1HR0I

Crystal structure of initiation factor if1 bound to the 30s ribosomal subunit
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
127
structure length
127
Chain Sequence
b'EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGRFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Crystal structure of an initiation factor bound to the 30S ribosomal subunit.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ribosome
total genus 31
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2000-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1hr0I00
1N33E 3OTOI 4NXNI 3OTOE 4NXNE 4NXMI 1H74A 4NXME 4PRXA 4HY1A 4DV1I 2CZ9A 2ZBKB 4DV1E 4R1FA 3QT7A 4JI6I 3J81C 2UU9I 1XNRI 2UU9E 1XNRE 3K17A 2DEJA 3B78A 4DV6I 4DPUA 1A6FA 4DV6E 4LF6I 4DV7I 4LF6E 2HK3A 1KKHA 4DV7E 4DU8A 4FWGA 4HYMA 4PRVA 4DV2I 4JYAI 4XTJA 4DV2E 2X7IA 4LF9I 4JYAE 3K1JA 1FKAE 4LF9E 4URLA 2R42A 2UUBI 1J5EE 4GKJI 2UUBE 4GKJE 4WUBA 1PVGA 1XMOE 1H7UA 3GONA 4YY3I 1XHKA 3H4LA 4MYTA 4B3MI 1FI4A 4HXZA 4YY3E 4DU7A 4JI5I 1D6TA 3J7AM 2HK2A 1KIJA 4JI5E 4B3RI 5LMUI 4B3RE 5LMUE 2V2VA 3JAMC 4DV0I 3JAMQ 4DPTA 4DV0E 1EI1A 1IBLI 4GKKI 2UUCI 2NPFA 1IBLE 4GKKE 1PIEA 2UUCE 2WW4A 3V2UC 1ZM9A 2AJ4A 1ZM4A 1HNXI 1B63A 3CWVA 1FWLA 1HNXE 3T1HI 1Z5BA 3T1HE 4DUZI 4LF4I 1I94I 1EA6A 4DUZE 4LF4E 1ZXMA 4JV5I 1I94E 1MX0A 4FW9A 4JV5E 1MG7A 4JI2I 4JI7I 4DR7I 5LL6R 4JI7E 4JI2E 5FLXQ 1Z0GA 2HFUA 3PYFA 4X64I 1N0VC 2ZITA 4X64E 5IT9C 4X66I 5IT9Q 4X66E 5GMDA 1HNZI 4USMA 1HNZE 3J81Q 1ELOA 2BM1A 3LTOA 4B3SI 4B3TI 1Z5AA 4B3SE 1BKNA 4B3TE 4FN5A 1OJ4A 4ZVIA 2E1RA 1Z0VA 2V2QA 4KQVA 4JI8I 4LFAI 4LFAE 4JI8E 4DXLA 4DPYA 1HR0I 1H7SA 2OI2A 1J5EI 2HHHI 1HR0E 4LF8I 4DR5E 2HKEA 4PU9A 2HHHE 4I3HA 4UT4A 4LF8E 4FWHA 3T1YI 3LNUA 1XMOI 1Z0EA 3J80C 3T1YE 2XEXA 2ZM6I 1RR9A 2ZM6E 4X65I 4USKA 3QT8A 4X65E 2UUAI 1U2RA 2VQEI 1KTVA 4LFCI 2UUAE 2VQEE 4DR3I 4LFCE 4JG4A 4DR3E 1NHHA 4LF7I 2LJPA 3V5RA 4HACA 4DV4E 4JI3I 3HULA 4DPXA 4LF7E 2A2DA 3PYEA 4JI3E 1Z0CA 3QT5A 1ZM3A 3QT6A 1N0UA 5IWAI 4WUDA 2HFSA 3ZKBA 5IWAE 1VISA 2E5LI 5L3JA 2E5LE 5A2QC 5A2QQ 4MYUA 1NHIA 5GMEA 3WU6A 2R3VA 4AQYI 4YHHI 4AQYE 4YHHE 4EMDA 1ZXNA 3F0NA 4JI0I 1MU5A 1N32I 4JI0E 1XNQI 3ZZ0A 1N32E 2F4VI 4LFBI 1XNQE 2J7KA 4DV3I 2F4VE 4LFBE 1Z0WA 2EFGA 3ZM7A 4DV3E 1IBKI 1K47A 1IBKE 4DUYI 4JI4I 1FNMA 1S16A 2V2ZA 2VQFI 4DUYE 4JI4E 4P52A 1IBMI 2VQFE 1IBME 1Z59A 4RPFA 2Q2EB 3D4JA 4JI6E 2A2CA 3ZZTA 2HKJA 3PYGA 5LMNI 4OX9I 4DR5I 3Q1QA 1Z5CA 5LMNE 4DR6I 4OX9E 1FJGI 4DR6E 1FJGE 1N36I 3M6AA 5BR8I 4DR2I 4DR1I 1N36E 4DR4I 3J80Q 5BR8E 4DR2E 3PYDA 4DR1E 4DR4E 1H73A 2VF3A 1XMQI 1B62A 2UXBI 4DPWA 1XMQE 3J7AG 2UXBE 4KHPI 4K0KI 2BM0A 4KHPE 1QZRA 2GS8A 4K0KE 4FWDA 4P7AA 2UXDI 4DV4I 1S4EA 3B8HA 2UXDE 1PKPA 4B3ME 3B82A 4HACB 1N34I 1RREA 1H72C 2DEIA 1N34E 1KVKA 1WUUA 4X62I 1NZ0A 4WUCA 4M1KA 4X62E 3WU5A 3WU3A 2X36A 4UTGA 4LF5I 3ZZUA 1FWKA 2BV3A 1Z0BA 4LF5E 4Z7CA 4DV5I 4ED4A 2V34A 4DV5E 3LPSA 2UXCI 2UXCE 1DARA 1ZM2A 1HNWI 4JI1I 4Z7YA 1HNWE 3WU4A 1Z0TA 4JI1E 2V8PA 1NHJA 1UEKA 5FLXC 4DR7E 1N33I 3ZKDA
chains in the Genus database with same CATH superfamily
1N33E 5C0XD 2O3ZA 4NXNI 3OTOI 3OTOE 4NXNE 4NXMI 1H74A 5K36F 1Y4UA 1YHCA 4NXME 4FW5A 4PRXA 4HY1A 4DV1I 2CZ9A 2ZBKB 2Z5BA 4DV1E 2NN6E 4U3BA 4R1FA 3QT7A 4JI6I 1OYRA 5C0XB 3J81C 2UU9I 1XNRI 5EL9A 2UU9E 1XNRE 1YH8A 2NN6A 2BR2B 3K17A 2PNZA 2DEJA 3B78A 4DV6I 2PO0A 4DPUA 2PNZB 1A6FA 4DV6E 2Z5CA 4LF6I 4MU1A 4DV7I 4LF6E 2HK3A 1KKHA 2C39A 2Z5CB 3P3CA 4DV7E 4DU8A 4FWGA 4HYMA 2C39B 4PRVA 4DV2I 1OYPA 2C37A 4JYAI 4XTJA 4DV2E 2X7IA 5DRRA 4LF9I 4JYAE 3K1JA 1FKAE 2PO1B 4FW4A 5C0XF 4J3DA 4URLA 4LF9E 2R42A 4IFDD 2UUBI 5DNLA 2JE6B 1J5EE 4GKJI 2UUBE 2BA0D 4GKJE 5JEAD 4WUBA 1PVGA 1XMOE 4IZKB 1H7UA 3GONA 4YY3I 1XHKA 3HKMA 3H4LA 4MYTA 4B3MI 1FI4A 3U1KA 4HXZA 4LCHA 4YY3E 4GQUA 4DU7A 4JI5I 1D6TA 3PS2A 3J7AM 2HK2A 1KIJA 4JI5E 4B3RI 5LMUI 4N3OA 4LCFA 2BA1G 4B3RE 5LMUE 2CVEA 2V2VA 3JAMC 5ELWA 4DV0I 3JAMQ 4NBQA 3M85G 4DPTA 2GQ0A 4DV0E 1EI1A 2IOPA 1IBLI 2IERA 4GKKI 2UUCI 2NPFA 1IBLE 3GCMA 1PIEA 4GKKE 2UUCE 4OO1D 2WW4A 3M7ND 2CG9A 1P42A 5DRQA 3V2UC 2PO2B 1ZM9A 2AJ4A 1ZM4A 3DD6A 4AM3A 1HNXI 4IFDC 1B63A 2AE8A 3CWVA 1FWLA 1HNXE 5K36E 3K85A 3T1HI 1Z5BA 3T1HE 4DUZI 4LF4I 3P76A 1I94I 1EA6A 4FW3A 4DUZE 5K36A 4LF4E 1ZXMA 3B4TA 4JV5I 1I94E 4BA1A 1MX0A 4FW9A 4JV5E 5JEAF 1MG7A 3L7ZA 4JI2I 3P3EA 4JI7I 4DR7I 5LL6R 4JI7E 4JI2E 2C38A 1R6LA 5FLXQ 1Z0GA 5K36C 1Y6ZA 2HFUA 3PYFA 4X64I 1N0VC 2J65A 2O1VA 2ZITA 4U3DA 4X64E 3NZKA 4X66I 5IT9C 5IT9Q 3U1YA 4X66E 5GMDA 1HNZI 4FW6A 4USMA 1HNZE 4OO1F 2Z5BB 3J81Q 1ELOA 2BM1A 1UDSA 4FW7A 3LTOA 4IS9A 4B3SI 2NN6B 4B3TI 1Z5AA 5FWKA 1BKNA 4B3SE 4B3TE 4FN5A 4OKGA 2PO0B 5DNXA 1OJ4A 4AIDA 4ZVIA 2E1RA 1Z0VA 2JEBA 2PNMA 2V2QA 3Q6MA 4KQVA 4JI8I 4LFAI 4LFAE 4JI8E 4DXLA 2IESA 5C0XC 4DPYA 3PS3A 2GO4A 2C37B 1HR0I 1H7SA 2OI2A 1J5EI 2HHHI 1HR0E 4LF8I 4DR5E 4OZEA 2HKEA 4PU9A 2HHHE 4I3HA 4UT4A 4LF8E 4FWHA 3T1YI 3LNUA 1XMOI 2NN6F 1Z0EA 3J80C 3T1YE 2XEXA 2ZM6I 1RR9A 2ZM6E 2WNRA 4X65I 4USKA 3QT8A 4X65E 2WNRB 2UUAI 1U2RA 2CGEA 2VQEI 1KTVA 4LFCI 4IFDE 2UUAE 2VQEE 4DR3I 4AIMA 4JG4A 4LFCE 4DR3E 1NHHA 5JEAE 4IFDA 3KRNA 4LF7I 2LJPA 3V5RA 4HACA 4DV4E 4JI3I 3HULA 2VESA 4DPXA 2A2DA 4LF7E 3PYEA 4JI3E 5JEAA 1Z0CA 3QT5A 1HK7A 1ZM3A 4ISAA 3QT6A 1N0UA 5IWAI 4WUDA 2HFSA 3ZKBA 5IWAE 2O1WA 5JEAC 4BA2A 1VISA 2E5LI 5L3JA 2E5LE 4OO1E 5A2QC 1Y60A 5A2QQ 4LPFA 5K36B 4MYUA 2O1UA 4IZJA 3PRYA 1NHIA 3PS1A 5GMEA 4BA1B 3WU6A 1USVA 2R3VA 4OO1A 3L7ZB 2BA1D 2JEAA 4AQYI 4YHHI 2C38B 3P3GA 4AQYE 4EMDA 4YHHE 3M85D 1ZXNA 2WP8A 1E3PA 3F0NA 4JI0I 1MU5A 5EKWA 1N32I 4JI0E 4OO1C 1XNQI 3P06A 2NN6D 3ZZ0A 1N32E 2F4VI 4LFBI 1XNQE 2J7KA 4DV3I 2F4VE 4LFBE 4LOMA 1Z0WA 2EFGA 3ZM7A 4DV3E 4QNKA 1IBKI 1K47A 1IBKE 4DUYI 4JI4I 1FNMA 5C0XE 1S16A 2V2ZA 2VQFI 4DUYE 4JI4E 4P52A 1IBMI 2VQFE 2IOQA 1IBME 1Z59A 1UDQA 4RPFA 5C0XA 2Q2EB 2BA0G 3HJCA 3D4JA 4JI6E 2A2CA 2BR2A 2O1TA 1XXEA 5DROA 3ZZTA 1E3HA 2JEBB 2HKJA 4QNJA 2PNLA 3PYGA 5LMNI 3Q6NA 4OX9I 4DR5I 3Q1QA 1Z5CA 2JT2A 5LMNE 1UDNA 4MDTA 2NN6C 4OX9E 4DR6I 1FJGI 4DR6E 1FJGE 1N36I 4MU3A 1RHYA 3M6AA 5BR8I 4DR2I 4DR1I 1N36E 4DR4I 3J80Q 5BR8E 3H1CA 3PYDA 4DR2E 4DR1E 3M7NG 4MQYA 5DRPA 4DR4E 2PO1A 1H73A 2VF3A 1XMQI 1B62A 2UXBI 2Z5EA 4DPWA 2JE6A 1XMQE 3J7AG 2UXBE 3GLLA 4KHPI 4K0KI 2BM0A 4KHPE 1QZRA 2GS8A 4K0KE 4FWDA 4P7AA 4IZKA 1VI7A 2UXDI 4DV4I 1S4EA 3B8HA 2UXDE 1PKPA 4IFDB 3UHMA 2GO3A 4B3ME 3B82A 1R6MA 4HACB 1N34I 1RREA 1H72C 2DEIA 1N34E 1KVKA 5JEAB 1WUUA 4X62I 5K36D 1NZ0A 4WUCA 4M1KA 4X62E 3WU5A 3CDJA 4IZJD 3WU3A 4MU4A 2X36A 4UTGA 1USUA 4LF5I 3ZZUA 1Y5YA 1FWKA 2PO2A 2BV3A 1Z0BA 4LF5E 4Z7CA 3GMEA 4DV5I 4BA2B 4ED4A 2V34A 4DV5E 3LPSA 2UXCI 4IZJB 2UXCE 1UDOA 1DARA 4MU0A 1ZM2A 2F1DA 4OO1B 1HNWI 4IFDF 2JEAB 4JI1I 1Y4SA 4Z7YA 1HNWE 3WU4A 1Z0TA 4JI1E 2V8PA 4LCGA 2WP8B 1NHJA 1UEKA 1OYSA 5FLXC 4DR7E 1N33I 3CDIA 3ZKDA
chains in the Genus database with same CATH topology
1N33E 3OTOI 4NXNI 3OTOE 4NXNE 4NXMI 1H74A 1Y4UA 4NXME 4PRXA 4HY1A 4DV1I 2CZ9A 2ZBKB 2Z5BA 4DV1E 4R1FA 3QT7A 4JI6I 3J81C 2UU9I 1XNRI 2UU9E 1XNRE 3K17A 2DEJA 3B78A 4DV6I 4DPUA 1A6FA 4DV6E 2Z5CA 4LF6I 4DV7I 4LF6E 2HK3A 1KKHA 2Z5CB 4DV7E 4DU8A 4FWGA 4HYMA 4PRVA 4DV2I 4JYAI 4XTJA 4DV2E 2X7IA 4LF9I 4JYAE 3K1JA 1FKAE 4LF9E 4URLA 2R42A 2UUBI 1J5EE 4GKJI 2UUBE 4GKJE 4WUBA 1PVGA 1XMOE 4IZKB 1H7UA 3GONA 4YY3I 1XHKA 3H4LA 4MYTA 4B3MI 1FI4A 4HXZA 4YY3E 4DU7A 4JI5I 1D6TA 3J7AM 2HK2A 1KIJA 4JI5E 4B3RI 5LMUI 4N3OA 4B3RE 5LMUE 2V2VA 3JAMC 4DV0I 3JAMQ 4DPTA 2GQ0A 4DV0E 1EI1A 2IOPA 1IBLI 4GKKI 2UUCI 2NPFA 1IBLE 4GKKE 1PIEA 2UUCE 2WW4A 2CG9A 3V2UC 1ZM9A 2AJ4A 1ZM4A 1HNXI 1B63A 3CWVA 1FWLA 1HNXE 3K85A 3T1HI 1Z5BA 3T1HE 4DUZI 4LF4I 1I94I 1EA6A 4DUZE 4LF4E 1ZXMA 4JV5I 1I94E 1MX0A 4FW9A 4JV5E 1MG7A 4JI2I 4JI7I 4DR7I 5LL6R 4JI7E 4JI2E 5FLXQ 1Z0GA 1Y6ZA 2HFUA 3PYFA 4X64I 1N0VC 2O1VA 2ZITA 4X64E 5IT9C 4X66I 5IT9Q 4X66E 5GMDA 1HNZI 4USMA 1HNZE 2Z5BB 3J81Q 1ELOA 2BM1A 3LTOA 4B3SI 4B3TI 1Z5AA 5FWKA 1BKNA 4B3SE 4B3TE 4FN5A 1OJ4A 4ZVIA 2E1RA 1Z0VA 2PNMA 2V2QA 3Q6MA 4KQVA 4JI8I 4LFAI 4LFAE 4JI8E 4DXLA 4DPYA 1HR0I 1H7SA 2OI2A 1J5EI 2HHHI 1HR0E 4LF8I 4DR5E 2HKEA 4PU9A 2HHHE 4I3HA 4UT4A 4LF8E 4FWHA 3T1YI 3LNUA 1XMOI 1Z0EA 3J80C 3T1YE 2XEXA 2ZM6I 1RR9A 2ZM6E 4X65I 4USKA 3QT8A 4X65E 2UUAI 1U2RA 2CGEA 2VQEI 1KTVA 4LFCI 2UUAE 2VQEE 4DR3I 4LFCE 4JG4A 4DR3E 1NHHA 4LF7I 2LJPA 3V5RA 4HACA 4DV4E 4JI3I 3HULA 4DPXA 4LF7E 2A2DA 3PYEA 4JI3E 1Z0CA 3QT5A 1HK7A 1ZM3A 3QT6A 1N0UA 5IWAI 4WUDA 2HFSA 3ZKBA 5IWAE 2O1WA 1VISA 2E5LI 5L3JA 2E5LE 5A2QC 5A2QQ 4MYUA 2O1UA 4IZJA 3PRYA 1NHIA 5GMEA 3WU6A 1USVA 2R3VA 4AQYI 4YHHI 4AQYE 4YHHE 4EMDA 1ZXNA 3F0NA 4JI0I 1MU5A 1N32I 4JI0E 1XNQI 3P06A 3ZZ0A 1N32E 2F4VI 4LFBI 1XNQE 2J7KA 4DV3I 2F4VE 4LFBE 1Z0WA 2EFGA 3ZM7A 4DV3E 1IBKI 1K47A 1IBKE 4DUYI 4JI4I 1FNMA 1S16A 2V2ZA 2VQFI 4DUYE 4JI4E 4P52A 1IBMI 2VQFE 2IOQA 1IBME 1Z59A 4RPFA 2Q2EB 3HJCA 3D4JA 4JI6E 2A2CA 2O1TA 3ZZTA 2HKJA 2PNLA 3PYGA 5LMNI 3Q6NA 4OX9I 4DR5I 3Q1QA 1Z5CA 5LMNE 4DR6I 4OX9E 1FJGI 4DR6E 1FJGE 1N36I 3M6AA 5BR8I 4DR2I 4DR1I 1N36E 4DR4I 3J80Q 5BR8E 4DR2E 3PYDA 4DR1E 4DR4E 1H73A 2VF3A 1XMQI 1B62A 2UXBI 2Z5EA 4DPWA 1XMQE 3J7AG 2UXBE 4KHPI 4K0KI 2BM0A 4KHPE 1QZRA 2GS8A 4K0KE 4FWDA 4P7AA 4IZKA 2UXDI 4DV4I 1S4EA 3B8HA 2UXDE 1PKPA 4B3ME 3B82A 4HACB 1N34I 1RREA 1H72C 2DEIA 1N34E 1KVKA 1WUUA 4X62I 1NZ0A 4WUCA 4M1KA 4X62E 3WU5A 4IZJD 3WU3A 2X36A 4UTGA 1USUA 4LF5I 3ZZUA 1FWKA 2BV3A 1Z0BA 4LF5E 4Z7CA 4DV5I 4ED4A 2V34A 4DV5E 3LPSA 2UXCI 4IZJB 2UXCE 1DARA 1ZM2A 1HNWI 4JI1I 1Y4SA 4Z7YA 1HNWE 3WU4A 1Z0TA 4JI1E 2V8PA 1NHJA 1UEKA 5FLXC 4DR7E 1N33I 3ZKDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N33 E;  3OTO I;  4NXN I;  3OTO E;  4NXN E;  4NXM I;  1H74 A;  4NXM E;  4PRX A;  4HY1 A;  4DV1 I;  2CZ9 A;  2ZBK B;  4DV1 E;  4R1F A;  3QT7 A;  4JI6 I;  3J81 C;  2UU9 I;  1XNR I;  2UU9 E;  1XNR E;  3K17 A;  2DEJ A;  3B78 A;  4DV6 I;  4DPU A;  1A6F A;  4DV6 E;  4LF6 I;  4DV7 I;  4LF6 E;  2HK3 A;  1KKH A;  4DV7 E;  4DU8 A;  4FWG A;  4HYM A;  4PRV A;  4DV2 I;  4JYA I;  4XTJ A;  4DV2 E;  2X7I A;  4LF9 I;  4JYA E;  3K1J A;  1FKA E;  4LF9 E;  4URL A;  2R42 A;  2UUB I;  1J5E E;  4GKJ I;  2UUB E;  4GKJ E;  4WUB A;  1PVG A;  1XMO E;  1H7U A;  3GON A;  4YY3 I;  1XHK A;  3H4L A;  4MYT A;  4B3M I;  1FI4 A;  4HXZ A;  4YY3 E;  4DU7 A;  4JI5 I;  1D6T A;  3J7A M;  2HK2 A;  1KIJ A;  4JI5 E;  4B3R I;  5LMU I;  4B3R E;  5LMU E;  2V2V A;  3JAM C;  4DV0 I;  3JAM Q;  4DPT A;  4DV0 E;  1EI1 A;  1IBL I;  4GKK I;  2UUC I;  2NPF A;  1IBL E;  4GKK E;  1PIE A;  2UUC E;  2WW4 A;  3V2U C;  1ZM9 A;  2AJ4 A;  1ZM4 A;  1HNX I;  1B63 A;  3CWV A;  1FWL A;  1HNX E;  3T1H I;  1Z5B A;  3T1H E;  4DUZ I;  4LF4 I;  1I94 I;  1EA6 A;  4DUZ E;  4LF4 E;  1ZXM A;  4JV5 I;  1I94 E;  1MX0 A;  4FW9 A;  4JV5 E;  1MG7 A;  4JI2 I;  4JI7 I;  4DR7 I;  5LL6 R;  4JI7 E;  4JI2 E;  5FLX Q;  1Z0G A;  2HFU A;  3PYF A;  4X64 I;  1N0V C;  2ZIT A;  4X64 E;  5IT9 C;  4X66 I;  5IT9 Q;  4X66 E;  5GMD A;  1HNZ I;  4USM A;  1HNZ E;  3J81 Q;  1ELO A;  2BM1 A;  3LTO A;  4B3S I;  4B3T I;  1Z5A A;  4B3S E;  1BKN A;  4B3T E;  4FN5 A;  1OJ4 A;  4ZVI A;  2E1R A;  1Z0V A;  2V2Q A;  4KQV A;  4JI8 I;  4LFA I;  4LFA E;  4JI8 E;  4DXL A;  4DPY A;  1HR0 I;  1H7S A;  2OI2 A;  1J5E I;  2HHH I;  1HR0 E;  4LF8 I;  4DR5 E;  2HKE A;  4PU9 A;  2HHH E;  4I3H A;  4UT4 A;  4LF8 E;  4FWH A;  3T1Y I;  3LNU A;  1XMO I;  1Z0E A;  3J80 C;  3T1Y E;  2XEX A;  2ZM6 I;  1RR9 A;  2ZM6 E;  4X65 I;  4USK A;  3QT8 A;  4X65 E;  2UUA I;  1U2R A;  2VQE I;  1KTV A;  4LFC I;  2UUA E;  2VQE E;  4DR3 I;  4LFC E;  4JG4 A;  4DR3 E;  1NHH A;  4LF7 I;  2LJP A;  3V5R A;  4HAC A;  4DV4 E;  4JI3 I;  3HUL A;  4DPX A;  4LF7 E;  2A2D A;  3PYE A;  4JI3 E;  1Z0C A;  3QT5 A;  1ZM3 A;  3QT6 A;  1N0U A;  5IWA I;  4WUD A;  2HFS A;  3ZKB A;  5IWA E;  1VIS A;  2E5L I;  5L3J A;  2E5L E;  5A2Q C;  5A2Q Q;  4MYU A;  1NHI A;  5GME A;  3WU6 A;  2R3V A;  4AQY I;  4YHH I;  4AQY E;  4YHH E;  4EMD A;  1ZXN A;  3F0N A;  4JI0 I;  1MU5 A;  1N32 I;  4JI0 E;  1XNQ I;  3ZZ0 A;  1N32 E;  2F4V I;  4LFB I;  1XNQ E;  2J7K A;  4DV3 I;  2F4V E;  4LFB E;  1Z0W A;  2EFG A;  3ZM7 A;  4DV3 E;  1IBK I;  1K47 A;  1IBK E;  4DUY I;  4JI4 I;  1FNM A;  1S16 A;  2V2Z A;  2VQF I;  4DUY E;  4JI4 E;  4P52 A;  1IBM I;  2VQF E;  1IBM E;  1Z59 A;  4RPF A;  2Q2E B;  3D4J A;  4JI6 E;  2A2C A;  3ZZT A;  2HKJ A;  3PYG A;  5LMN I;  4OX9 I;  4DR5 I;  3Q1Q A;  1Z5C A;  5LMN E;  4DR6 I;  4OX9 E;  1FJG I;  4DR6 E;  1FJG E;  1N36 I;  3M6A A;  5BR8 I;  4DR2 I;  4DR1 I;  1N36 E;  4DR4 I;  3J80 Q;  5BR8 E;  4DR2 E;  3PYD A;  4DR1 E;  4DR4 E;  1H73 A;  2VF3 A;  1XMQ I;  1B62 A;  2UXB I;  4DPW A;  1XMQ E;  3J7A G;  2UXB E;  4KHP I;  4K0K I;  2BM0 A;  4KHP E;  1QZR A;  2GS8 A;  4K0K E;  4FWD A;  4P7A A;  2UXD I;  4DV4 I;  1S4E A;  3B8H A;  2UXD E;  1PKP A;  4B3M E;  3B82 A;  4HAC B;  1N34 I;  1RRE A;  1H72 C;  2DEI A;  1N34 E;  1KVK A;  1WUU A;  4X62 I;  1NZ0 A;  4WUC A;  4M1K A;  4X62 E;  3WU5 A;  3WU3 A;  2X36 A;  4UTG A;  4LF5 I;  3ZZU A;  1FWK A;  2BV3 A;  1Z0B A;  4LF5 E;  4Z7C A;  4DV5 I;  4ED4 A;  2V34 A;  4DV5 E;  3LPS A;  2UXC I;  2UXC E;  1DAR A;  1ZM2 A;  1HNW I;  4JI1 I;  4Z7Y A;  1HNW E;  3WU4 A;  1Z0T A;  4JI1 E;  2V8P A;  1NHJ A;  1UEK A;  5FLX C;  4DR7 E;  1N33 I;  3ZKD A; 
#chains in the Genus database with same CATH topology
 1N33 E;  5C0X D;  2O3Z A;  4NXN I;  3OTO I;  3OTO E;  4NXN E;  4NXM I;  1H74 A;  5K36 F;  1Y4U A;  1YHC A;  4NXM E;  4FW5 A;  4PRX A;  4HY1 A;  4DV1 I;  2CZ9 A;  2ZBK B;  2Z5B A;  4DV1 E;  2NN6 E;  4U3B A;  4R1F A;  3QT7 A;  4JI6 I;  1OYR A;  5C0X B;  3J81 C;  2UU9 I;  1XNR I;  5EL9 A;  2UU9 E;  1XNR E;  1YH8 A;  2NN6 A;  2BR2 B;  3K17 A;  2PNZ A;  2DEJ A;  3B78 A;  4DV6 I;  2PO0 A;  4DPU A;  2PNZ B;  1A6F A;  4DV6 E;  2Z5C A;  4LF6 I;  4MU1 A;  4DV7 I;  4LF6 E;  2HK3 A;  1KKH A;  2C39 A;  2Z5C B;  3P3C A;  4DV7 E;  4DU8 A;  4FWG A;  4HYM A;  2C39 B;  4PRV A;  4DV2 I;  1OYP A;  2C37 A;  4JYA I;  4XTJ A;  4DV2 E;  2X7I A;  5DRR A;  4LF9 I;  4JYA E;  3K1J A;  1FKA E;  2PO1 B;  4FW4 A;  5C0X F;  4J3D A;  4URL A;  4LF9 E;  2R42 A;  4IFD D;  2UUB I;  5DNL A;  2JE6 B;  1J5E E;  4GKJ I;  2UUB E;  2BA0 D;  4GKJ E;  5JEA D;  4WUB A;  1PVG A;  1XMO E;  4IZK B;  1H7U A;  3GON A;  4YY3 I;  1XHK A;  3HKM A;  3H4L A;  4MYT A;  4B3M I;  1FI4 A;  3U1K A;  4HXZ A;  4LCH A;  4YY3 E;  4GQU A;  4DU7 A;  4JI5 I;  1D6T A;  3PS2 A;  3J7A M;  2HK2 A;  1KIJ A;  4JI5 E;  4B3R I;  5LMU I;  4N3O A;  4LCF A;  2BA1 G;  4B3R E;  5LMU E;  2CVE A;  2V2V A;  3JAM C;  5ELW A;  4DV0 I;  3JAM Q;  4NBQ A;  3M85 G;  4DPT A;  2GQ0 A;  4DV0 E;  1EI1 A;  2IOP A;  1IBL I;  2IER A;  4GKK I;  2UUC I;  2NPF A;  1IBL E;  3GCM A;  1PIE A;  4GKK E;  2UUC E;  4OO1 D;  2WW4 A;  3M7N D;  2CG9 A;  1P42 A;  5DRQ A;  3V2U C;  2PO2 B;  1ZM9 A;  2AJ4 A;  1ZM4 A;  3DD6 A;  4AM3 A;  1HNX I;  4IFD C;  1B63 A;  2AE8 A;  3CWV A;  1FWL A;  1HNX E;  5K36 E;  3K85 A;  3T1H I;  1Z5B A;  3T1H E;  4DUZ I;  4LF4 I;  3P76 A;  1I94 I;  1EA6 A;  4FW3 A;  4DUZ E;  5K36 A;  4LF4 E;  1ZXM A;  3B4T A;  4JV5 I;  1I94 E;  4BA1 A;  1MX0 A;  4FW9 A;  4JV5 E;  5JEA F;  1MG7 A;  3L7Z A;  4JI2 I;  3P3E A;  4JI7 I;  4DR7 I;  5LL6 R;  4JI7 E;  4JI2 E;  2C38 A;  1R6L A;  5FLX Q;  1Z0G A;  5K36 C;  1Y6Z A;  2HFU A;  3PYF A;  4X64 I;  1N0V C;  2J65 A;  2O1V A;  2ZIT A;  4U3D A;  4X64 E;  3NZK A;  4X66 I;  5IT9 C;  5IT9 Q;  3U1Y A;  4X66 E;  5GMD A;  1HNZ I;  4FW6 A;  4USM A;  1HNZ E;  4OO1 F;  2Z5B B;  3J81 Q;  1ELO A;  2BM1 A;  1UDS A;  4FW7 A;  3LTO A;  4IS9 A;  4B3S I;  2NN6 B;  4B3T I;  1Z5A A;  5FWK A;  1BKN A;  4B3S E;  4B3T E;  4FN5 A;  4OKG A;  2PO0 B;  5DNX A;  1OJ4 A;  4AID A;  4ZVI A;  2E1R A;  1Z0V A;  2JEB A;  2PNM A;  2V2Q A;  3Q6M A;  4KQV A;  4JI8 I;  4LFA I;  4LFA E;  4JI8 E;  4DXL A;  2IES A;  5C0X C;  4DPY A;  3PS3 A;  2GO4 A;  2C37 B;  1HR0 I;  1H7S A;  2OI2 A;  1J5E I;  2HHH I;  1HR0 E;  4LF8 I;  4DR5 E;  4OZE A;  2HKE A;  4PU9 A;  2HHH E;  4I3H A;  4UT4 A;  4LF8 E;  4FWH A;  3T1Y I;  3LNU A;  1XMO I;  2NN6 F;  1Z0E A;  3J80 C;  3T1Y E;  2XEX A;  2ZM6 I;  1RR9 A;  2ZM6 E;  2WNR A;  4X65 I;  4USK A;  3QT8 A;  4X65 E;  2WNR B;  2UUA I;  1U2R A;  2CGE A;  2VQE I;  1KTV A;  4LFC I;  4IFD E;  2UUA E;  2VQE E;  4DR3 I;  4AIM A;  4JG4 A;  4LFC E;  4DR3 E;  1NHH A;  5JEA E;  4IFD A;  3KRN A;  4LF7 I;  2LJP A;  3V5R A;  4HAC A;  4DV4 E;  4JI3 I;  3HUL A;  2VES A;  4DPX A;  2A2D A;  4LF7 E;  3PYE A;  4JI3 E;  5JEA A;  1Z0C A;  3QT5 A;  1HK7 A;  1ZM3 A;  4ISA A;  3QT6 A;  1N0U A;  5IWA I;  4WUD A;  2HFS A;  3ZKB A;  5IWA E;  2O1W A;  5JEA C;  4BA2 A;  1VIS A;  2E5L I;  5L3J A;  2E5L E;  4OO1 E;  5A2Q C;  1Y60 A;  5A2Q Q;  4LPF A;  5K36 B;  4MYU A;  2O1U A;  4IZJ A;  3PRY A;  1NHI A;  3PS1 A;  5GME A;  4BA1 B;  3WU6 A;  1USV A;  2R3V A;  4OO1 A;  3L7Z B;  2BA1 D;  2JEA A;  4AQY I;  4YHH I;  2C38 B;  3P3G A;  4AQY E;  4EMD A;  4YHH E;  3M85 D;  1ZXN A;  2WP8 A;  1E3P A;  3F0N A;  4JI0 I;  1MU5 A;  5EKW A;  1N32 I;  4JI0 E;  4OO1 C;  1XNQ I;  3P06 A;  2NN6 D;  3ZZ0 A;  1N32 E;  2F4V I;  4LFB I;  1XNQ E;  2J7K A;  4DV3 I;  2F4V E;  4LFB E;  4LOM A;  1Z0W A;  2EFG A;  3ZM7 A;  4DV3 E;  4QNK A;  1IBK I;  1K47 A;  1IBK E;  4DUY I;  4JI4 I;  1FNM A;  5C0X E;  1S16 A;  2V2Z A;  2VQF I;  4DUY E;  4JI4 E;  4P52 A;  1IBM I;  2VQF E;  2IOQ A;  1IBM E;  1Z59 A;  1UDQ A;  4RPF A;  5C0X A;  2Q2E B;  2BA0 G;  3HJC A;  3D4J A;  4JI6 E;  2A2C A;  2BR2 A;  2O1T A;  1XXE A;  5DRO A;  3ZZT A;  1E3H A;  2JEB B;  2HKJ A;  4QNJ A;  2PNL A;  3PYG A;  5LMN I;  3Q6N A;  4OX9 I;  4DR5 I;  3Q1Q A;  1Z5C A;  2JT2 A;  5LMN E;  1UDN A;  4MDT A;  2NN6 C;  4OX9 E;  4DR6 I;  1FJG I;  4DR6 E;  1FJG E;  1N36 I;  4MU3 A;  1RHY A;  3M6A A;  5BR8 I;  4DR2 I;  4DR1 I;  1N36 E;  4DR4 I;  3J80 Q;  5BR8 E;  3H1C A;  3PYD A;  4DR2 E;  4DR1 E;  3M7N G;  4MQY A;  5DRP A;  4DR4 E;  2PO1 A;  1H73 A;  2VF3 A;  1XMQ I;  1B62 A;  2UXB I;  2Z5E A;  4DPW A;  2JE6 A;  1XMQ E;  3J7A G;  2UXB E;  3GLL A;  4KHP I;  4K0K I;  2BM0 A;  4KHP E;  1QZR A;  2GS8 A;  4K0K E;  4FWD A;  4P7A A;  4IZK A;  1VI7 A;  2UXD I;  4DV4 I;  1S4E A;  3B8H A;  2UXD E;  1PKP A;  4IFD B;  3UHM A;  2GO3 A;  4B3M E;  3B82 A;  1R6M A;  4HAC B;  1N34 I;  1RRE A;  1H72 C;  2DEI A;  1N34 E;  1KVK A;  5JEA B;  1WUU A;  4X62 I;  5K36 D;  1NZ0 A;  4WUC A;  4M1K A;  4X62 E;  3WU5 A;  3CDJ A;  4IZJ D;  3WU3 A;  4MU4 A;  2X36 A;  4UTG A;  1USU A;  4LF5 I;  3ZZU A;  1Y5Y A;  1FWK A;  2PO2 A;  2BV3 A;  1Z0B A;  4LF5 E;  4Z7C A;  3GME A;  4DV5 I;  4BA2 B;  4ED4 A;  2V34 A;  4DV5 E;  3LPS A;  2UXC I;  4IZJ B;  2UXC E;  1UDO A;  1DAR A;  4MU0 A;  1ZM2 A;  2F1D A;  4OO1 B;  1HNW I;  4IFD F;  2JEA B;  4JI1 I;  1Y4S A;  4Z7Y A;  1HNW E;  3WU4 A;  1Z0T A;  4JI1 E;  2V8P A;  4LCG A;  2WP8 B;  1NHJ A;  1UEK A;  1OYS A;  5FLX C;  4DR7 E;  1N33 I;  3CDI A;  3ZKD A; 
#chains in the Genus database with same CATH homology
 1N33 E;  3OTO I;  4NXN I;  3OTO E;  4NXN E;  4NXM I;  1H74 A;  1Y4U A;  4NXM E;  4PRX A;  4HY1 A;  4DV1 I;  2CZ9 A;  2ZBK B;  2Z5B A;  4DV1 E;  4R1F A;  3QT7 A;  4JI6 I;  3J81 C;  2UU9 I;  1XNR I;  2UU9 E;  1XNR E;  3K17 A;  2DEJ A;  3B78 A;  4DV6 I;  4DPU A;  1A6F A;  4DV6 E;  2Z5C A;  4LF6 I;  4DV7 I;  4LF6 E;  2HK3 A;  1KKH A;  2Z5C B;  4DV7 E;  4DU8 A;  4FWG A;  4HYM A;  4PRV A;  4DV2 I;  4JYA I;  4XTJ A;  4DV2 E;  2X7I A;  4LF9 I;  4JYA E;  3K1J A;  1FKA E;  4LF9 E;  4URL A;  2R42 A;  2UUB I;  1J5E E;  4GKJ I;  2UUB E;  4GKJ E;  4WUB A;  1PVG A;  1XMO E;  4IZK B;  1H7U A;  3GON A;  4YY3 I;  1XHK A;  3H4L A;  4MYT A;  4B3M I;  1FI4 A;  4HXZ A;  4YY3 E;  4DU7 A;  4JI5 I;  1D6T A;  3J7A M;  2HK2 A;  1KIJ A;  4JI5 E;  4B3R I;  5LMU I;  4N3O A;  4B3R E;  5LMU E;  2V2V A;  3JAM C;  4DV0 I;  3JAM Q;  4DPT A;  2GQ0 A;  4DV0 E;  1EI1 A;  2IOP A;  1IBL I;  4GKK I;  2UUC I;  2NPF A;  1IBL E;  4GKK E;  1PIE A;  2UUC E;  2WW4 A;  2CG9 A;  3V2U C;  1ZM9 A;  2AJ4 A;  1ZM4 A;  1HNX I;  1B63 A;  3CWV A;  1FWL A;  1HNX E;  3K85 A;  3T1H I;  1Z5B A;  3T1H E;  4DUZ I;  4LF4 I;  1I94 I;  1EA6 A;  4DUZ E;  4LF4 E;  1ZXM A;  4JV5 I;  1I94 E;  1MX0 A;  4FW9 A;  4JV5 E;  1MG7 A;  4JI2 I;  4JI7 I;  4DR7 I;  5LL6 R;  4JI7 E;  4JI2 E;  5FLX Q;  1Z0G A;  1Y6Z A;  2HFU A;  3PYF A;  4X64 I;  1N0V C;  2O1V A;  2ZIT A;  4X64 E;  5IT9 C;  4X66 I;  5IT9 Q;  4X66 E;  5GMD A;  1HNZ I;  4USM A;  1HNZ E;  2Z5B B;  3J81 Q;  1ELO A;  2BM1 A;  3LTO A;  4B3S I;  4B3T I;  1Z5A A;  5FWK A;  1BKN A;  4B3S E;  4B3T E;  4FN5 A;  1OJ4 A;  4ZVI A;  2E1R A;  1Z0V A;  2PNM A;  2V2Q A;  3Q6M A;  4KQV A;  4JI8 I;  4LFA I;  4LFA E;  4JI8 E;  4DXL A;  4DPY A;  1HR0 I;  1H7S A;  2OI2 A;  1J5E I;  2HHH I;  1HR0 E;  4LF8 I;  4DR5 E;  2HKE A;  4PU9 A;  2HHH E;  4I3H A;  4UT4 A;  4LF8 E;  4FWH A;  3T1Y I;  3LNU A;  1XMO I;  1Z0E A;  3J80 C;  3T1Y E;  2XEX A;  2ZM6 I;  1RR9 A;  2ZM6 E;  4X65 I;  4USK A;  3QT8 A;  4X65 E;  2UUA I;  1U2R A;  2CGE A;  2VQE I;  1KTV A;  4LFC I;  2UUA E;  2VQE E;  4DR3 I;  4LFC E;  4JG4 A;  4DR3 E;  1NHH A;  4LF7 I;  2LJP A;  3V5R A;  4HAC A;  4DV4 E;  4JI3 I;  3HUL A;  4DPX A;  4LF7 E;  2A2D A;  3PYE A;  4JI3 E;  1Z0C A;  3QT5 A;  1HK7 A;  1ZM3 A;  3QT6 A;  1N0U A;  5IWA I;  4WUD A;  2HFS A;  3ZKB A;  5IWA E;  2O1W A;  1VIS A;  2E5L I;  5L3J A;  2E5L E;  5A2Q C;  5A2Q Q;  4MYU A;  2O1U A;  4IZJ A;  3PRY A;  1NHI A;  5GME A;  3WU6 A;  1USV A;  2R3V A;  4AQY I;  4YHH I;  4AQY E;  4YHH E;  4EMD A;  1ZXN A;  3F0N A;  4JI0 I;  1MU5 A;  1N32 I;  4JI0 E;  1XNQ I;  3P06 A;  3ZZ0 A;  1N32 E;  2F4V I;  4LFB I;  1XNQ E;  2J7K A;  4DV3 I;  2F4V E;  4LFB E;  1Z0W A;  2EFG A;  3ZM7 A;  4DV3 E;  1IBK I;  1K47 A;  1IBK E;  4DUY I;  4JI4 I;  1FNM A;  1S16 A;  2V2Z A;  2VQF I;  4DUY E;  4JI4 E;  4P52 A;  1IBM I;  2VQF E;  2IOQ A;  1IBM E;  1Z59 A;  4RPF A;  2Q2E B;  3HJC A;  3D4J A;  4JI6 E;  2A2C A;  2O1T A;  3ZZT A;  2HKJ A;  2PNL A;  3PYG A;  5LMN I;  3Q6N A;  4OX9 I;  4DR5 I;  3Q1Q A;  1Z5C A;  5LMN E;  4DR6 I;  4OX9 E;  1FJG I;  4DR6 E;  1FJG E;  1N36 I;  3M6A A;  5BR8 I;  4DR2 I;  4DR1 I;  1N36 E;  4DR4 I;  3J80 Q;  5BR8 E;  4DR2 E;  3PYD A;  4DR1 E;  4DR4 E;  1H73 A;  2VF3 A;  1XMQ I;  1B62 A;  2UXB I;  2Z5E A;  4DPW A;  1XMQ E;  3J7A G;  2UXB E;  4KHP I;  4K0K I;  2BM0 A;  4KHP E;  1QZR A;  2GS8 A;  4K0K E;  4FWD A;  4P7A A;  4IZK A;  2UXD I;  4DV4 I;  1S4E A;  3B8H A;  2UXD E;  1PKP A;  4B3M E;  3B82 A;  4HAC B;  1N34 I;  1RRE A;  1H72 C;  2DEI A;  1N34 E;  1KVK A;  1WUU A;  4X62 I;  1NZ0 A;  4WUC A;  4M1K A;  4X62 E;  3WU5 A;  4IZJ D;  3WU3 A;  2X36 A;  4UTG A;  1USU A;  4LF5 I;  3ZZU A;  1FWK A;  2BV3 A;  1Z0B A;  4LF5 E;  4Z7C A;  4DV5 I;  4ED4 A;  2V34 A;  4DV5 E;  3LPS A;  2UXC I;  4IZJ B;  2UXC E;  1DAR A;  1ZM2 A;  1HNW I;  4JI1 I;  1Y4S A;  4Z7Y A;  1HNW E;  3WU4 A;  1Z0T A;  4JI1 E;  2V8P A;  1NHJ A;  1UEK A;  5FLX C;  4DR7 E;  1N33 I;  3ZKD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...