB5A 3MAQA 4WZQA 2WK4A 2WAQD 1QDUB 1R8HA 1Q5YA 2AW0A 2XYHB 4ZPAA 4N47A 5IM0A 4JI7J 1LFPA 1G4CA 1ZM4A 3M2VB 3W9HA 1RT2A 1O0PA 3PM9A 3UWTA 1XR5A 3WQPA 2OLWA 3KJFB 1T0TV 1WI8A 1UA0A 2D9PA 3HSDA 2MHNA 5E5NA 2ERRA 4A8FA 4KH1B 2HHXA 4BC7A 2GGPB 4CLLA 4DX6A 1NO8A 1KWMA 1TU0B 3RTVA 3C6TA 2GVDB 1RWVB 2ZKUA 4GRSA 4OZJA 2AGPA 1S7HA 1UETA 3EXYA 3JQKA 1UPPA 2FVPA 1C0UB 1MROB 1UAWA 3AOBA 2K2PA 1NK5A 3OL9A 2IVYA 3UN5A 2DYAA 4U96A 2B4PA 1TL1A 4ANCA 2ZNYA 1JX4A 2W4DA 2ZE2A 5J1EA 1T9VA 4QOTA 1Y11A 4ZVPB 1M5VC 4HDGA 4ZCKA 3S1TA 1SL2A 1LWCA 1S6PA 4JI4F 3NS5A 3D66A 6FDRA 4U7CA 1HHTP 1KQGB 2WSFC 3TYTA 1PIEA 4JV0A 1R6YA 1WTBA 3CIMA 1S4EA 1FXRA 3FEXB 2HMIA 3X3UA 1NHKL 3W2WB 3KK2A 2UUTA 3V81B 4C8OA 5KFUA 4NLRA 3THPA 1KONA 5DDOC 2DRAA 4LJMA 3KJVA 2EC0A 2O67A 4KGMA 2DHGA 1NHUA 5A8KB 3VAKA 1FK9B 3PRBA 3QIPA 4UUWA 1KRPA 5MLCV 1SC1B 4P75A 5A0YA 2E5IA 4FDFA 2W25A 4LQ9A 4DN0A 2HHSA 3AFGA 2HFUA 1WC4A 1VQ4S 1RT5B 1WNEA 2ZH1A 2JLGA 2DNMA 2E1AA 4HLBA 5KFEA 4DV0J 1VQ5S 1Z1ZA 1RJJA 4GO5X 5E7OB 4YQWA 3KG4A 2WOMA 5LMUF 2K8GA 1HNVA 1SJQA 3LP1A 5I3PA 4FYYB 4BWMA 2FJBB 3N79A 3TAMA 2IRXA 2XLJA 3G8TA 2G0JA 2OPQB 3KNAA 2RRNA 4KH0B 4EMDA 2C3PA 3QAEA 3U02A 4USHA 1HWJA 3CPWR 2L08A 3UE2A 2J9DE 1PBAA 1B0TA 2BM1A 2CPYA 3BPSP 3MUTP 2OIHA 3CSKA 2VFVA 1J5EF 1TQLA 3BF4A 1XMOF 3I9V9 5ETMA 2DNRA 3PR5B 5D3GA 2XGPA 1RT3B 4Q0BA 2W9BB 1NJXA 3I4HX 1RP5A 5L46A 3DC2A 2MZRA 3GE9A 4KJIA 1OSCA 1NLKL 2GW8A 4EBCA 1RQ0A 2HZVA 3MXHP 1SUQA 2AZ3A 2NCKL 1T02A 2NYIA 1C0TB 3W9JA 3CJQA 3TQEA 4Q43A 2QLBB 1AXQA 1UP1A 4WYWA 5B0CA 2M5YA 4G1IA 2BX6A 1R27B 2R3VA 2WSEC 3MFIA 1NKCA 4I6WA 1HBOA 1BC6A 5LJ5Y 2I38A 2B6AB 5HO4A 4DQRA 2ROGA 3MF5A 1RLDA 3SDEB 1QAXA 1S1UA 3ZFVA 4JI1J 1Q0NA 2HWTA 2FVRA 1E6VA 1QSYA 2XMTA 4J90A 2KVQE 4DSEA 2GX8A 3V6KA 2W01A 3I6PA 3DI6B 3OT9A 4N7TA 4WTYA 1OYEA 4OI1A 3KLEA 1IKWA 4F4XA 5HATA 2QLJB 4KHPF 2XMWA 1R8AA 5LSLA 2C22A 5K14A 2JSXA 1N48A 4X4QA 3KLHB 4PWUA 2CNKB 3H98A 4QU7A 2JC0A 3I32A 3CDBA 2AYGA 4ED4A 1CJKB 1M1HA 2K3KA 2DRBA 4RW7A 3FBBA 1VJQA 4RNFA 2VFUA 3LGHA 3Q8VA 4IFYB 2AIRB 4KY3A 2F8HA 4QIFA 4D3GA 4ICLB 2P9GA 2ZZMA 1AFIA 2GO9A 1OO0B 4RO0A 3TJ9A 3VTIA 2YNHA 2LA4A 4M5LA 2CJAA 2RDIA 3LA0A 1U1NA 2L9NA 4XPEA 3OL6A 4C3KA 2QTWA 4A4JA 4C7QA 3OV7A 1CULA 4C8KA 2FC9A 2HVDA 4KHRA 3UCZP 5L39A 1YSJA 4ZJQA 5I4MA 3ISZA 5T7LA 3MR3A 1S0VA 2JJ4D 2IY5B 2DHSA 1FRXA 3HZEA 4UF4A 1LWFB 1BY9A 2DISA 2GVZA 3GIKA 4K2XA 4I2QA 4PG5A 1QSLA 4LFCJ 2F9JA 2BE7D 1GQEA 2CNNB 2DIVA 3OFFA 4FVMA 1F2GA 4G6VB 4CH7A 3PIPQ 1LW0B 3PVXA 1CULB 5KFIA 4BDPA 4MK8A 2QV6A 5KOXA 3QO9A 4ID5A 1R0AB 1KP6A 2BUNA 1EKSA 5CQGA 1ZA2B 2XZDB 5H1SV 4JI4J 3HLUA 2NPIA 5A8RA 4DCOB 1V6HA 2XBPA 4OL8A 1U2RA 2YNIA 4OIXA 1JXEA 3D0IE 3PYDA 3QT6A 3NGDA 1X5OA 3CW2C 3MM6B 1FEHA 1JKHB 5KFHA 4DR7J 3CNQP 4CLSA 4QBUA 4ZCLA 2BM0A 2EVZA 4DR5F 2WBRA 3QNWB 4NOHA 1QY7A 3G8QA 3H5UA 2KDOA 4URSA 4A8XA 2F4VJ 3F0NA 3H20A 3H2VE 1EQ0A 4MYTA 4EO8A 3KLEB 2HS3A 3LWLA 3KK3B 2GMJA 1NDCA 1WEZA 3TW0A 2P6TA 1RAAB 1T8EA 1J5OA 3HHLC 2VQEJ 4W98A 5J2NA 3DLGA 4TY8A 1T05A 2G13A 1N0VC 1CG2A 3CDWA 4F25A 2V9KA 2IAJA 4WFBQ 3EPIA 1FTRA 4IFVA 1VQ9S 1VK3A 2V9WA 1B3TA 4JI3J 5CZVA 2RS2A 2BJ3A 2GJFA 2KT5A 1KKHA 4OV6A 3KWMA 4M5GA 5B09A 2MQQA 1I5OB 4JI6F 1HBNB 1H7XA 3G6VA 3Q8YA 1A6LA 4LBHA 5KFGA 2VIHA 4QR2A 1FDNA 2CQDA 2LU1A 2VHGA 4ECUA 4Q0BB 3PEHA 2OTJS 2HURA 3C16A 4C4WA 5H9EK 1GAOA 2B5JB 2RMLA 4KAIA 2ZUGA 4K5RA 4DR3J 3J81Y 3RW6A 4UUXA 4MKBA 3MOJB 1Q81T 4WKYA 4ZOSA 2E7XA 5FLXU 3QZ7A 3QZ8A 4K4ZA 2HKEA 3FQLA 2AJ0A 4NXMF 1RTHB 2M2BA 5DO2A 1K0VA 2HGLA 4BLGA 4J9RA 3HT3A 1Q95G 3LW5C 5DM6Q 2XMKA 3DLHA 4GO7X 1RK8A 2FLOA 4C0OC 2RAQA 3R5GA 1CS4B 3DRYA 1CJVB 2F4VF 3K0JA 2J9DA 1R6VA 1RT5A 2OI2A 4X4PA 2CVIA 1RKIA 3R6GB 3QRRA 4LRCA 3F44A 3VZIA 1WEYA 2WHOA 2E5HA 2HSEB 2QGFB 2WW4A 3PJXA 5F8MA 3V6JA 5A8KA 4JI2F 3QJJA 2FJVA 1GXUA 3OR2A 2RVJA 5HK4A 2J7WA 1UJ6A 3A8IA 3POTB 4JP8A 4PYAA 4HT5A 1F3VA 1SV5B 4CH1A 3R8YA 2J0WA 2YKNB 2ZHOA 1MMNA 2GS8A 1RISA 2NSCA 5KFAA 1UEVA 5DLGA 4WXOA 5CD4A 1O6XA 2DD8S 2QMXA 4F0HA 2HYIB 2VA3A 4DDFA 3WC0A 1YX2A 2DGVA 2XS5A 1YJ7A 3IMQJ 4J9VA 1ZAXA 3HVWA 2GZOA 1LWCB 4K0KF 4QWDA 3CJ0A 3VAMA 1R0BG 2ZE2B 5J1EB 5HAOA 3RB6A 4DCJB 1RT4B 2KRRA 4DS5A 2IIHA 1H2UX 3NS7B 1R89A 3NWRA 2BJDA 4CQ1A 3A8KA 4K4TA 5CYMB 1T03B 2CKWA 5KFDA 3J81U 1HI1A 1M5KC 1FD2A 3ZXWA 2V8VA 3OTEA 4FKXA 1IXKA 3VF0B 1S1TB 3AHPA 1T9XA 2GMHA 2LYVA 2PDAA 3CDUA 4ZP8A 5BYQA 2W8LA 1S72S 1WKKA 3CJ3A 1AW0A 2KB2A 5A8RB 1UJ4A 2R8KA 3V6HA 3C6UA 3ZTOA 4JI8F 2CWKA 2AYMA 4UOGA 2A1BA 2CQPA 2IC3A 3EDQB 4WU3A 5F0UA 1X4EA 4C8MA 3THTA 4EBEA 3W2VB 3CCVS 2PO4A 3RUBL 2FY1A 2GQ2A 1U25A 3LAKA 1VC6A 3OL8A 1Q4RA 1BQNB 1PJ7A 1Y5LB 2XMUA 2MKHA 2Z4PA 3EE3A 3UW1A 5AE2A 3KLVA 1S1VB 5BYSA 2RH3A 3B4DA 1TAUA 3HCXA 1KNZA 1RGVA 4NLDA 3BR9A 3UI3A 3D3BJ 2VG5B 2XG8A 5I42B 2XYGB 3FMBA 3RRKA 1XERA 1DFDA 2KT3A 1RAIB 1HD0A 4ATNA 2HHHF 4PUOA 1N5QA 1P1TA 2K1RA 2MQPA 4TQSA 4X4TA 1Y9OA 1KC8T 1DBDA 3D1HA 5KFNA 1RUSA 2AJ4A 2R7VA 2EC2A 1XNQJ 5M2PA 1VJWA 5BXIA 2UV8G 4HT7A 4HHUA 3QLHB 9ATCB 4YB1P 2UXBJ 4M8LA 3TUZC 4C3LA 3CCSS 3NNAA 1S1WA 2YVSA 1Q53A 4KFBB 2RILA 1FEEA 1IWGA 2RQMA 1SQEA 3AH6A 3U1LA 1YVFA 3HFKA 5J2PB 2KFYA 1SKWA 1GEHA 3RB4A 3DMJA 4CM2A 3H4BA 1TZ0A 4DV3F 5GAGI 4YR0A 5L38A 1DY3A 2MYFA 3CCTA 3GFXA 3I9ZA 2KFNA 2H3EB 1UVIA 1SJ4P 2Y0SD 3O1LA 1U24A 1HPZA 1O5JA 1RBOB 3AD7C 4FKYA 4QIWD 1FT8A 1NJWA 4DSIA 2QC3A 1F9HA 2BXJA 2J9CA 3AB2B 2FHJD 3CD5A 3GYNA 3IRXA 2YQ3A 1RAEB 3A3OB 8RUCA 3DDIA 5I42A 2UXDJ 3BSAA 3HHDA 4DV4J 1NCLA 2F40A 3QPIA 4UOCA 2ILZA 4X65F 3EPGA 1JLGB 4KKOA 3PX4A 2QX0A 5E2QA 1IR1A 4O0NA 5GAEI 1SUQB 2R7RA 1VHFA 5FDLA 1RYSA 1U6ZA 3GCXP 2ZITA 2KJVA 1Q8LA 1MMDA 1PJ6A 2OPSA 2X1BA 4N8OA 1QSSA 4IRDA 3UFCX 4HTIA 2WRMA 5D4NA 4NCAA 1SPBP 2C2OB 2CIMA 3KG0A 3BGOP 2DT9A 3NOGA 4MK7A 4ZN3A 5F9NA 1NM2A 1JLBA 4WK3A 2YBVA 1A7GE 4M5MA 2EG2A 4XDDA 1RBAA 1SC3B 3CXCR 5DQIA 2CJXB 2GHPA 3AOCA 5HVFA 2J9EA 2WVCA 4A8WA 2ZDOA 2R2SA 1UJ5A 4YN3B 3OTBA 5D4PA 4RNOA 2XC9A 4KHPJ 3IG1A 2DVIA 2UXBF 1RAHB 2SXLA 1R0CB 4FPIA 3QJLA 1SQFA 2CPJA 5EGYA 3Q83A 4LF9F 1TL3A 2E66A 3V4IA 1XBWA 4WF9Q 4C0BA 3OSNA 2RIJA 4A8MP 2DNYA 3PFOA 1RT4A 4FBTA 3RU0A 4WPAA 1S9FA 1TKZB 1W25A 4P52A 4CZCA 4H54A 3R97A 2HK3A 3K5OA 7FD1A 2PD1A 2ZNZA 4R0EA 2QL5B 3HD1A 1F3FA 4QR0A 4XIUA 2Z8QA 4NWBA 4C8LA 4K4SA 1IBKF 2RQ4A 3NCRA 3DOLA 3O3LA 2H4YB 3CCUS 4NLYA 4F4WA 1HNZF 3LP2A 3GG1A 4RW4A 1S1XA 1WI6A 3KLFB 4ZN1A 2YNGA 1WDTA 3ZZTA 1F0XA 2O01C 3MM6A 4KSEB 3GJSB 1V9OA 3TAPA 3MMBB 2XS7A 2E5JA 4OJ3A 5BR8F 1JMTA 1H3DA 4NZ0A 1UFWA 2PMHA 1F6TA 1NU4A 3OFEA 3VVTA 5C2GA 2QSFA 4K7QA 1OJ4A 5GADI 1WG1A 3T6JA 3AY0A 1FKPA 3OD2A 2Y1LB 2XYPB 4OI2A 1S6PB 2V2ZA 2MZ1A 4O3OA 2WSCC 4N5SA 1QM9A 1CBKA 2ZD1A 4ECQA 4DXLA 4HACA 1RTJA 1UFKA 2AYEA 3EICA 4P72A 5D0GA 4C8NA 2YWGA 2FVCA 1NDKA 2DRDA 2JFKA 2W7AA 1Q1KA 1X4DA 3MEKA 5A6WA 3TUIC 4AYBD 4YMEA 6AT1B 3GV8B 3W5XA 1JLEA 1MNEA 2FVQA 2R7UA 1REVB 1XN9A 3Q22A 2MSTA 2HVHA 2XY5A 1ZTWA 3TUJC 1HNIB 2N4DA 4TN2A 4DUYF 4ID8A 2HFOA 1H2VZ 2I0XA 4ECSA 2I9SA 5GADU 2YX7A 4KTQA 5IZHA 4RUHA 1IM6A 2VPYB 2BABA 3ZZUA 3T1HF 3NCPA 3EGVA 4U7UK 4B3MJ 1Q82T 3FDSA 4RW9A 1EP4A 2UXCF 4IRCA 1HI8A 1NAQA 1SXLA 1YHQS 1UZDA 4EI2A 4IOCQ 3G6YA 2W7PA 3T5KA 1I6JA 1YDLA 2XLKA 2F1FA 3PRVA 4ETXA 2BBEA 1H6KX 1GMWD 2ASLA 4WWSA 3J7A1 3M32B 5HQLA 3M8PB 3V4MA 2AF6A 4YHHJ 3MPUB 4HHHA 4MKYA 3ZZZA 2D3OR 1PCAA 3IBFB 2ZH4A 4G65A 4OYPA 3BSOA 3J7Z5 1T9UA 2C28A 2FJDB 1GXTA 2B9EA 3KXDA 3DNCA 3OQ2A 5EWEA 3JSYA 4TNOA 2P2CB 4QIGA 1RE1B 3C14A 5CAAA 1IR2A 4DUZF 1NRKA 1FRIA 1O51A 3E51A 4C8YA 1CLFA 4USIA 5HLFB 1HLWA 4WP3A 2C2NA 4CLZA 4OX6A 2JFDA 3D68A 4BBYA 5D8HB 2PA8D 1TMJA 3LUYA 1W26A 3NGKA 1KHVA 4N8NA 1RHKB 1QUPA 4ANEA 2BE2A 1JNZB 4CYUB 4DOZA 3MTKA 3RB0A 3DU6A 2XCAA 3Q86A 5IWAJ 3PW5A 5ETPA 4X2BA 3ISNC 3R7BB 2MKCA 2QMUB 2BRKA 3DHXA 3IC1A 3QO9B 4DPUA 4C2MA 1R0AA 2KKHA 1DTTB 4DPOA 4CCHA 4O3RA 1FXLA 3HZGA 2CXEA 1N33F 4MAKA 2Z2MA 4RBVA 1QD1A 3AAWB 1S6QA 2A10A 3S6EA 2KN4A 2PT0A 3KLIB 3MMAA 4IO1A 1X8DA 3CTRA 5I3UA 3MPYA 4OX7A 4DV3J 2FUG9 1D0EA 2N7CA 1B0VA 2OJ3A 5C2CA 3CF5Q 4Y2AA 1Y3JA 1IQZA 2B4OA 2UU9F 1RCOB 2V63A 1R7IA 3UD5A 5KFFA 1VQ8S 5D15A 1WEXA 2YNHB 3CCLS 3FK4A 3JXOA 1VQYA 3BBFA 3TVYA 3IRWP 1TK0A 5KTQA 1HYSB 4LBIA 1FKOA 4MKVA 3VVUA 1X5PA 5F3ZA 1N5YB 4EZ6A 2C2EA 4V19X 3H4DA 2FY8A 1CQMA 3BPDA 2OPPA 1GXLA 1P27B 3DM2A 2MJNA 4CT9A 2V2QA 2LQ5A 2W4CA 1IKYB 3AXKA 2DH8A 1J5EJ 3A8EA 4JI7F 1AZSB 1I51B 1ACMB 1FRLA 1S57A 4QW8A 5M2UA 1K8AT 2UP1A 2UVWA 2XI2A 4ENOA 4MJKA 3CCES 4K4XA 2XB2D 3VWSA 3OXFA 2K1RB 2OEKA 3PFEA 1FNMA 2YPYA 1E6VB 4OYIA 4ILMA 1H74A 4LRDA 4MKAA 3EGNA 2VG5A 4R0JA 1WKJA 2PE8A 4NX9A 5KFTA 2X7IA 5AJ3F 3GB0A 3B78A 2E1MC 2PFDA 2DNQA 3Q0AA 3FRZA 5SZTA 4PEOA 3MMJA 2Y1IA 4LF8F 3ADAC 3R5CA 3I0RB 5HQMA 4ILLA 2HHQA 2KTQA 3CJSA 3KG1A 4ZPCA 5HLFA 1YJUA 2BW2A 4JI1F 2AYBA 1HNWJ 4BCAA 1DQ9A 2XO6A 4ZPBA 2YNFA 4CDIA 1V5IB 4CO5A 1KOOA 1W2BR 3FQKA 3KNGA 3EZ5A 4JYAJ 1PAEX 1YRUA 1VC0A 2EK1A 2FJEB 3QT5A 4F8RA 4TU9A 4FS2A 2E44A 1TKXA 2GQQA 2E5LJ 3BKTA 1UWAA 5HMYA 4X4RA 3T9NA 3UVJA 4YFUA 1DRZA 3KHGA 2DCUB 3C2PA 4LR8A 1KTVA 2R7TA 1Q8BA 5J2MB 3ENAA 3RAMA 3GV5B 2W9CB 3MPDA 2RHQB 2ZC3A 3GIRA 3WIUA 5A8WA 3HI9A 4EGLA 3GIJA 3ENQA 1VQMS 2QRRA 1T95A 2JOQA 2ZOFA 5IFMA 4IG0A 1XC9A 4JUZA 1XIQA 2J6SA 4EWTA 1KR4A 3TOQA 3SBMA 4NRUA 3OTOJ 4NXMJ 4F3MA 2YH1A 5IS2A 3OFGA 2BKNA 3IBWA 4J9OA 4LF4F 3FSXA 4DJBA 1JLBB 1WTFA 4ZVUB 2KG1A 2GC8A 1KLNA 1RA6A 1SH0A 3PNIA 2DPIA 3KJNB 4H4MB 1SIWB 4I6AA 4IQXA 4IUFA 1RA7A 1MWQA 2IM0A 2H5JB 3DDKA 4WIQA 4DL2A 4K4UA 1FJ7A 4P7VA 3FZBA 3IXQA 4PKDB 1TV6A 3I96A 3GR0A 3OR1A 1YRTA 1CC8A 4OJGA 1WOOA 3T19A 3TX8A 4USVA 3VGSA 4U95A 4DQQA 3MM8A 1H38A 4Q2MA 2ZHAA 2X1GA 3HVTA 1S10A 1CSJA 2HHHJ 4KGVB 4JI6J 1GH8A 4FVCA 3HKZD 2BV3A 3I0SB 2AMCB 4M5DB 3QFWA 1RTJB 3V2UC 1FDDA 3CCRS 3OTOF 3Q24A 1X31C 5D6GA 2IRYA 2Q79A 4FXVA 1RWMB 3C8YA 2IJRA 4TLRA 3HF5A 2YY3A 4B08A 5EDWA 1RAJA 1JNRB 1HQUA 1EHWA 2E7WA 1EARA 1FNXH 3R5DA 2VJUA 1K1QA 4P10A 5F41A 5LL6d 2VG7A 5B08A 1UVNA 1Z2LA 2PFFB 2L9DA 3LO3A 4QWAA 2EEYA 4WIIA 4KV8B 2CPIA 4X4NA 4U6PA 1XK8A 5B0GA 2YNGB 1TV6B 4PG7A 2J7KA 1ZM2A 1S1XB 2DHHA 3KLFA 4DV1F 3FGVA 1TR0A 1S9GB 5E3CA 3DOLB 3QLHA 3MAAB 4ZKAA 5A2QU 2HQDA 4LR9A 1S0MA 2MKIA 1YLXA 3C16B 2CDQA 1H72C 3I5BA 1LNQA 2WVBA 3UCGA 4X66J 4DL3A 5B0AA 3TARA 1UA1A 2FC8A 2OHDA 5KG2A 4B3OA 4KC5A 1VQ6S 4CO2A 1GNKA 2OPRA 2GAHC 2VG6B 3SSSA 3TEHB 1LV5A 1SJ1A 5KFVA 2VU5A 2B56A 4PABA 2OFHX 2LDIA 2GO8A 2XMMA 4F36A 1FJEB 4URGA 3BREA 3DLLQ 4WFZA 2HGMA 5E0OA 1F5CA 2FGCA 3ETOA 4TY8B 3DCAA 2U2FA 2XY6A 5J2NB 1RHRB 1JLCA 2UUBJ 3JSBA 4CLPA 4UZCA 3PX6A 3BO4A 3H8YA 2BYCA 3S8SA 5FLXY 4B9VA 4G1QA 1NKEA 4F4KA 2QG9B 3C6UB 4IYQA 4WXWA 5J1NA 4FNIA 3G82B 3GIMA 4DWIA 4G3IA 5LXRA 4RNNA 2OO4A 4ZVSB 2GFFA 4ECVA 3ZZ0A 3HVRA 3A12A 4J9PA 4YHHF 5KG7A 1X7VA 2BQRA 4MIWA 3TRGA 4R8UA 4QU6A 2KJWA 1PBUA 2HVZA 3NP5A 2ZH2A 4NA2A 5C24B 4ITSA 2GQCA 4G1QB 4RBUA 4KR0B 2G1HA 2Z0GA 5LSOA 4JI2J 3UDCA 1HIYA 4ID5B 2R9LA 3FFIB 2CRLA 2MKKA 1JLCB 1LK7A 5LXYA 1X4GA 2NSBA 2G2OA 2ZH3A 5IT4A 3VAIA 3M8PA 5HP1B 1FX4A 1RT7B 1U0HB 3JTPA 3M32A 4OI6A 5KFBA 4AQYF 2YKMA 4DQSA 1N6QB 1V3SA 4ELVA 2EPIA 3HX9A 2NLWA 1OMSA 1FESA 1N5VA 4ED3A 1RT6A 4F0MA 2CWXA 2IDLA 4NCGB 2EFNA 5HJXA 3SYZA 1AFJA 4DI6A 5CYQB 2G2ZA 1HYSA 3OTDA 3ZZRA 2G0IA 3TA1A 1REGX 2KXHA 2CJKA 2KXNB 5L9NA 3WX8A 3LANA 3Q8SB 3SV3A 3M6VA 4QYZJ 1X0FA 4L72B 3SFGA 4DZDA 3AA9A 3RAXA 1GFWB 1N34F 1HR0F 4PUOB 4NYZA 2VDHA 4QQBA 3OTCA 2QFJA 2FTRA 1OY6A 2I2YA 3NOCA 4OZNA 3FUYA 2DTJA 1JJHA 1NSPA 2QZ8A 5D0HA 2X51A 2J76E 3OBIA 2CQGA 1QTNB 2DJWA 2NXNA 3MHYA 4AUKA 4IG3A 2F7VA 4Q7AA 4QWCA 1UW4A 3TI0A 1N6QA 1HMVB 3ILIA 4HR2A 4KBIA 4Q8EA 4GKKF 4F3OA 5ITHA 4J9NA 1N32J 4RW8A 1VRQC 2RUGA 3NBPA 1ZM9A 1S1UB 2Z56B 1JIHA 3D5MA 3H2UB 4HH1A 1S0OA 2GNKA 3CUNA 3EUNA 3W63A 2VC1A 2NQPA 1EQMA 1S97A 1GTHA 4DL4A 1L5UA 1U48A 1S9EA 1HQEA 2ZOMA 3TP2A 1TAQA 1S1TA 2F5GA 3K17A 4XK8C 1P9YA 2PSZA 5HSPA 2R8HA 1D9DA 3M2RB 4ES3A 1X4CA 3QT7A 2NZCA 4EEYA 4PPDA 3R1LA 4UY85 1U1QA 5CCMA 1YI2S 2UVUA 1HFEL 1IR0A 2AEJA 1LK5A 3DYAB 4KGKA 1ZETA 2MQLA 1T03A 1Y4ZB 4AE5A 4YY3J 4QWBA 4F04B 2ROPA 1UVJA 2HEKA 3W3SA 3DLGB 3HDSA 3MFHA 4ANDA 4M95A 1ROFA 2IHR1 2ACYA 2FJAB 4ZMMA 2DB1A 2AX1A 3D1OA 3GLJA 2MQOA 1TKZA 3HK2A 3NAIA 2ZBPA 2FLPA 1Q8KA 4LF5F 3K5LA 5F8NA 2PIIA 2MLZA 4V19J 1OY9A 3OW2R 4DPWA 2DH9A 3FBCA 3DU5A 4GVLA 2ADBA 2FHOB 2HQGA 4DR3F 1WHYA 4Q5VA 1SKUB 1IBMJ 1TFYA 1T9TA 2Y1RI 2OPRB 4FNHA 3GG0A 1VQPS 3J80U 1S49A 4B3OB 4DG1B 4DUTA 2LVWA 4P2FA 2KFZA 1S79A 2YWHA 3PHEA 3OXGA 5KFQA 4GC7A 1KFDA 3Q2TC 5D77A 4BC9A 2DEIA 5DJBA 3U7JA 3FKBA 1CJVA 5AXLA 3QGIA 4ED8A 4I1TA 1S9GA 2DNOA 2OPSB 1CQNA 2LMIA 3ONQA 3ENWA 1XR7A 1YIJS 1RI7A 2CQ1A 3BM7A 2NPFA 4B3MF 2HW3A 4PWDB 5KFLA 1U8WA 1UKUA 4JI0F 2P9CA 4ZVOB 1TL5A 2EW9A 3B8HA 5DGBA 3BO3A 2F63A 4HACB 2UV8A 4CLTA 2DXEA 3BGLA 2OEMA 2HBYB 4OZ0A 1SH2A 2CQIA 2EFOA 2C3MA 2LQJA 2PA3A 1HHSA 3IAS9 4V1Ak 2MB0B 5KOWA 2M0GB 4XO0A 4OLOA 2VH7A 4ICLA 3SQGA 2R2RA 2IYGA 3M8ZA 3SEOA 1AZSA 2EBEA 3L7OA 4LR7A 4R25A 2V8GA 1H73A 3PR4A 1KHWA 3HVTB 1HBNA 2CQ0A 5ETLA 1N34J 3MMCA 4CP5A 2ATCB 2L41A 4H4KC 4RJVA 5J2PA 1HR0J 2B9YA 3ZNUA 3R7NB 1VQ7S 3DLJA 3EVMA 2DEJA 2GIFA 3U1MA 4H4OB 3IFEA 4IQMA 3M8SA 1RWNB 2YKMB 1Q78A 1YBAA 4RX6A 4DUZJ 2EI5A 2KVIA 1CC7A 5DG8A 1DTQA 4ZCMA 4YOEA 2D41A 4WU2A 3JSMA 5AE1A 2YPZA 2QYCA 1RWPB 3BGFA 3PEJA 3HFVA 1ZTTA 3LPEA 4FBUA 5T14A 3HULA 5EX3A 4B3RJ 1UEUA 2C1EB 3H0PA 4IH6A 5HMWA 1XTZA 3RRGA 1Q7LB 5KG6A 5CABA 4QIVA 1AUSL 4J9SA 4DS4A 3CC7S 3IR7B 4AL5A 2C2KB 3HHEA 2XS2A 4P73A 4IOAQ 1M1GA 4X4VA 3QIDA 4JYAF 3HVAA 2NS1B 3R2CJ 2YNIB 2W9BA 1FJGF 2QN6B 2QL9B 3PYGA 2QO3A 3U1NA 5BJRA 5KT4A 3FJ2A 2XGQA 1X5SA 4ZPDA 4TYAA 5DLFA 3NMRA 4MIBA 2ZJRQ 2BDPA 2UXDF 2DNKA 4W4MA 3MUVP 3CJRA 2Z58B 3KHLA 3PV8A 4IR9A 1LW0A 5DDPC 2YNFB 1L3VA 1TUVA 2BEFA 3IGNA 1IM4A 2VD3A 2LEBA 5GAEU 1LQ9A 4Y65A 2CJBA 3BYPA 3GFYA 1Q86T 2JEGA 1HD1A 4HDHA 4K5SA 5L1KA 5JVGQ 2HFZA 2WOMB 1XMBA 3ENVA 3QYYA 1L3KA 4DSKA 5IQ6A 4E0DA 3EXCX 5H9FK 1YJ9S 1ZAWA 2VBZA 2CQ4A 1BGXT 4NZ6A 1NZ8A 4CO0A 1TVRA 2QA4G 3T1YJ 4HVZA 1S77D 4B9MA 1YJVA 2CZVC 3CB4A 2BJ8A 2G9OA 2OGUA 3FCHA 4ZJLA 2ASDA 2UUCJ 5E3PA 3FC9A 1V3RA 1Y7PA 1NDLA 4NI2A 3H5YA 1M5HA 2WTFA 3D54A 3TQ1A 4JV5F 1QTMA 2V0NA 1HNXF 2ZBRA 3GWCA 1T9YA 2R7QA 1U49A 3KLHA 3HP6A 2HIYA 2N82B 4DQIA 4M5JA 4UY8T 2IM1A 1K44A 2VB6A 3NL0A 4QCLA 2PI4A 4QR1A 2FIUA 1QLNA 1URRA 4JI0J 1HQUB 1V3ZA 3DFEA 3DOMA 5B7WA 2ZHBA 5JVHQ 2N3LA 2FLLA 5IOLA 2ZWPA 4RWWA 3SV4A 2ADCA 1NK4A 2FQQB 1TVRB 2H5IB 4JB8B 5B0FA 1KQKA 1NPRA 2WVDA 4F7VA 3B82A 3WHIA 2KHCA 4ECWA 1VGYA 3BQ1A 3O8WA 2AJ2A 4M5DA 2W9AA 3DN9A 3QJPA 2CPFA 3D67A 2PN6A 3A3PB 2RRAA 1M5OC 1OWXA 4OZ1A 3UNGC 1FRKA 1REVA 3FSYA 4JI8J 5LMNJ 1C0TA 4DV2F 4FXDA 3T3FA 4YDXA 2P6SA 1S6QB 1GTEA 2NUUG 2I5JB 4OYBA 5ETNA 4KYZA 1UEKA 5C42A 3AJ2A 3Q23A 2CYYA 4K0KJ 2HFVA 5E3AA 4FYVB 3MR5A 1KVKA 3E01A 4ZHRB 3EZOA 3MCMA 2RQKA 3ITHA 3J81j 4A46A 3TZYA 1S0NA 3CULA 3KUEA 3M2VA 1RSCA 5KFYA 1Y0HA 3NMAA 3HSJA 1LEOA 2CNOB 2F65A 3D9BA 4PYDA 3MURP 1TUWA 3LQVA 3N9UC 4NMXA 3KLGB 1P1LA 2O66A 1NK7A 2BRLA 2KG0A 2ALZA 2CQ3A 5J1PA 1TKTA 1N32F 4USWA 1HI0P 1VLOA 5A8WB 2QYGA 3Q8RB 4C11A 1D8YA 2IDEA 2VPWB 3C14B 2V94A 4URQU 4HYKA 1YQHA 3BN7A 1HNVB 2QA2A 1UVMA 5KT5A 2DHXA 4A8SA 3UVJB 1VRTA 1RADB 2MSSA 2QJ3A 3GMGA 4KGZB 2VQFJ 2F3JA 2LQBA 1F2HA 2Z2ZA 5FD1A 1T05B 2VOOA 2EFQA 5FJ4A 1FHTA 3NY0A 4OYXA 1RAOA 4DCPB 4NPOA 5F8GA 3CE8A 1J5OB 4LT6A 4WE1B 3VAGA 4PZVA 1WD6A 5KFWA 1P9QC 1LXJA 4H4OA 4LSNB 4P2XA 5EX0A 1OPIA 2OP5A 4EK2A 2D69A 4EFAC 4QYRA 2ABYA 2JEIA 2WB1D 2IVFB 4C11B 2H1YA 1QAIA 1JJ4A 2VPZB 2LXFA 4CTAA 3M7VA 4Y2KA 1HQEB 3C3LA 2HFSA 2U1AA 5DG9A 2OTLS 1YG0A 2V8PA 2NXJA 4ES1A 2NR0A 1HBMB 2XQCA 2W8KA 1KSPA 2ZDPA 3HD2A 5HBMA 3SQGB 3PJ9A 3O2IA 2BANA 3ILOA 4L3KA 4AQYJ 2QMWA 5HVHA 3WX4A 1FWKA 1D8ZA 1EJ7L 2HZAA 3DKDA 2KM8B 1NJZA 1VI7A 1FRHA 1SB6A 2YQ1A 5C42B 3CD7A 4ECTA 4J5OA 3AQPA 4O4RA 4PQUB 2KZMA 1RTHA 1UVLA 3HM9A 3MECB 4RLEA 2KL8A 1EKRA 1VQKS 5KFSA 4B9LA 1HA1A 2BOPA 2W2NP 4IDKA 4C98A 2B3TB 2E1RA 2IRUA 2GGPA 3CJKA 5IXUA 5J2QA 5T7LB 3MM7A 1N88A 3CO9A 1X0PA 3QGGA 2CAJA 3AD9C 3PCOB 3M6XA 1QE1B 3GPAA 1X4FA 2JNJA 2HRTA 3E8OA 1DLOA 4NLVA 2XHCA 3UO0A 3J7ZT 3PKYA 2DIUA 1C4CA 1MU2B 5LM7E 3UNYA 2DPJA 4DG1A 1TELA 3DRXA 3K8WA 5CYQA 3EVWA 3TZXA 1NK6A 1PYSB 2YX1A 3CCMS 3PIOQ 4OZ2A 4NCGA 4RKUC 3MMBA 4J9LA 4RL1A 2KI2A 2CPEA 1XWLA 2P9EA 1S5ZA 3OSPA 3AA8A 2QE5A 3P5BP 4NEZA 3KLIA 3MMAB 3BKFA 3RZAA 2HNDB 2EKNA 4NI2B 2UU9J 4LIRA 4NYPA 3AJDA 4OI3A 4DUYJ 3A1YG 3O5TB 1TKDA 1HNWF 2Y8WA 3A13A 2HHTA 1URNA 1TL4A 4Y0FA 3OVSA 2MDAA 3QAUA 2MJUA 5SUHA 4I2PA 2R7OA 3FZ2A 3TVZA 3L9ZA 1JLQB 1YTYA 2XMJA 2YWEA 1C1CB 2IJFA 3B6BA 1WUUA 1U1PA 1XQIA 3IAM9 4FF2A 4DLGA 5U47A 4LSZB 2HRYA 4R8UB 2DR5A 1XEZA 1JXVA 4MIAA 2XM3A 3NLCA 3ZTSA 1FD8A 3OJSA 5GMDA 2VQEF 4AXIA 3M30A 2QFIA 3MTJA 1S9EB 2LEPA 1SL0A 1ZBTA 3F73A 3DLBA 4PG6A 4ZS6A 3NGUA 3W2VA 3CVKA 2FJXA 2NZ4A 1JB0C 1GX5A 2IC3B 3R9LA 5H9FJ 5CA5A 2CQBA 2UVRA 1JLAA 1E6YA 3LP0A 1NMEB 1U2CA 4NZ7A 1HNZJ 1OQ3A 2G1DA 2AEMA 5ETOA 2HHWA 1GK8A 3CJKB 2AEFA 2CUYA 2HNYA 1S6UA 1HW9A 3BS9A 4WKRA 1LWFA 3D1QA 3MECA 5AT1B 5K8OA 2VICA 3S01A 3OHBA 3GJTB 3CC4S 1X5TA 3R5BA 2IMWP 4NLQA 3MR6A 2I6WA 5KFCA 3PXGa 3W8PA 2VL1A 1LFWA 3MI7X 1TFWA 3BBCA 3MWBA 1FDBA 1VQSA 3AT1B 4OFZA 4RR5A 4Y2IA 4B3SJ 4DR4J 5F8JA 1NSAA 1ZPVA 3UD3P 5C25B 2GHWA 1K1SA 2V6AA 2AJQA 2HZCA 1Q16B 3G2XA 2F4FA 5D4OA 3P45B 3VQSA 2V67A 1RB0A 2J0XA 3BH6B 3CWJA 3MM9A 3BH7B 4RWXA 4USKA 1FVSA 1LXNA 3T5JA 2D7SA 1QAJA 1APSA 2A0FB 2JX2A 4YEAA 1VQOS 3KJVB 1Y5IB 2C2RA 1IBLF 2QIFA 4ECZA 2J0QD 4USUA 2DXFA 3MCNA 1NK0A 2UUAF 3MMCB 4EZ9A 2DY1A 3H42A 1JLEB 1RWWB 2MKSA 2RJZA 4NA3A 5ETSA 5K8MA 3K57A 3T1HJ 3ZNJ1 1QAYA 4GKJJ 3DI6A 4JI3F 4WE1A 1WELA 3KJQB 1FVQA 3M8RA 2FD2A 2BOAA 1IN0A 3N4WA 4L76A 4DX5A 1CPZA 1IBKJ 1U1RA 1FKPB 1CS4A 2DGWA 1TK5A 3NEKA 4HKQA 1PO6A 5LJ3Y 3FVYA 5C24A 3THVA 4YB6A 4CLWA 4ILRA 5GMEA 5HMZA 4NRTA 5HI7A 3C46A 3CMQA 4S0MA 2Q6BA 1U26A 4EBDA 1FO1A 2Z2LA 2RDJA 2MTLA 1HWKA 4WTOB 2MQNA 1WWHA 4GVBB 4ZCIA 2ASJA 2HHPA 3MCSA 4RNMA 2DNLA 4DF8A 4ZA1A 5B0EA 2DNGA 3AODA 2RT3A 2DK2A 3LGNA 3N01A 1FF2A 2JRSA 3N5FA 3F41A 4OX9J 3MEGB 4YUDA 1YZ7A 1RBLA 3CT9A 3G9CA 2FPHX 2OKQA 2ACMA 4DBQA 3BGRB 3H5XA 2ZM6F 2IPOB 3ZO7A 1TL3B 3KUHA 4PG4A 3D0GE 8ATCB 2O1PA 4F4YA 3TAMB 2W9CA 5J2MA 2AGOA 5RUBA 1TK8A 4C6AA 1VR6A 2CQHA 1Y3KA 3LP1B 3KDOA 1YJWS 1BQMB 2WVEA 4RPFA 4Y6IA 2LP4A 2MHEA 4E98A 4DPTA 4NCBA 1VFJA 3V6DB 2C3YA 4TKTA 7FDRA 3KOAA 1FA0A 4OHZA 2AP6A 3R3TA 3PG9A 2GIQA 2CZ4A 4DR2F 2E29A 4NMLA 3CJTA 3UDLA 4DV5J 4FYDA 3IWLA 3CIZA 3T5HA 3MM5A 2R7XA 5LSRA 3M1VB 3DYAA 3VHQA 2Z2YB 4ED6A 2YKNA 1FFWB 3G86A 4K2JA 4M5IA 4LF7J 4M94A 3FBEA 4NL5A 3M2RA 2EG1A 4TVAB 1N8RT 4B3SF 4GKJF 1KOHA 2LFVA 5DM7Q 2VOPA 2CPZA 4F0KA 2CQ2A 1S7IA 3L7UA 4DV6J 1JXLA 4Y3CA 4USMA 4X62J 3FCVA 5CCLA 1FXDA 2GHVC 3M4XA 3P5TL 4DL5A 2B43A 1KBRA 4GC6A 2AWZA 5AE3A 1IBLJ 1NH8A 5F9LA 1T94A 2G0CA 3OPKA 2B4VA 4Q2LA 2XLIA 2PEHA 4JV5J 2HHVA 1KTQA 1C0UA 3RJMB 3W9IA 4B9SA 2BKPA 1IJFB 3JQJA 1Z2ZA 1IKYA 1F60B 2X3DA 3DMJB 1N56A 2A18A 2GVDA 4CLUA 1VYAA 3UDEA 3UR0A 2OPPB 2BA9A 2HAIA 4P71A 4DMZA 1VBXA 3I55S 4DU8A 1Q7YT 5KFZA 1HARA 3US5A 4LF9J 2YKQA 4Z2XA 1VOMA 3ET6B 4RU2A 2W2QP 3RBDA 8AT1B 2VKZG 3IS9A 1NSKL 2IBOA 2ZZTA 4A8YA 2OH2A 5KT7A 3GYGA 2BZ2A 4NLOA 1N33J 1VC5A 2JLEA 3ETMA 2NXCA 2RF2A 4ZVHA 4A8OA 3DGPA 4DV7F 4CIOA 1BUXA 2ZWOA 3DRSB 9RUBA 1SC4B 1HWIA 2DY9A 2XZTB 1SJFA 3TA0A 3TJ8A 2UUCF 4CNYA 1C4AA 2R7WA 1RACB 1S1VA 5K8NA 2ZBQA 1HW8A 1ZZFA 2RS8A 1U6FA 3CGIA 3DLKA 4QW9A 3DRRA 1VCTA 1PSDA 1BQNA 1X4AA 4J9MA 2FDNA 2C2DA 3DGPB 2RRBA 1UL3A 1YITS 1RABB 2HBZB 3M05A 3N5BA 3G8SA 3DRPB 1B0PA 2DGUA 1JLAB 3AOAA 1SVDA 3ZZPA 1WC1A 4A8QA 2KHDA 4OHWA 4P74A 2J6UA 1R8BA 1SQGA 2DO0A 3QRPA 5KG4A 3G4SS 1M5SA 4L74A 2B9WA 4CM0A 1HWLA 3OUYB 1EB0A 1ELOA 3DXBA 4ECYA 2V50A 4B02A 2IVMA 4XAKA 1T3OA 2AT1B 1HBUB 2DGQA 4HL9A 5EHHA 1KEKA 4ALZA 4ES2A 1IWAA 2H4WB 1RYRA 2KH9A 5CYMA 3K8VA 4DR1F 2AQ4A 4LFBJ 1KDNA 2JWNA 2DCLA 2HS0A 2Y3YA 3C19A 3E3XA 4O4GA 1WC3A 2OFGX 2FVSA 3I56S 2XHWA 4R5PB 4OV1A 3GTYX 3OJUA 4B9NA 2CG8A 2PC6A 2MZTA 2JZ5A 3NS6A 1OS5A 1S99A 2W4PA 3RBEA 1G3OA 1QUVA 3ZTQA 1D9AA 2QL7B 4L3NA 2HG4A 2W1BA 5DG7A 3BQ0A 4QIEA 2HQ3A 1LWEB 4J91A 4PQAA 1C2PA 2E5LF 5L1JA 4PWDA 1Y5NB 1M5PC 3M8WA 4O3QA 2G2YA 2B7BB 2H54B 4ETZA 5LT5A 1CJTA 1EP4B 1GMVA 1UVKA 3K7RA 3IA0A 1KLMA 1WF0A 5F8HA 2J5AA 3EM1A 3M8YA 1BLUA 1NH7A 1N5YA 3L3CA 4F67A 1MU2A 2LDYA 2W2OP 1X9WA 2JVOA 4DV2J 4E8UA 1FRMA 2M8HA 1EAYC 1RXOB 2LCWA 2VFRA 3G6ES 3VALA 1AROP 5L1IA 3QIPB 1JWWA 2VKRA 4J37A 1HNIA 3CC2S 1L3SA 2MZJA 1KD1T 1C1BB 1NBEB 3KHRA 3IM8A 2QLWA 4HEA9 2IBKA 5THWA 2A6MA 3BYRA 1RTIB 4PXCA 2VF3A 3AJ1A 1RWXB 1N54B 4PG8A 5HJYA 5KAKA 4J9QA 1U47A 2UUBF 2FHJA 1YWXA 1TP7A 1WACA 2HBQB 2MMYA 3O44A 4KV8A 3QWPA 4Y2MA 2JDJA 3CCZA 3UR3C 3CJ2A 3W64A 3BGRA 3BQ2A 2VG7B 4X66F 2IFXA 2ZD1B 2OMOA 3MEGA 3CCQS 1TL7A 4ED1A 2V2KA 2FHMA 3LH2S 3EX7B 3K5MA 2EWHA 3IM9A 1MWZA 3JQMA 2KM8C 4RUCA 2UUAJ 4K4VA 5KG1A 5HROB 3MR2A 3VAHA 2BE2B 3I87A 2HFNA 3PW2A 4X64J 4CYUA 2LECA 4I4BA 3M2UB 2WB4A 4LRAA 3UN2A 3W65A 2Z30B 2XCPA 2ZFHA 4GVBA 1X9MA 3EGZA 2HIQA 3MM8B 1OQ6A 2ZEJA 4EU0A 5HN0A 3OHAA 5B0DA 3L4BC 5C7PA 4DR6J 1YJNS 1KQFB 3W7BA 4TU8A 1F9EB 4JV1A 3HPOA 2GV1A 1S6OA 2DXDA 1CJUB 3J7AN 4I68A 3JAMY 1Q8IA 2BJ1A 2RE1A 3M2UA 3N0VA 1VHIA 2D3O1 2AU0A 4PWWA 3N28A 1D09B 1K47A 2H65B 1RT2B 3IN5A 2HNZA 3IWXA 3NGTA 3D6TB 5KG5A 4DF4A 1B64A 1FRJA 3B54A 3MEEA 3X1LB 3H25A 1AB8A 5ADZA 1HMVA 1QVGR 4QYZK 5IC6B 1IQTA 5GAHU 1NJYA 2HQFA 3DLKB 4YB7A 4DV0F 2F8EX 4EO6A 4ZPVR 4USJC 3TVKA 1UWBB 5ETKA 2VFTA 2AD9A 2H5EA 3KLGA 4M5NA 2E1CA 2DNZA 2NREA 1N5TA 3KMSA 1FNOA 1XJWB 4K59A 4Y2CA 2KU7A 4HTJA 1FTCA 4NYOA 4IOBA 3G6XA 2AV5A 2ZH8A 1NEEA 2FHKA 5DZ6A 1NXIA 2BJ9A 3EGWB 4P7TA 3S7RA 1I94F 5C25A 2Y9HA 3IP0A 2GIRA 1SJ3P 3E01B 1VMBA 2CFXA 2ZVIA 3FSIA 2ZUAA 3PO5A 5CD4H 1FK9A 1LWXA 3NNHA 4WZMA 1HQ2A 1SBRA 2DKOB 4FP9A 4KRWA 3KTQA 2A2CA 1DURA 2CJYB 1SCJB 2KYZA 2VBWA 2V4RA 1MMLA 5KT6A 1UTAA 1FE4A 1PYTA 3KFWX 2IJNA 3CDEA 2J8SA 4ECRA 2V4QA 3GIIA 1DZ5A 1ZYQA 2M3DA 3R27A 4DL6A 3BR8A 4O3SA 1RHUB 1MN7A 4B9TA 2DGOA 1E6YB 3LP0B 1RTDB 3FRYA 1YZ6A 3L09A 4MFBB 1IJEB 2H9ZA 5L9XA 3T1AA 5A2QY 4DR5J 2YX4A 5IT9Y 3CEDA 4RW7B 4ZLPA 4O4GB 1VISA 5DDRC 4X84A 2ZH6A 4AL6A 4CLKA 3HJVA 3GCWP 4Y28C 2COLA 2GJ2A 1S1WB 1RZMA 1JK9B 1WSVA 2Q3PA 3K5PA 2OD4A 4KFBA 3W66A 5KFMA 1FKAF 3C6TB 3RG6A 2PI5A 1O8BA 4OHXA 3JS9A 3M1VA 1VS3A 3IGVA 3W1YC 4ZLNA 3HHNB 4ZK7M 4LBPA 1IKWB 1DAXA 1EETB 3PYFA 1FKOB 4NLPA 3OUYA 2R7SA 4HI1A 1BWEA 1JLQA 2N4CA 2D1CA 4QJVA 2YWKA 3MCOA 2HK2A 1YGYA 3CMES 1MG7A 1R8PA 1LKZA 3TA2A 4TXSA 3GFHA 5IM0B 4LF6F 4U7UD 2V34A 2ZVSA 1YRXA 3V6DA 1VIXA 2E1PA 3OFHA 4ZVRB 1VQLS 1HBOB 2LLZA 3GR1A 1VLYA 1WSRA 4DPYA 3PO4A 3BBBA 1G7CB
chains in the Genus database with same CATH topology
1SC6A 4XDCA 2YKAA 1DQAA 2XMVA 2HS4A 4ZVEA 2R8JA 3MD3A 4LFCF 2R2UA 4NA1A 4OQJA 2RF2B 3RRHA 1DLOB 2EFGA 4YR3A 3M6WA 3P6YC 4CNZA 3D2WA 3ZC4A 2ZH7A 2XY7A 2JEFA 4KPYA 3M9OB 2F8MA 4B3RF 5KG3A 3TNVA 2EK6A 4OLPA 4JBCA 2V4JB 2B7CB 3IWNC 3DOKA 3DDNA 2YH0A 5KFRA 4D3HA 4O3NA 3IRXB 1SL1A 3FEYB 3CDAA 5KT2A 1HPZB 3RB3A 4DLEA 2UVVA 3D28A 4HH0A 4IO9Q 4DQPA 2XZWA 3OXLA 2ZJPQ 1B7FA 2DR9A 5HBMB 4OZ5A 4TU7A 1U1OA 4N56A 1DARA 1KQSR 5A0YB 1VRUA 4M1KA 3I0SA 1VIOA 3F56A 3P3DA 1ZM3A 1U2FA 4YR2A 3CJ4A 2BR0A 1SV5A 4OX9F 5MAOA 2WBMA 4IRKA 4FN5A 5EUHA 1XMQF 3MM9B 3T6BA 2E9TA 2XULA 3OVBA 4LVNP 4ERDA 3MM5B 2G4BA 1G2EA 5D4LA 5A6PA 1R31A 4QPTA 2CG4A 1K9MT 1D3WA 4WYLA 1ZAVA 3TAQA 5HMXA 4W92B 2WCXA 3OVAA 2M70A 1GX6A 3IR6B 1VRTB 3RYLA 4J9KA 3GQCA 5HL7Q 1OIAA 2CJQA 1WHVA 2ZOGA 4DX8H 2KYXA 3FEZA 3MEDA 1MROA 4FZVA 1BQMA 1X4HA 2P5VA 2Q66A 2HGNA 3DLEB 2K7KA 5K5MA 4N76A 2PGCA 3JB9k 2B5JA 3WBZA 1IKXA 5E41A 4YB5A 5DS7A 1SI9A 4ED7A 1AUDA 3VCDA 4DV6F 2YWFA 3MPVA 2X1FA 2VA2A 3HJFA 1MWYA 1IKVA 2FLNA 3SCIE 2MKJA 4WJBA 2AGQA 2I5JA 4I0WA 4N41A 1ZOTA 3CD0A 4MH8A 4C3MA 3AQOA 4ZPTR 4N77A 2ASYA 1DQ8A 3DLEA 4HHJA 4LSLB 4IFVB 4P6QA 3I0RA 2QLXA 3MZIA 1D1UA 2EFPA 3O6QA 4C8ZA 3E2EA 3N6LA 4IR1A 3C66A 5BYRA 5HROA 3HXMA 2OAUA 4LFBF 4DR7F 4IH7A 3U27A 2VC0A 2RD5C 3NG8A 4PXDA 1S76D 3SFUA 4EYHB 4O44B 3GYXB 2HLTA 4NXNF 4EUVA 2RQCA 3V4IB 4DSFA 3D0HE 1RT1B 2DH7A 2V5HG 3NWGA 4U67Q 3SSQA 4RW6B 3G71S 1JKHA 1Z4UA 4I67A 3NCQA 3DM2B 5E33A 3TO8A 4F26A 1F5BA 2AJFE 4FF1A 5G0RA 1LOUA 1KFSA 3KK1B 1T3NA 4MFBA 2JHEA 5KFJA 3NBPB 5IT0A 4BWJA 3JYTB 4LIWA 5G4DA 1XNQF 5J2QB 3VR1A 1N36F 2DGXA 1H0HB 2DNPA 4IG3B 2HLUA 2C3UA 5I3UB 5DGAA 1U1KA 2DITA 3SSRA 1PILA 1BD6A 1JLGA 4KKOB 3UD4P 5JXSA 4AL7A 4KQZA 4KE5A 5L1LA 1U1MA 5I3QA 3I5AA 3JYTA 2L3MA 4DSLA 3CJ5A 2XSFA 2EKYA 3M8QB 3NNCA 1T7PA 3PY8A 2HHUA 3EYZA 3MD1A 1VQNS 2GJIA 2L9WA 2VODA 2LXIA 1H2TZ 4CTAB 2EFVA 1ZZNA 1NJIT 2O3DA 3VZHA 1ULRA 3UCUP 1ZH5A 2W7OA 2XWYA 3K59A 4MK9A 2MGZB 1PC5A 2FB0A 2GMLA 5DDQC 2BQ3A 2ILYA 3T1YF 3BO2A 4OHYA 2M88A 2ZC4A 2MZSA 4OMFG 1C1CA 3CMAS 3DHWC 3KKFA 4WFAQ 3JSMB 4I2PB 2I8EA 2J6TA 1DTQB 4LQ3A 4FXWA 3KK3A 3VQTA 1L3UA 2LEAA 2OSRA 3HHLB 3DRRB 3NKYA 2RKIA 2GCFA 4I7FA 4X4SA 2MGZA 2OMLA 1ZTTA 1OSDA 1W2IA 2KRBA 2HNDA 2MZQA 2QA1A 5DETA 2ZJQQ 3N6NA 1N4LA 2N7YA 2PMZD 4F2RA 2D74B 1P6TA 1QVFR 2LQ9A 1TKTB 3CCWA 3SCLE 3KYLA 2K3IA 4WCEQ 5GAHI 5LMNF 3Q8PB 4KIAA 1LW2A 4X4UA 3M8QA 1G6BA 4P2SA 3PW0A 5CH7B 2ZH5A 4PPZA 4CO4A 2E9RX 2AX0A 2JL9A 3BZQA 1RKJA 2YKPA 3K5NA 2DGSA 4ZDNA 2FJWA 1JJ2R 2D9OA 2APOA 4X64F 1MSWD 4K4WA 2HVIA 1PC4A 5EWFA 3KHHA 4PQUA 1RDRA 4I69A 2L48A 5DRKA 1MW7A 2KZZA 4Q45A 5EN1A 3MOZA 2IA0A 1HL6A 1WF1A 2XI3A 5JJBA 3OLBA 2J7UA 4RZRA 5E3RA 2W8KA 3Q24A 4IFYA 4NLTA 1CVJA 3ULHA 2MY8A 1NK9A 2M4MA 4M63A 2CPDA 2BQUA 3PZPA 3KK2B 4Z37A 1UWBA 3LP2B 4DSJA 5KFPA 1RT1A 1FJCA 3OR2B 3BSCA 3QMQA 5K8PA 4RBTA 4LSNA 1NHVA 4O44A 1FDAA 4ZP9A 2ZKTA 1N0UA 4I64A 3WDOA 3FNNA 1VK8A 2CVEA 3BDPA 2VBXA 5CXTA 4B17A 5L8RC 2DNNA 2YKOA 1S4FA 3B4MA 4EYIB 2J8AA 1U1LA 3PDNA 3K58A 4DFKA 4LF7F 3RR8A 2VZ9A 3PKMA 2IA6A 4G1PA 2RNEA 3Q2SC 4C0HA 4NLSA 2M7SA 2MXYA 3QGPA 3IG1B 3EZUA 4YY3F 3FMWA 4IKAA 2VQFF 1R43A 4MTPA 2LA6A 5D3GB 3GILA 3G96A 3RR7A 5GMKa 2DO4A 2D3ZA 3AB4B 5EWGA 4ECXA 3ITHB 4RW8B 4OI4A 3BEGB 3RW7A 3ICLA 4UW2A 2HWHA 4MYUA 1WHWA 4KHMA 1SKRA 4IG0B 3MUMP 2X3GA 1S48A 2XEXA 3TANA 2POKA 4F2SA 4DR4F 3Q8QB 2B0GA 1JLFA 3MDFA 3WZ0A 2YTCA 4AXJA 4W90B 1RTIA 1HWUA 2LU2A 4XPCA 1GT8A 3SMZA 1U09A 3HO1A 5E3QA 3I4PA 4DN9A 1U4BA 4IH5A 3BJYA 3BDEA 3I82A 3PRDA 3PACA 2C42A 5GVQA 4DFMA 1NKBA 1I1GA 2LXUA 3OL7A 1M90T 4A47A 2MPUA 4FPRA 1F5AA 3H2LA 4LVOP 5F8LA 1L3TA 2D3UA 3ZZOA 2KO1A 4LFAF 3L95X 3LALA 1WG4A 4PRFA 4FF4A 2CPHA 2XSJA 4KT0C 4YP3A 2CQCA 3IR5B 3TR5A 1N5SA 3LGMA 1VRUB 4K4YA 3PW4A 2DNHA 1RT7A 3I5CA 4A8KA 1H7WA 5GAGU 2VASA 4O0IA 1X4BA 3FFIA 2M8DB 3LWMA 4I56A 2JEJA 4OZLA 3JTOA 2QT7A 5KG0A 4DHVA 2O5DA 3HHLD 2FGOA 4DEZA 4B3TF 3BSNA 4Y00A 2M9KA 2BJEA 2JC1A 3DOKB 3ISND 2E9ZA 3L7PA 2VONA 4CH0S 4I2QB 1KS2A 3VAJA 2EBGA 2XSJB 2ATLA 2QSWA 5HQ8A 1HBUA 4OHVA 4PXEA 4ED0A 3QGHA 2RU9A 2KXFA 3SZ2A 4Q8FA 3T9ZA 1WG5A 1U6BA 2QEXS 4PXBA 3N6MA 1R8CA 2B51A 2RSQA 4ZPWR 1ZPWX 2R8IA 3M6UA 3M9MB 1LW2B 1XNRF 3M30B 1DJ0A 4DFPA 4JOUA 2VPXB 1JLFB 5K9FA 3LAMA 3KMQA 3DRSA 4C9DA 4A48A 4DR6F 4LMZA 1DTTA 3HMJG 3HHLA 4ELTA 1QJHA 3JTNA 2ZH9A 2M52A 3MEEB 3P96A 1SH3A 2HNZB 3P49B 3SDEA 3V5RA 5KFOA 1EETA 2LKZA 4NLWA 4UQGA 2B9XA 4L6V3 4PR6A 6FD1A 4RU9A 2J0SD 1KN6A 2IM2A 1WHXA 1PGZA 2DR8A 4NLGA 1UFLA 1YJRA 3IO1A 3POTA 4ZVFA 5DQHA 3T5LA 1IKVB 2DHAA 4F3QA 1VBZA 2VFSA 2OSQA 4NLUA 2Y1JA 1K73T 4BS2A 4FS1A 1IKXB 2BACA 4AFFA 1M1KT 3H5SA 1SJRA 4TLQA 5H9EJ 2Q6CA 4IDKB 4TYBA 4WK1A 4QZVB 1SKSA 3GZ7A 4DL7A 2OPQA 3DXSX 2B4UA 3R1HA 4X62F 5KFXA 2A2DA 2WONA 4OJ1A 2HQIA 1C1BA 4QWEA 4CI0B 4RW9B 3UQSA 2DR7A 4H4MA 4KO0B 4OX8A 2BANB 2MQMA 1K0TA 2JVRA 4DV4F 4O23A 2V8DA 2WONB 4RNHA 1M0SA 1NNDA 5G0RB 4FF3A 1KLMB 4DV5F 4F50A 2F9DA 2JH3A 1NKEA 2ZBCA 4I6YA 1BQXA 3V81A 3LPYA 3MGJA 4RW6A 3W2WA 5F0WA 4TQRA 1P8GA 2HMIB 2IAJB 1OPZA 1A9NB 3MPWA 1U45A 5AXNA 1IBMF 1TKXB 3K2YA 2X1AA 5CZXA 3SCKE 4RUAA 2E5GA 2IM3A 2V8HA 1TL1B 4ZP6A 1U8SA 4BHQA 2K7JA 4OJHA 5T41A 4TY9A 4JV2A 3BGUA 3GV7B 1NZAA 2RB7A 4ZP7A 1NB7A 4LSLA 3PW7A 4ED2A 2GA7A 4RW4B 5F8IA 4OI0A 3MAHA 2I1RA 3H59A 1X9SA 2UUWA 1FCAA 3HKWA 2RKIB 2UZAA 3BN4A 2HPUA 4I7FB 1J2VA 5D78A 4F02A 1FE0A 2XWXA 2HRUA 2R8GA 4ZHRA 4MMOA 4DFJA 3J7YU 3DRPA 3WC2A 2XNQA 5CHCB 2KT2A 2IYIA 2Q43A 2DGTA 2BVZA 2NUHA 2WW8A 3ZZYA 4CO3A 2MY7A 2Q1LA 3PX0A 1U7LA 3I31A 4WFXA 3SI8A 3J7YI 4LUBA 5IWAF 3MEDB 1FERA 2VG6A 4HI2A 2CJ9A 3NRBA 4CT8A 3H40A 2ZZNA 3GFZA 2C3OA 4UQTA 4QPXA 2R2TA 4ELUA 4O3PA 3CCJS 3QWUA 1QE1A 5FIIA 2DBBA 4GMKA 4KO0A 4U9RA 4ZVGA 3IS9B 3SXLA 3MM7B 2HWIA 4PCQA 4KB7A 5M2RA 3R5AA 1YJTA 4B9UA 1RWUA 3J80Y 5FDLB 1Q79A 2VUGA 2RU3A 4Q44A 1RT6B 1LWEA 1KVIA 5K14B 5KT3A 2ROEA 2HNYB 4YDDB 1N52B 4WFNQ 3LF0A 4NLXA 3UPFA 1WF2A 3VAFA 5HP1A 1RTDA 3CD6S 5IQQA 3NAHA 4R5PA 2XO7A 3KK1A 3GSDA 2B6AA 1HBMA 4Y34A 2JLFA 2W24A 5AXMA 2ZBIA 3M9NB 1G1XA 1SIZA 1DHMA 2AJ1A 2IMOA 1Y00A 2VV5A 3JSRA 4F4ZA 2V4JA 3OR1B 4WFYA 1F9FA 4H4KA 2NXUA 1H98A 3SCJE 1IUJA 1RT3A 5C5JA 4CO1A 2XNRA 4C97A 2CPXA 4ED5A 2VBYA 1XR6A 3OLAA 3PJWA 5F3TA 2OD6A 4DL0C 1UMJA 3HHKA 1NK8A 3LOUA 3RAQA 2N3OA 1KVJA 2A3JA 4X4OA 1VBYA 2R4FA 1D9FA 5DQGA 5KFKA 1R3NA 5AXKA 3BB5A 3MAQA 4WZQA 2WK4A 2WAQD 1R8HA 2AW0A 4ZPAA 5IM0A 4N47A 1LFPA 1ZM4A 3M2VB 1RT2A 1O0PA 3PM9A 3UWTA 1XR5A 2OLWA 1WI8A 1UA0A 2D9PA 5E5NA 2MHNA 2ERRA 4A8FA 2HHXA 4BC7A 2GGPB 3RTVA 1NO8A 3C6TA 2ZKUA 4OZJA 2AGPA 1S7HA 1UETA 3EXYA 2FVPA 1C0UB 1MROB 1UAWA 1NK5A 2K2PA 3OL9A 2IVYA 2B4PA 1TL1A 2ZNYA 1JX4A 2W4DA 2ZE2A 5J1EA 1M5VC 4QOTA 4HDGA 4ZCKA 3S1TA 1SL2A 1LWCA 1S6PA 3NS5A 6FDRA 4U7CA 1HHTP 1KQGB 2WSFC 3TYTA 4JV0A 1R6YA 1WTBA 3CIMA 2HMIA 1FXRA 3FEXB 3X3UA 3W2WB 3KK2A 2UUTA 3V81B 4C8OA 5KFUA 4NLRA 3THPA 1KONA 5DDOC 2DRAA 4LJMA 3KJVA 2EC0A 2O67A 4KGMA 2DHGA 1NHUA 5A8KB 3VAKA 1FK9B 3PRBA 3QIPA 4UUWA 1KRPA 5MLCV 5A0YA 2E5IA 4LQ9A 2W25A 2HHSA 4DN0A 1VQ4S 1RT5B 1WNEA 2ZH1A 2JLGA 2DNMA 2E1AA 4HLBA 5KFEA 1VQ5S 1Z1ZA 1RJJA 4GO5X 5E7OB 4YQWA 3KG4A 2WOMA 5LMUF 2K8GA 1HNVA 1SJQA 3LP1A 5I3PA 4BWMA 2FJBB 3N79A 3TAMA 2IRXA 2XLJA 3G8TA 2OPQB 3KNAA 2RRNA 2C3PA 3QAEA 3U02A 4USHA 1HWJA 3CPWR 2L08A 3UE2A 2J9DE 1B0TA 2BM1A 2CPYA 3MUTP 2OIHA 3CSKA 2VFVA 1J5EF 1TQLA 3BF4A 1XMOF 3I9V9 2DNRA 3PR5B 5D3GA 2XGPA 1RT3B 4Q0BA 2W9BB 1NJXA 3I4HX 1RP5A 3DC2A 2MZRA 3GE9A 4KJIA 1OSCA 3MXHP 2GW8A 4EBCA 1RQ0A 1SUQA 1T02A 2NYIA 1C0TB 4Q43A 1AXQA 1UP1A 4WYWA 5B0CA 2M5YA 4G1IA 3MFIA 1R27B 2WSEC 1NKCA 1BC6A 4I6WA 1HBOA 5LJ5Y 2I38A 2B6AB 5HO4A 4DQRA 2ROGA 3MF5A 3SDEB 1QAXA 1S1UA 3ZFVA 2HWTA 2FVRA 1E6VA 1QSYA 2XMTA 4DSEA 2GX8A 3V6KA 3I6PA 3DI6B 4WTYA 3KLEA 4F4XA 4OI1A 4KHPF 1IKWA 2XMWA 1R8AA 5LSLA 2C22A 5K14A 2JSXA 1N48A 4X4QA 3KLHB 4PWUA 3H98A 4QU7A 2JC0A 3I32A 3CDBA 2AYGA 2DRBA 2K3KA 4RW7A 4RNFA 2VFUA 4IFYB 4QIFA 4D3GA 2F8HA 2ZZMA 4ICLB 2P9GA 1AFIA 2GO9A 1OO0B 3VTIA