1HR0I

Crystal structure of initiation factor if1 bound to the 30s ribosomal subunit
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGRFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of an initiation factor bound to the 30S ribosomal subunit.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 31
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2000-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1hr0I00
1PVGA 1ZM3A 3V5RA 4DR6E 1BKNA 4ED4A 4P7AA 5BR8I 5IT9Q 4JI6I 2UXBE 4MYTA 2GS8A 4M1KA 3OTOE 1EI1A 4X62I 2J7KA 4DV2I 4DV7I 1Z0TA 4LF7E 4LF8E 1H72C 4FN5A 1EA6A 1Z59A 4LFBE 4DPYA 5FLXQ 2VQFE 4LF5I 4B3SE 1OJ4A 4DUYE 1ZM2A 3WU5A 4Z7YA 1ZM9A 2VQEE 3T1HE 2UUBI 5L3JA 4X65E 4WUDA 4JI8E 3K17A 4X66E 1ZXNA 2ZM6I 2ZITA 4I3HA 4JI4E 5A2QC 5LMUI 4GKJE 2R42A 1UEKA 4DR1E 4NXME 4B3ME 4JI0I 1Z5CA 2E5LI 1Z0BA 4JI1E 5GMDA 1FKAE 3WU6A 4DV4I 4LF9I 4DV6I 2UXDE 2A2CA 4LFCE 4LFBI 1IBKE 4DUZI 2X36A 4DU8A 2UUCI 4XTJA 4LF7I 4NXNE 4B3TE 4DR5E 3ZM7A 4UT4A 2UUCE 1HNXI 2BM1A 5BR8E 3J7AM 3J81Q 4DV6E 1FWKA 4DPXA 4PRVA 4PU9A 1MG7A 4JV5E 4DV4E 4KHPI 4JI7I 1N34I 1HNZI 1H7SA 3J81C 1DARA 1N0VC 2UXDI 2HK3A 4DV0I 4PRXA 4X64E 1FJGI 1XMOI 1IBMI 3M6AA 2X7IA 3V2UC 1FJGE 3B8HA 4DV3E 4LFAE 4MYUA 3ZZUA 1N0UA 1IBLI 4YY3E 3K1JA 2UUBE 3T1HI 4K0KE 3QT5A 2OI2A 4JI4I 4YHHI 2UUAI 1H7UA 4X64I 1VISA 4UTGA 4X66I 2ZM6E 3ZKDA 1FWLA 4LF5E 4JI8I 2VQFI 2V2VA 3F0NA 1Z0CA 4URLA 4HACA 4DR7E 2VQEI 1N32E 4OX9E 1PIEA 3B78A 1N33E 1MX0A 4RPFA 1XNRI 2UXCE 3LPSA 4Z7CA 2F4VE 3PYFA 4NXNI 1Z5AA 2A2DA 3J80Q 4DU7A 1KKHA 2F4VI 4X62E 4DR6I 2UXCI 1B63A 1PKPA 1N32I 1FI4A 3Q1QA 4R1FA 4DR7I 4YY3I 1KVKA 2E5LE 4USMA 2V8PA 2HHHE 4DR4E 1IBME 4JI1I 3QT7A 4K0KI 1Z0VA 3ZKBA 4B3RE 1Z5BA 4DR1I 4GKJI 1XNQE 4B3RI 2UU9E 2HHHI 4DXLA 5LMNI 4GKKI 4FWDA 4P52A 1XMOE 5IWAI 4HXZA 4JI3I 1N36E 3D4JA 4DPWA 1ZM4A 1I94E 4DR3I 1Z0EA 3J7AG 4KQVA 3PYDA 1HNXE 3HULA 1H74A 1B62A 4DV1E 4KHPE 3OTOI 2V2ZA 1K47A 3LTOA 2HFUA 2BM0A 4AQYE 4LF8I 2E1RA 2HK2A 1RREA 1NHHA 2Q2EB 4DUZE 1XNRE 1N33I 4WUCA 4LFCI 2HKEA 2R3VA 4JI6E 2DEIA 4DR5I 3GONA 4DR2I 3QT6A 1D6TA 4FWHA 1I94I 5IT9C 2EFGA 4JG4A 4FW9A 4LF6I 1U2RA 5LMUE 3QT8A 1NHIA 1HNWI 1IBLE 4LF4E 3LNUA 1Z0GA 1J5EI 5FLXC 2LJPA 4DPUA 4JI2E 4X65I 2HKJA 3T1YI 4FWGA 2AJ4A 4JYAE 4DV0E 4DUYI 4DPTA 1S16A 3ZZTA 1S4EA 1A6FA 1ZXMA 1HNWE 4DR2E 1HNZE 4HACB 3J80C 1N34E 2DEJA 3JAMQ 2XEXA 3CWVA 4B3SI 5GMEA 3WU3A 4DV5E 1FNMA 2V34A 1XMQI 4DV2E 4DV7E 1Z0WA 1XMQE 4AQYI 4DV5I 2BV3A 4HYMA 1NHJA 2UXBI 4OX9I 4HY1A 4B3TI 1NZ0A 1IBKI 3PYEA 1XHKA 4JI5I 4LF9E 2V2QA 4JI3E 4DV1I 3H4LA 3JAMC 4YHHE 2UUAE 2VF3A 1HR0E 4DR3E 2UU9I 1KIJA 4EMDA 4WUBA 4JI0E 3ZZ0A 1ELOA 1H73A 4B3MI 4JYAI 4JI2I 4NXMI 1N36I 4LFAI 2NPFA 1RR9A 1MU5A 4DV3I 5IWAE 3T1YE 1QZRA 5LMNE 3B82A 4GKKE 1WUUA 4ZVIA 3WU4A 1J5EE 2CZ9A 1XNQI 5LL6R 4LF4I 2HFSA 4JI5E 4USKA 2WW4A 2ZBKB 3PYGA 1HR0I 5A2QQ 4DR4I 1KTVA 4LF6E 4JI7E 4JV5I
chains in the Genus database with same CATH superfamily
1PVGA 1ZM3A 3V5RA 3P3CA 4DR6E 1BKNA 5JEAA 4OO1E 4ED4A 1YH8A 4P7AA 5BR8I 5IT9Q 4JI6I 2JEBA 4IFDB 3GLLA 2UXBE 4MYTA 2GS8A 1Y5YA 2IOQA 4M1KA 3OTOE 1EI1A 4X62I 2J7KA 4J3DA 4DV2I 4DV7I 1Z0TA 4LF7E 2WNRA 3GCMA 1H72C 4LF8E 4FN5A 1EA6A 1Z59A 4LFBE 4DPYA 5FLXQ 2VQFE 4LF5I 4B3SE 1OJ4A 4N3OA 4DUYE 3PS3A 1ZM2A 3WU5A 4MU4A 4Z7YA 3DD6A 1ZM9A 2VQEE 3T1HE 2UUBI 5L3JA 4X65E 4WUDA 4IFDF 4JI8E 3K17A 4LCGA 4X66E 1ZXNA 2ZM6I 2ZITA 4I3HA 5JEAD 2O3ZA 4JI4E 5A2QC 2IOPA 5LMUI 2PO2B 3P3GA 4U3BA 4GKJE 2R42A 1UEKA 4DR1E 4NXME 5DRQA 4B3ME 4JI0I 1Z5CA 2E5LI 4MU3A 5JEAC 1Z0BA 4JI1E 5GMDA 1FKAE 4MQYA 3WU6A 2PNLA 2JT2A 4DV4I 5EKWA 4BA1A 4LF9I 4BA1B 5C0XF 2C37A 4DV6I 2UXDE 2A2CA 4LCFA 4LFCE 4LFBI 1IBKE 4DUZI 2X36A 2O1TA 4DU8A 2UUCI 4XTJA 4LF7I 4NXNE 4B3TE 4NBQA 4FW7A 4DR5E 2J65A 5DNLA 2PO1B 1RHYA 3ZM7A 4UT4A 2UUCE 1HNXI 2C38B 2BM1A 5BR8E 3M85G 3J7AM 3J81Q 4DV6E 1FWKA 4DPXA 4PRVA 4PU9A 1MG7A 4JV5E 3M85D 4DV4E 3NZKA 4KHPI 4JI7I 1OYPA 1N34I 1HNZI 2PNZB 2BR2B 1H7SA 4IZKA 4IZJD 3PS2A 3K85A 3J81C 2PO0B 2NN6A 1DARA 1N0VC 5K36C 2UXDI 1E3PA 2HK3A 4DV0I 5JEAE 4OO1A 4PRXA 4X64E 5DNXA 2PNMA 5C0XA 1FJGI 1XMOI 2O1WA 1IBMI 3M6AA 2NN6C 2X7IA 5DRRA 5K36F 2IESA 3V2UC 1FJGE 3B8HA 2C37B 4DV3E 4LFAE 4MYUA 5JEAF 3ZZUA 1N0UA 4MDTA 1IBLI 4YY3E 3K1JA 1USUA 2UUBE 3T1HI 2Z5CA 4K0KE 2PO2A 2GO4A 3QT5A 1Y60A 2OI2A 4JI4I 4AIDA 4YHHI 2UUAI 3PS1A 1H7UA 4X64I 1VISA 4UTGA 4X66I 2ZM6E 3ZKDA 1FWLA 4OO1B 1HK7A 4LF5E 4JI8I 2VQFI 1VI7A 2V2VA 3F0NA 4OZEA 1Z0CA 4URLA 2WP8A 4HACA 4DR7E 2VQEI 3L7ZB 4OO1C 1N32E 4IS9A 4OX9E 1PIEA 4AM3A 3U1KA 3Q6MA 3B78A 1N33E 2O1UA 1MX0A 4RPFA 1XNRI 2UXCE 3LPSA 4Z7CA 2F4VE 3PYFA 3UHMA 4NXNI 1Z5AA 2A2DA 3J80Q 4DU7A 1KKHA 2F4VI 3CDIA 4X62E 1Y6ZA 4DR6I 2UXCI 4ISAA 1B63A 5C0XC 1PKPA 4OKGA 5K36E 1N32I 2O1VA 1FI4A 5K36A 5FWKA 3Q1QA 4R1FA 4FW5A 4DR7I 4YY3I 1KVKA 5C0XB 2E5LE 2IERA 4USMA 2V8PA 4BA2B 3CDJA 2HHHE 4DR4E 1IBME 2NN6D 4JI1I 3QT7A 4K0KI 1Z0VA 3ZKBA 4B3RE 1Z5BA 2C39A 4DR1I 1YHCA 4GKJI 1XNQE 2PO0A 4B3RI 2UU9E 2JEAA 2Z5BB 4IFDC 2AE8A 4FW6A 2HHHI 4DXLA 5LMNI 4GKKI 4FWDA 2BA0G 4P52A 1XMOE 5IWAI 4HXZA 2BA1G 1N36E 4JI3I 2PO1A 3D4JA 4DPWA 1ZM4A 1I94E 4IZJB 4DR3I 3HJCA 1Z0EA 4U3DA 4KQVA 3J7AG 3PYDA 1Y4SA 1R6LA 1HNXE 2WP8B 3HULA 1UDOA 1H74A 4IZJA 1B62A 2JE6A 5C0XE 4DV1E 4KHPE 3H1CA 2V2ZA 3OTOI 1K47A 3LTOA 2HFUA 2BM0A 4AQYE 4LF8I 2E1RA 2HK2A 3P76A 1UDSA 5K36B 3PRYA 1RREA 1NHHA 2Q2EB 4BA2A 4DUZE 1XNRE 5JEAB 1N33I 4WUCA 4LFCI 2JEAB 3M7NG 2HKEA 2R3VA 1P42A 2JEBB 4LOMA 4QNJA 4JI6E 2DEIA 4DR5I 3Q6NA 4FW3A 3GONA 4IZKB 4DR2I 4OO1F 2Z5BA 3QT6A 3P06A 1D6TA 4FWHA 2GQ0A 1I94I 5IT9C 3HKMA 2EFGA 4JG4A 4IFDE 4FW9A 4LF6I 4MU1A 2VESA 1U2RA 4AIMA 5LMUE 3QT8A 1NHIA 1HNWI 5EL9A 4FW4A 1IBLE 3M7ND 3B4TA 4LF4E 3LNUA 1Z0GA 5ELWA 1J5EI 5FLXC 2LJPA 5DRPA 4IFDD 4DPUA 1USVA 2JE6B 4JI2E 2NN6F 4X65I 2C38A 2HKJA 1Y4UA 3T1YI 4FWGA 2AJ4A 3GMEA 2C39B 4JYAE 4DV0E 4DUYI 4DPTA 2F1DA 4QNKA 1S16A 4IFDA 3ZZTA 2CG9A 1S4EA 1A6FA 2WNRB 1ZXMA 1HNWE 4DR2E 3L7ZA 1HNZE 4HACB 3J80C 1N34E 2DEJA 3JAMQ 2XEXA 1UDQA 4LPFA 3CWVA 4B3SI 5GMEA 3WU3A 4DV5E 2GO3A 3U1YA 5C0XD 1FNMA 2V34A 1XMQI 4DV2E 4DV7E 2Z5CB 1Z0WA 1XMQE 4AQYI 4GQUA 4DV5I 2BV3A 4HYMA 1NHJA 2NN6B 2UXBI 4OX9I 4HY1A 4B3TI 1NZ0A 2BR2A 2CVEA 2BA0D 1IBKI 3PYEA 1XHKA 2CGEA 4JI5I 4LF9E 2V2QA 4JI3E 1OYSA 4DV1I 3H4LA 3JAMC 4OO1D 4YHHE 2UUAE 2VF3A 2PNZA 4DR3E 1HR0E 2NN6E 2UU9I 1KIJA 4EMDA 4WUBA 4JI0E 3ZZ0A 1ELOA 1H73A 4B3MI 4JYAI 4JI2I 4NXMI 3KRNA 1N36I 4LCHA 4LFAI 2NPFA 1RR9A 1MU5A 4DV3I 5IWAE 3T1YE 1UDNA 1QZRA 5LMNE 3B82A 3P3EA 4GKKE 1WUUA 2BA1D 4ZVIA 3WU4A 1J5EE 2CZ9A 1XNQI 5LL6R 4LF4I 5K36D 1OYRA 2HFSA 4JI5E 4USKA 5DROA 2WW4A 4MU0A 2ZBKB 3PYGA 1R6MA 1HR0I 5A2QQ 4DR4I 1XXEA 1KTVA 4LF6E 4JI7E 1E3HA 2Z5EA 4JV5I
chains in the Genus database with same CATH topology
1PVGA 1ZM3A 3V5RA 4DR6E 1BKNA 4ED4A 4P7AA 5BR8I 5IT9Q 4JI6I 2UXBE 4MYTA 2GS8A 2IOQA 4M1KA 3OTOE 1EI1A 4X62I 2J7KA 4DV2I 4DV7I 1Z0TA 4LF7E 4LF8E 1H72C 4FN5A 1EA6A 1Z59A 4LFBE 4DPYA 5FLXQ 2VQFE 4LF5I 4B3SE 1OJ4A 4N3OA 4DUYE 1ZM2A 3WU5A 4Z7YA 1ZM9A 2VQEE 3T1HE 2UUBI 5L3JA 4X65E 4WUDA 4JI8E 3K17A 4X66E 1ZXNA 2ZM6I 2ZITA 4I3HA 4JI4E 5A2QC 2IOPA 5LMUI 4GKJE 2R42A 1UEKA 4DR1E 4NXME 4B3ME 4JI0I 1Z5CA 2E5LI 1Z0BA 4JI1E 5GMDA 1FKAE 3WU6A 2PNLA 4DV4I 4LF9I 4DV6I 2UXDE 2A2CA 4LFCE 4LFBI 1IBKE 4DUZI 2X36A 2O1TA 4DU8A 2UUCI 4XTJA 4LF7I 4NXNE 4B3TE 4DR5E 3ZM7A 4UT4A 2UUCE 1HNXI 2BM1A 5BR8E 3J7AM 3J81Q 4DV6E 1FWKA 4DPXA 4PRVA 4PU9A 1MG7A 4JV5E 4DV4E 4KHPI 4JI7I 1N34I 1HNZI 1H7SA 4IZKA 4IZJD 3K85A 3J81C 1DARA 1N0VC 2UXDI 2HK3A 4DV0I 4PRXA 4X64E 2PNMA 1FJGI 1XMOI 2O1WA 1IBMI 3M6AA 2X7IA 3V2UC 1FJGE 3B8HA 4DV3E 4LFAE 4MYUA 3ZZUA 1N0UA 1IBLI 4YY3E 3K1JA 1USUA 2UUBE 3T1HI 2Z5CA 4K0KE 3QT5A 2OI2A 4JI4I 4YHHI 2UUAI 1H7UA 4X64I 1VISA 4UTGA 4X66I 2ZM6E 3ZKDA 1FWLA 1HK7A 4LF5E 4JI8I 2VQFI 2V2VA 3F0NA 1Z0CA 4URLA 4HACA 4DR7E 2VQEI 1N32E 4OX9E 1PIEA 3Q6MA 3B78A 1N33E 2O1UA 1MX0A 4RPFA 1XNRI 2UXCE 3LPSA 4Z7CA 2F4VE 3PYFA 4NXNI 1Z5AA 2A2DA 3J80Q 4DU7A 1KKHA 2F4VI 4X62E 1Y6ZA 4DR6I 2UXCI 1B63A 1PKPA 1N32I 2O1VA 1FI4A 5FWKA 3Q1QA 4R1FA 4DR7I 4YY3I 1KVKA 2E5LE 4USMA 2V8PA 2HHHE 4DR4E 1IBME 4JI1I 3QT7A 4K0KI 1Z0VA 3ZKBA 4B3RE 1Z5BA 4DR1I 4GKJI 1XNQE 4B3RI 2UU9E 2Z5BB 2HHHI 4DXLA 5LMNI 4GKKI 4FWDA 4P52A 1XMOE 5IWAI 4HXZA 4JI3I 1N36E 3D4JA 4DPWA 1ZM4A 1I94E 4IZJB 4DR3I 3HJCA 1Z0EA 3J7AG 4KQVA 3PYDA 1Y4SA 1HNXE 3HULA 1H74A 4IZJA 1B62A 4DV1E 4KHPE 3OTOI 2V2ZA 1K47A 3LTOA 2HFUA 2BM0A 4AQYE 4LF8I 2E1RA 2HK2A 3PRYA 1RREA 1NHHA 2Q2EB 4DUZE 1XNRE 1N33I 4WUCA 4LFCI 2HKEA 2R3VA 4JI6E 2DEIA 4DR5I 3Q6NA 4IZKB 3GONA 4DR2I 2Z5BA 3QT6A 3P06A 1D6TA 4FWHA 2GQ0A 1I94I 5IT9C 2EFGA 4JG4A 4FW9A 4LF6I 1U2RA 5LMUE 3QT8A 1NHIA 1HNWI 1IBLE 4LF4E 3LNUA 1Z0GA 1J5EI 5FLXC 2LJPA 4DPUA 1USVA 4JI2E 4X65I 2HKJA 1Y4UA 3T1YI 4FWGA 2AJ4A 4JYAE 4DV0E 4DUYI 4DPTA 1S16A 3ZZTA 2CG9A 1S4EA 1A6FA 1ZXMA 1HNWE 4DR2E 1HNZE 4HACB 3J80C 1N34E 2DEJA 3JAMQ 2XEXA 3CWVA 4B3SI 5GMEA 3WU3A 4DV5E 1FNMA 2V34A 1XMQI 4DV2E 4DV7E 2Z5CB 1Z0WA 1XMQE 4AQYI 4DV5I 2BV3A 4HYMA 1NHJA 2UXBI 4OX9I 4HY1A 4B3TI 1NZ0A 1IBKI 3PYEA 1XHKA 2CGEA 4JI5I 4LF9E 2V2QA 4JI3E 4DV1I 3H4LA 3JAMC 4YHHE 2UUAE 2VF3A 1HR0E 4DR3E 2UU9I 1KIJA 4EMDA 4WUBA 4JI0E 3ZZ0A 1ELOA 1H73A 4B3MI 4JYAI 4JI2I 4NXMI 1N36I 4LFAI 2NPFA 1RR9A 1MU5A 4DV3I 5IWAE 3T1YE 1QZRA 5LMNE 3B82A 4GKKE 1WUUA 4ZVIA 3WU4A 1J5EE 2CZ9A 1XNQI 5LL6R 4LF4I 2HFSA 4JI5E 4USKA 2WW4A 2ZBKB 3PYGA 1HR0I 5A2QQ 4DR4I 1KTVA 4LF6E 4JI7E 2Z5EA 4JV5I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PVG A;  1ZM3 A;  3V5R A;  4DR6 E;  1BKN A;  4ED4 A;  4P7A A;  5BR8 I;  5IT9 Q;  4JI6 I;  2UXB E;  4MYT A;  2GS8 A;  4M1K A;  3OTO E;  1EI1 A;  4X62 I;  2J7K A;  4DV2 I;  4DV7 I;  1Z0T A;  4LF7 E;  4LF8 E;  1H72 C;  4FN5 A;  1EA6 A;  1Z59 A;  4LFB E;  4DPY A;  5FLX Q;  2VQF E;  4LF5 I;  4B3S E;  1OJ4 A;  4DUY E;  1ZM2 A;  3WU5 A;  4Z7Y A;  1ZM9 A;  2VQE E;  3T1H E;  2UUB I;  5L3J A;  4X65 E;  4WUD A;  4JI8 E;  3K17 A;  4X66 E;  1ZXN A;  2ZM6 I;  2ZIT A;  4I3H A;  4JI4 E;  5A2Q C;  5LMU I;  4GKJ E;  2R42 A;  1UEK A;  4DR1 E;  4NXM E;  4B3M E;  4JI0 I;  1Z5C A;  2E5L I;  1Z0B A;  4JI1 E;  5GMD A;  1FKA E;  3WU6 A;  4DV4 I;  4LF9 I;  4DV6 I;  2UXD E;  2A2C A;  4LFC E;  4LFB I;  1IBK E;  4DUZ I;  2X36 A;  4DU8 A;  2UUC I;  4XTJ A;  4LF7 I;  4NXN E;  4B3T E;  4DR5 E;  3ZM7 A;  4UT4 A;  2UUC E;  1HNX I;  2BM1 A;  5BR8 E;  3J7A M;  3J81 Q;  4DV6 E;  1FWK A;  4DPX A;  4PRV A;  4PU9 A;  1MG7 A;  4JV5 E;  4DV4 E;  4KHP I;  4JI7 I;  1N34 I;  1HNZ I;  1H7S A;  3J81 C;  1DAR A;  1N0V C;  2UXD I;  2HK3 A;  4DV0 I;  4PRX A;  4X64 E;  1FJG I;  1XMO I;  1IBM I;  3M6A A;  2X7I A;  3V2U C;  1FJG E;  3B8H A;  4DV3 E;  4LFA E;  4MYU A;  3ZZU A;  1N0U A;  1IBL I;  4YY3 E;  3K1J A;  2UUB E;  3T1H I;  4K0K E;  3QT5 A;  2OI2 A;  4JI4 I;  4YHH I;  2UUA I;  1H7U A;  4X64 I;  1VIS A;  4UTG A;  4X66 I;  2ZM6 E;  3ZKD A;  1FWL A;  4LF5 E;  4JI8 I;  2VQF I;  2V2V A;  3F0N A;  1Z0C A;  4URL A;  4HAC A;  4DR7 E;  2VQE I;  1N32 E;  4OX9 E;  1PIE A;  3B78 A;  1N33 E;  1MX0 A;  4RPF A;  1XNR I;  2UXC E;  3LPS A;  4Z7C A;  2F4V E;  3PYF A;  4NXN I;  1Z5A A;  2A2D A;  3J80 Q;  4DU7 A;  1KKH A;  2F4V I;  4X62 E;  4DR6 I;  2UXC I;  1B63 A;  1PKP A;  1N32 I;  1FI4 A;  3Q1Q A;  4R1F A;  4DR7 I;  4YY3 I;  1KVK A;  2E5L E;  4USM A;  2V8P A;  2HHH E;  4DR4 E;  1IBM E;  4JI1 I;  3QT7 A;  4K0K I;  1Z0V A;  3ZKB A;  4B3R E;  1Z5B A;  4DR1 I;  4GKJ I;  1XNQ E;  4B3R I;  2UU9 E;  2HHH I;  4DXL A;  5LMN I;  4GKK I;  4FWD A;  4P52 A;  1XMO E;  5IWA I;  4HXZ A;  4JI3 I;  1N36 E;  3D4J A;  4DPW A;  1ZM4 A;  1I94 E;  4DR3 I;  1Z0E A;  3J7A G;  4KQV A;  3PYD A;  1HNX E;  3HUL A;  1H74 A;  1B62 A;  4DV1 E;  4KHP E;  3OTO I;  2V2Z A;  1K47 A;  3LTO A;  2HFU A;  2BM0 A;  4AQY E;  4LF8 I;  2E1R A;  2HK2 A;  1RRE A;  1NHH A;  2Q2E B;  4DUZ E;  1XNR E;  1N33 I;  4WUC A;  4LFC I;  2HKE A;  2R3V A;  4JI6 E;  2DEI A;  4DR5 I;  3GON A;  4DR2 I;  3QT6 A;  1D6T A;  4FWH A;  1I94 I;  5IT9 C;  2EFG A;  4JG4 A;  4FW9 A;  4LF6 I;  1U2R A;  5LMU E;  3QT8 A;  1NHI A;  1HNW I;  1IBL E;  4LF4 E;  3LNU A;  1Z0G A;  1J5E I;  5FLX C;  2LJP A;  4DPU A;  4JI2 E;  4X65 I;  2HKJ A;  3T1Y I;  4FWG A;  2AJ4 A;  4JYA E;  4DV0 E;  4DUY I;  4DPT A;  1S16 A;  3ZZT A;  1S4E A;  1A6F A;  1ZXM A;  1HNW E;  4DR2 E;  1HNZ E;  4HAC B;  3J80 C;  1N34 E;  2DEJ A;  3JAM Q;  2XEX A;  3CWV A;  4B3S I;  5GME A;  3WU3 A;  4DV5 E;  1FNM A;  2V34 A;  1XMQ I;  4DV2 E;  4DV7 E;  1Z0W A;  1XMQ E;  4AQY I;  4DV5 I;  2BV3 A;  4HYM A;  1NHJ A;  2UXB I;  4OX9 I;  4HY1 A;  4B3T I;  1NZ0 A;  1IBK I;  3PYE A;  1XHK A;  4JI5 I;  4LF9 E;  2V2Q A;  4JI3 E;  4DV1 I;  3H4L A;  3JAM C;  4YHH E;  2UUA E;  2VF3 A;  1HR0 E;  4DR3 E;  2UU9 I;  1KIJ A;  4EMD A;  4WUB A;  4JI0 E;  3ZZ0 A;  1ELO A;  1H73 A;  4B3M I;  4JYA I;  4JI2 I;  4NXM I;  1N36 I;  4LFA I;  2NPF A;  1RR9 A;  1MU5 A;  4DV3 I;  5IWA E;  3T1Y E;  1QZR A;  5LMN E;  3B82 A;  4GKK E;  1WUU A;  4ZVI A;  3WU4 A;  1J5E E;  2CZ9 A;  1XNQ I;  5LL6 R;  4LF4 I;  2HFS A;  4JI5 E;  4USK A;  2WW4 A;  2ZBK B;  3PYG A;  1HR0 I;  5A2Q Q;  4DR4 I;  1KTV A;  4LF6 E;  4JI7 E;  4JV5 I; 
#chains in the Genus database with same CATH topology
 1PVG A;  1ZM3 A;  3V5R A;  3P3C A;  4DR6 E;  1BKN A;  5JEA A;  4OO1 E;  4ED4 A;  1YH8 A;  4P7A A;  5BR8 I;  5IT9 Q;  4JI6 I;  2JEB A;  4IFD B;  3GLL A;  2UXB E;  4MYT A;  2GS8 A;  1Y5Y A;  2IOQ A;  4M1K A;  3OTO E;  1EI1 A;  4X62 I;  2J7K A;  4J3D A;  4DV2 I;  4DV7 I;  1Z0T A;  4LF7 E;  2WNR A;  3GCM A;  1H72 C;  4LF8 E;  4FN5 A;  1EA6 A;  1Z59 A;  4LFB E;  4DPY A;  5FLX Q;  2VQF E;  4LF5 I;  4B3S E;  1OJ4 A;  4N3O A;  4DUY E;  3PS3 A;  1ZM2 A;  3WU5 A;  4MU4 A;  4Z7Y A;  3DD6 A;  1ZM9 A;  2VQE E;  3T1H E;  2UUB I;  5L3J A;  4X65 E;  4WUD A;  4IFD F;  4JI8 E;  3K17 A;  4LCG A;  4X66 E;  1ZXN A;  2ZM6 I;  2ZIT A;  4I3H A;  5JEA D;  2O3Z A;  4JI4 E;  5A2Q C;  2IOP A;  5LMU I;  2PO2 B;  3P3G A;  4U3B A;  4GKJ E;  2R42 A;  1UEK A;  4DR1 E;  4NXM E;  5DRQ A;  4B3M E;  4JI0 I;  1Z5C A;  2E5L I;  4MU3 A;  5JEA C;  1Z0B A;  4JI1 E;  5GMD A;  1FKA E;  4MQY A;  3WU6 A;  2PNL A;  2JT2 A;  4DV4 I;  5EKW A;  4BA1 A;  4LF9 I;  4BA1 B;  5C0X F;  2C37 A;  4DV6 I;  2UXD E;  2A2C A;  4LCF A;  4LFC E;  4LFB I;  1IBK E;  4DUZ I;  2X36 A;  2O1T A;  4DU8 A;  2UUC I;  4XTJ A;  4LF7 I;  4NXN E;  4B3T E;  4NBQ A;  4FW7 A;  4DR5 E;  2J65 A;  5DNL A;  2PO1 B;  1RHY A;  3ZM7 A;  4UT4 A;  2UUC E;  1HNX I;  2C38 B;  2BM1 A;  5BR8 E;  3M85 G;  3J7A M;  3J81 Q;  4DV6 E;  1FWK A;  4DPX A;  4PRV A;  4PU9 A;  1MG7 A;  4JV5 E;  3M85 D;  4DV4 E;  3NZK A;  4KHP I;  4JI7 I;  1OYP A;  1N34 I;  1HNZ I;  2PNZ B;  2BR2 B;  1H7S A;  4IZK A;  4IZJ D;  3PS2 A;  3K85 A;  3J81 C;  2PO0 B;  2NN6 A;  1DAR A;  1N0V C;  5K36 C;  2UXD I;  1E3P A;  2HK3 A;  4DV0 I;  5JEA E;  4OO1 A;  4PRX A;  4X64 E;  5DNX A;  2PNM A;  5C0X A;  1FJG I;  1XMO I;  2O1W A;  1IBM I;  3M6A A;  2NN6 C;  2X7I A;  5DRR A;  5K36 F;  2IES A;  3V2U C;  1FJG E;  3B8H A;  2C37 B;  4DV3 E;  4LFA E;  4MYU A;  5JEA F;  3ZZU A;  1N0U A;  4MDT A;  1IBL I;  4YY3 E;  3K1J A;  1USU A;  2UUB E;  3T1H I;  2Z5C A;  4K0K E;  2PO2 A;  2GO4 A;  3QT5 A;  1Y60 A;  2OI2 A;  4JI4 I;  4AID A;  4YHH I;  2UUA I;  3PS1 A;  1H7U A;  4X64 I;  1VIS A;  4UTG A;  4X66 I;  2ZM6 E;  3ZKD A;  1FWL A;  4OO1 B;  1HK7 A;  4LF5 E;  4JI8 I;  2VQF I;  1VI7 A;  2V2V A;  3F0N A;  4OZE A;  1Z0C A;  4URL A;  2WP8 A;  4HAC A;  4DR7 E;  2VQE I;  3L7Z B;  4OO1 C;  1N32 E;  4IS9 A;  4OX9 E;  1PIE A;  4AM3 A;  3U1K A;  3Q6M A;  3B78 A;  1N33 E;  2O1U A;  1MX0 A;  4RPF A;  1XNR I;  2UXC E;  3LPS A;  4Z7C A;  2F4V E;  3PYF A;  3UHM A;  4NXN I;  1Z5A A;  2A2D A;  3J80 Q;  4DU7 A;  1KKH A;  2F4V I;  3CDI A;  4X62 E;  1Y6Z A;  4DR6 I;  2UXC I;  4ISA A;  1B63 A;  5C0X C;  1PKP A;  4OKG A;  5K36 E;  1N32 I;  2O1V A;  1FI4 A;  5K36 A;  5FWK A;  3Q1Q A;  4R1F A;  4FW5 A;  4DR7 I;  4YY3 I;  1KVK A;  5C0X B;  2E5L E;  2IER A;  4USM A;  2V8P A;  4BA2 B;  3CDJ A;  2HHH E;  4DR4 E;  1IBM E;  2NN6 D;  4JI1 I;  3QT7 A;  4K0K I;  1Z0V A;  3ZKB A;  4B3R E;  1Z5B A;  2C39 A;  4DR1 I;  1YHC A;  4GKJ I;  1XNQ E;  2PO0 A;  4B3R I;  2UU9 E;  2JEA A;  2Z5B B;  4IFD C;  2AE8 A;  4FW6 A;  2HHH I;  4DXL A;  5LMN I;  4GKK I;  4FWD A;  2BA0 G;  4P52 A;  1XMO E;  5IWA I;  4HXZ A;  2BA1 G;  1N36 E;  4JI3 I;  2PO1 A;  3D4J A;  4DPW A;  1ZM4 A;  1I94 E;  4IZJ B;  4DR3 I;  3HJC A;  1Z0E A;  4U3D A;  4KQV A;  3J7A G;  3PYD A;  1Y4S A;  1R6L A;  1HNX E;  2WP8 B;  3HUL A;  1UDO A;  1H74 A;  4IZJ A;  1B62 A;  2JE6 A;  5C0X E;  4DV1 E;  4KHP E;  3H1C A;  2V2Z A;  3OTO I;  1K47 A;  3LTO A;  2HFU A;  2BM0 A;  4AQY E;  4LF8 I;  2E1R A;  2HK2 A;  3P76 A;  1UDS A;  5K36 B;  3PRY A;  1RRE A;  1NHH A;  2Q2E B;  4BA2 A;  4DUZ E;  1XNR E;  5JEA B;  1N33 I;  4WUC A;  4LFC I;  2JEA B;  3M7N G;  2HKE A;  2R3V A;  1P42 A;  2JEB B;  4LOM A;  4QNJ A;  4JI6 E;  2DEI A;  4DR5 I;  3Q6N A;  4FW3 A;  3GON A;  4IZK B;  4DR2 I;  4OO1 F;  2Z5B A;  3QT6 A;  3P06 A;  1D6T A;  4FWH A;  2GQ0 A;  1I94 I;  5IT9 C;  3HKM A;  2EFG A;  4JG4 A;  4IFD E;  4FW9 A;  4LF6 I;  4MU1 A;  2VES A;  1U2R A;  4AIM A;  5LMU E;  3QT8 A;  1NHI A;  1HNW I;  5EL9 A;  4FW4 A;  1IBL E;  3M7N D;  3B4T A;  4LF4 E;  3LNU A;  1Z0G A;  5ELW A;  1J5E I;  5FLX C;  2LJP A;  5DRP A;  4IFD D;  4DPU A;  1USV A;  2JE6 B;  4JI2 E;  2NN6 F;  4X65 I;  2C38 A;  2HKJ A;  1Y4U A;  3T1Y I;  4FWG A;  2AJ4 A;  3GME A;  2C39 B;  4JYA E;  4DV0 E;  4DUY I;  4DPT A;  2F1D A;  4QNK A;  1S16 A;  4IFD A;  3ZZT A;  2CG9 A;  1S4E A;  1A6F A;  2WNR B;  1ZXM A;  1HNW E;  4DR2 E;  3L7Z A;  1HNZ E;  4HAC B;  3J80 C;  1N34 E;  2DEJ A;  3JAM Q;  2XEX A;  1UDQ A;  4LPF A;  3CWV A;  4B3S I;  5GME A;  3WU3 A;  4DV5 E;  2GO3 A;  3U1Y A;  5C0X D;  1FNM A;  2V34 A;  1XMQ I;  4DV2 E;  4DV7 E;  2Z5C B;  1Z0W A;  1XMQ E;  4AQY I;  4GQU A;  4DV5 I;  2BV3 A;  4HYM A;  1NHJ A;  2NN6 B;  2UXB I;  4OX9 I;  4HY1 A;  4B3T I;  1NZ0 A;  2BR2 A;  2CVE A;  2BA0 D;  1IBK I;  3PYE A;  1XHK A;  2CGE A;  4JI5 I;  4LF9 E;  2V2Q A;  4JI3 E;  1OYS A;  4DV1 I;  3H4L A;  3JAM C;  4OO1 D;  4YHH E;  2UUA E;  2VF3 A;  2PNZ A;  4DR3 E;  1HR0 E;  2NN6 E;  2UU9 I;  1KIJ A;  4EMD A;  4WUB A;  4JI0 E;  3ZZ0 A;  1ELO A;  1H73 A;  4B3M I;  4JYA I;  4JI2 I;  4NXM I;  3KRN A;  1N36 I;  4LCH A;  4LFA I;  2NPF A;  1RR9 A;  1MU5 A;  4DV3 I;  5IWA E;  3T1Y E;  1UDN A;  1QZR A;  5LMN E;  3B82 A;  3P3E A;  4GKK E;  1WUU A;  2BA1 D;  4ZVI A;  3WU4 A;  1J5E E;  2CZ9 A;  1XNQ I;  5LL6 R;  4LF4 I;  5K36 D;  1OYR A;  2HFS A;  4JI5 E;  4USK A;  5DRO A;  2WW4 A;  4MU0 A;  2ZBK B;  3PYG A;  1R6M A;  1HR0 I;  5A2Q Q;  4DR4 I;  1XXE A;  1KTV A;  4LF6 E;  4JI7 E;  1E3H A;  2Z5E A;  4JV5 I; 
#chains in the Genus database with same CATH homology
 1PVG A;  1ZM3 A;  3V5R A;  4DR6 E;  1BKN A;  4ED4 A;  4P7A A;  5BR8 I;  5IT9 Q;  4JI6 I;  2UXB E;  4MYT A;  2GS8 A;  2IOQ A;  4M1K A;  3OTO E;  1EI1 A;  4X62 I;  2J7K A;  4DV2 I;  4DV7 I;  1Z0T A;  4LF7 E;  4LF8 E;  1H72 C;  4FN5 A;  1EA6 A;  1Z59 A;  4LFB E;  4DPY A;  5FLX Q;  2VQF E;  4LF5 I;  4B3S E;  1OJ4 A;  4N3O A;  4DUY E;  1ZM2 A;  3WU5 A;  4Z7Y A;  1ZM9 A;  2VQE E;  3T1H E;  2UUB I;  5L3J A;  4X65 E;  4WUD A;  4JI8 E;  3K17 A;  4X66 E;  1ZXN A;  2ZM6 I;  2ZIT A;  4I3H A;  4JI4 E;  5A2Q C;  2IOP A;  5LMU I;  4GKJ E;  2R42 A;  1UEK A;  4DR1 E;  4NXM E;  4B3M E;  4JI0 I;  1Z5C A;  2E5L I;  1Z0B A;  4JI1 E;  5GMD A;  1FKA E;  3WU6 A;  2PNL A;  4DV4 I;  4LF9 I;  4DV6 I;  2UXD E;  2A2C A;  4LFC E;  4LFB I;  1IBK E;  4DUZ I;  2X36 A;  2O1T A;  4DU8 A;  2UUC I;  4XTJ A;  4LF7 I;  4NXN E;  4B3T E;  4DR5 E;  3ZM7 A;  4UT4 A;  2UUC E;  1HNX I;  2BM1 A;  5BR8 E;  3J7A M;  3J81 Q;  4DV6 E;  1FWK A;  4DPX A;  4PRV A;  4PU9 A;  1MG7 A;  4JV5 E;  4DV4 E;  4KHP I;  4JI7 I;  1N34 I;  1HNZ I;  1H7S A;  4IZK A;  4IZJ D;  3K85 A;  3J81 C;  1DAR A;  1N0V C;  2UXD I;  2HK3 A;  4DV0 I;  4PRX A;  4X64 E;  2PNM A;  1FJG I;  1XMO I;  2O1W A;  1IBM I;  3M6A A;  2X7I A;  3V2U C;  1FJG E;  3B8H A;  4DV3 E;  4LFA E;  4MYU A;  3ZZU A;  1N0U A;  1IBL I;  4YY3 E;  3K1J A;  1USU A;  2UUB E;  3T1H I;  2Z5C A;  4K0K E;  3QT5 A;  2OI2 A;  4JI4 I;  4YHH I;  2UUA I;  1H7U A;  4X64 I;  1VIS A;  4UTG A;  4X66 I;  2ZM6 E;  3ZKD A;  1FWL A;  1HK7 A;  4LF5 E;  4JI8 I;  2VQF I;  2V2V A;  3F0N A;  1Z0C A;  4URL A;  4HAC A;  4DR7 E;  2VQE I;  1N32 E;  4OX9 E;  1PIE A;  3Q6M A;  3B78 A;  1N33 E;  2O1U A;  1MX0 A;  4RPF A;  1XNR I;  2UXC E;  3LPS A;  4Z7C A;  2F4V E;  3PYF A;  4NXN I;  1Z5A A;  2A2D A;  3J80 Q;  4DU7 A;  1KKH A;  2F4V I;  4X62 E;  1Y6Z A;  4DR6 I;  2UXC I;  1B63 A;  1PKP A;  1N32 I;  2O1V A;  1FI4 A;  5FWK A;  3Q1Q A;  4R1F A;  4DR7 I;  4YY3 I;  1KVK A;  2E5L E;  4USM A;  2V8P A;  2HHH E;  4DR4 E;  1IBM E;  4JI1 I;  3QT7 A;  4K0K I;  1Z0V A;  3ZKB A;  4B3R E;  1Z5B A;  4DR1 I;  4GKJ I;  1XNQ E;  4B3R I;  2UU9 E;  2Z5B B;  2HHH I;  4DXL A;  5LMN I;  4GKK I;  4FWD A;  4P52 A;  1XMO E;  5IWA I;  4HXZ A;  4JI3 I;  1N36 E;  3D4J A;  4DPW A;  1ZM4 A;  1I94 E;  4IZJ B;  4DR3 I;  3HJC A;  1Z0E A;  3J7A G;  4KQV A;  3PYD A;  1Y4S A;  1HNX E;  3HUL A;  1H74 A;  4IZJ A;  1B62 A;  4DV1 E;  4KHP E;  3OTO I;  2V2Z A;  1K47 A;  3LTO A;  2HFU A;  2BM0 A;  4AQY E;  4LF8 I;  2E1R A;  2HK2 A;  3PRY A;  1RRE A;  1NHH A;  2Q2E B;  4DUZ E;  1XNR E;  1N33 I;  4WUC A;  4LFC I;  2HKE A;  2R3V A;  4JI6 E;  2DEI A;  4DR5 I;  3Q6N A;  4IZK B;  3GON A;  4DR2 I;  2Z5B A;  3QT6 A;  3P06 A;  1D6T A;  4FWH A;  2GQ0 A;  1I94 I;  5IT9 C;  2EFG A;  4JG4 A;  4FW9 A;  4LF6 I;  1U2R A;  5LMU E;  3QT8 A;  1NHI A;  1HNW I;  1IBL E;  4LF4 E;  3LNU A;  1Z0G A;  1J5E I;  5FLX C;  2LJP A;  4DPU A;  1USV A;  4JI2 E;  4X65 I;  2HKJ A;  1Y4U A;  3T1Y I;  4FWG A;  2AJ4 A;  4JYA E;  4DV0 E;  4DUY I;  4DPT A;  1S16 A;  3ZZT A;  2CG9 A;  1S4E A;  1A6F A;  1ZXM A;  1HNW E;  4DR2 E;  1HNZ E;  4HAC B;  3J80 C;  1N34 E;  2DEJ A;  3JAM Q;  2XEX A;  3CWV A;  4B3S I;  5GME A;  3WU3 A;  4DV5 E;  1FNM A;  2V34 A;  1XMQ I;  4DV2 E;  4DV7 E;  2Z5C B;  1Z0W A;  1XMQ E;  4AQY I;  4DV5 I;  2BV3 A;  4HYM A;  1NHJ A;  2UXB I;  4OX9 I;  4HY1 A;  4B3T I;  1NZ0 A;  1IBK I;  3PYE A;  1XHK A;  2CGE A;  4JI5 I;  4LF9 E;  2V2Q A;  4JI3 E;  4DV1 I;  3H4L A;  3JAM C;  4YHH E;  2UUA E;  2VF3 A;  1HR0 E;  4DR3 E;  2UU9 I;  1KIJ A;  4EMD A;  4WUB A;  4JI0 E;  3ZZ0 A;  1ELO A;  1H73 A;  4B3M I;  4JYA I;  4JI2 I;  4NXM I;  1N36 I;  4LFA I;  2NPF A;  1RR9 A;  1MU5 A;  4DV3 I;  5IWA E;  3T1Y E;  1QZR A;  5LMN E;  3B82 A;  4GKK E;  1WUU A;  4ZVI A;  3WU4 A;  1J5E E;  2CZ9 A;  1XNQ I;  5LL6 R;  4LF4 I;  2HFS A;  4JI5 E;  4USK A;  2WW4 A;  2ZBK B;  3PYG A;  1HR0 I;  5A2Q Q;  4DR4 I;  1KTV A;  4LF6 E;  4JI7 E;  2Z5E A;  4JV5 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...