1HR0I

Crystal structure of initiation factor if1 bound to the 30s ribosomal subunit
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGRFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Crystal structure of an initiation factor bound to the 30S ribosomal subunit.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ribosome
total genus 31
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2000-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1hr0I00
4DR3I 5A2QC 5LMNI 4KQVA 1N34I 1FWKA 1MU5A 4X62I 5IWAE 1ZM9A 3GONA 4DR2I 4DV3E 1NHJA 3LTOA 1H72C 1MG7A 4LF9I 1ELOA 4HACA 4DV1E 3K1JA 3JAMC 3OTOI 4PU9A 3Q1QA 2E5LI 5FLXQ 4JI4I 2ZITA 1I94E 3J7AG 1Z59A 2UUBE 2R42A 2V8PA 2EFGA 4URLA 1PKPA 2XEXA 4Z7CA 4B3SE 1Z5CA 4DPXA 4DUZE 1BKNA 4JYAI 2E1RA 4EMDA 1U2RA 4Z7YA 1EI1A 1N34E 1Z0VA 2HK2A 4X62E 4LF6I 4LF7I 1H7UA 3JAMQ 2GS8A 1N36I 4NXME 3OTOE 4I3HA 3ZZUA 1PIEA 2ZM6I 2UXCI 4FWHA 2E5LE 1Z0EA 2X7IA 1IBMI 4DPUA 4B3RI 1XMQE 1HR0I 4HY1A 4X66E 1MX0A 2V2QA 3PYGA 2BV3A 2F4VI 2VQFE 1HNWI 4JI7E 4P7AA 3J81C 2UXBI 1FJGE 1N33E 3H4LA 3T1YE 4K0KE 4UTGA 2BM0A 4JI2E 3LPSA 2DEIA 4HXZA 2V34A 4UT4A 4GKKI 1S4EA 1UEKA 4JI0I 4LFCI 4JI6I 1XMOE 1NHIA 4LF7E 3V5RA 4DR5I 5LMUI 4USMA 3QT7A 4B3TE 3QT5A 5IT9C 2UUAI 4OX9I 1Z0TA 1OJ4A 2UXCE 4DV4I 5BR8I 4JI5I 1FKAE 4B3RE 5GMEA 2UU9I 4DR7E 1ZM3A 3V2UC 5L3JA 4JI1I 3J80Q 3PYEA 2F4VE 1HNWE 1IBLI 1ZXMA 3ZKDA 1NZ0A 3T1HI 4YHHE 2UXBE 4JG4A 4DR6E 4GKJI 4DV6I 4XTJA 1KIJA 1N32I 1B62A 4LF5E 4JI0E 4JI6E 1Z5BA 4YY3E 3HULA 4DR5E 5IT9Q 5LMUE 4JV5E 4WUDA 1Z5AA 4DUYI 5A2QQ 4LFBI 4FWGA 4OX9E 2HFUA 4DR3E 4MYUA 4LFAI 5LMNE 4X65I 4DV4E 5BR8E 1S16A 4DR2E 1ZM4A 1KTVA 2UU9E 4DV0I 1FI4A 3M6AA 4LF9E 4DR1I 4ZVIA 4LF8I 4X64I 5GMDA 1Z0GA 4B3MI 4PRXA 1J5EI 2V2VA 4DV7I 3B8HA 4GKJE 4JI4E 1XHKA 2UXDI 4R1FA 4DU7A 1RR9A 1IBKI 1KKHA 1EA6A 3D4JA 4PRVA 3PYFA 1KVKA 4RPFA 4MYTA 4DPYA 4DUYE 2VQEI 5IWAI 4JYAE 4DV3I 4JI3I 1WUUA 3ZZ0A 4LFAE 2CZ9A 4WUCA 4DV1I 4X65E 4USKA 4FN5A 4LF6E 3ZZTA 1ZXNA 1Z0CA 4DV0E 1DARA 4DR1E 1N36E 3WU4A 3B82A 4X64E 2UUBI 2HKJA 4DR4I 4B3ME 2ZM6E 4DV5I 1J5EE 4P52A 1IBME 1XNRI 1HR0E 2J7KA 4DUZI 4JI8I 3J81Q 1HNZI 4FWDA 1XNQI 1Z0BA 3WU5A 2V2ZA 2NPFA 2VQEE 4JI3E 4WUBA 2A2DA 1N0VC 4GKKE 4LFCE 4LF4I 3PYDA 4NXMI 3QT8A 4NXNI 4DPWA 1HNXI 2AJ4A 4AQYI 1B63A 2HFSA 1ZM2A 4HACB 4DU8A 2UUAE 1FNMA 1XMQI 4DR4E 4X66I 4DV5E 4KHPI 3LNUA 3ZKBA 2DEJA 1XNRE 4HYMA 2R3VA 4JI5E 2VQFI 4JI7I 4DXLA 1FJGI 2UUCI 1N33I 2Q2EB 3T1YI 4K0KI 4JI8E 4DV2I 2HHHI 1HNZE 2LJPA 1K47A 4JI1E 4JI2I 1XNQE 4FW9A 2A2CA 1IBLE 3T1HE 4ED4A 1XMOI 1PVGA 4DV6E 3WU3A 1N0UA 1N32E 2X36A 5LL6R 1H7SA 4LF4E 4B3TI 4DPTA 1HNXE 4NXNE 1QZRA 3K17A 4AQYE 1Z0WA 2BM1A 4LFBE 1VISA 4DR7I 3ZM7A 4KHPE 3WU6A 3CWVA 1FWLA 4YHHI 2UUCE 1A6FA 4DR6I 3J80C 1H74A 3QT6A 2OI2A 3F0NA 4DV2E 1I94I 2HHHE 4LF8E 5FLXC 1RREA 1H73A 2ZBKB 4LF5I 3J7AM 4DV7E 4YY3I 2UXDE 4M1KA 4B3SI 2WW4A 2HKEA 3B78A 4JV5I 2HK3A 1IBKE 1D6TA 1NHHA 2VF3A
chains in the Genus database with same CATH superfamily
4DR3I 5A2QC 5LMNI 3U1YA 4KQVA 1N34I 1FWKA 1MU5A 4X62I 5IWAE 1ZM9A 1R6LA 3GONA 5JEAF 4DV3E 1NHJA 3LTOA 4DR2I 1H72C 1Y4UA 1MG7A 2C38A 2O1WA 4LF9I 4IZJD 1ELOA 4OZEA 4HACA 4DV1E 3K1JA 3JAMC 3OTOI 4IS9A 4PU9A 3Q1QA 3M85D 2E5LI 4FW3A 2WNRA 5JEAE 2JT2A 5FLXQ 4OO1A 4JI4I 2ZITA 3H1CA 3L7ZA 1I94E 3J7AG 1Z59A 2UUBE 2R42A 1USVA 2V8PA 2NN6A 2BR2A 3P3EA 5K36C 5DRPA 2EFGA 4QNKA 4URLA 1PKPA 2XEXA 4Z7CA 4B3SE 5DNLA 1Z5CA 4DPXA 2CVEA 2PNZA 4DUZE 1BKNA 4JYAI 3M7ND 1HK7A 2E1RA 4EMDA 1U2RA 2Z5BA 4Z7YA 4IFDB 1EI1A 4IZKA 1N34E 1Z0VA 2HK2A 4X62E 4LF6I 4MU1A 4LF7I 1H7UA 3JAMQ 5C0XB 1YHCA 2NN6D 4OO1C 1UDSA 4GQUA 2GS8A 1N36I 1E3PA 4NXME 3OTOE 4I3HA 3M85G 3P3CA 4IFDD 3ZZUA 1PIEA 2ZM6I 2UXCI 3Q6NA 4FWHA 4LCHA 2E5LE 1Z0EA 2X7IA 5FWKA 1IBMI 4DPUA 4B3RI 2Z5CB 1XMQE 1HR0I 4HY1A 4FW6A 4X66E 3HJCA 1MX0A 2PNLA 4OKGA 4MU4A 1OYSA 1UDOA 3U1KA 2CGEA 2PNMA 2V2QA 4BA2A 3PYGA 2BV3A 2F4VI 2VQFE 1HNWI 4JI7E 4P7AA 4LCFA 3J81C 2JEAB 2UXBI 1FJGE 1N33E 3M7NG 3H4LA 3T1YE 4K0KE 1Y60A 4UTGA 2BM0A 1XXEA 4JI2E 3LPSA 2DEIA 3NZKA 4HXZA 2V34A 4BA1B 4UT4A 4GKKI 1S4EA 1UEKA 4IZJA 4JI0I 4LFCI 4JI6I 1XMOE 5DNXA 1NHIA 3HKMA 4LF7E 3V5RA 4DR5I 2CG9A 5LMUI 4USMA 3QT7A 1Y6ZA 1RHYA 2IESA 1OYRA 3CDJA 4LPFA 4B3TE 3QT5A 5IT9C 2UUAI 4OX9I 1P42A 4U3BA 1Z0TA 2JEBB 1OJ4A 2UXCE 3GMEA 5JEAB 2VESA 4DV4I 2PO2B 5BR8I 4JI5I 1FKAE 4B3RE 5GMEA 2UU9I 4DR7E 1ZM3A 3V2UC 3PS1A 5L3JA 4JI1I 3J80Q 3PYEA 2F4VE 1HNWE 1IBLI 1ZXMA 3ZKDA 1NZ0A 3T1HI 4YHHE 2UXBE 4JG4A 4DR6E 4GKJI 1E3HA 2JE6B 5DRRA 2BA1D 2O1TA 4DV6I 4LCGA 2PO1B 4XTJA 1KIJA 1N32I 1B62A 5K36F 4LF5E 4JI0E 4JI6E 1VI7A 1Z5BA 2O1UA 4YY3E 3HULA 4DR5E 4IFDA 5IT9Q 5LMUE 4JV5E 4WUDA 1Z5AA 4DUYI 2WP8B 5A2QQ 5C0XA 4LFBI 4FWGA 2PO0B 4OX9E 5K36E 2HFUA 4DR3E 4MYUA 4LFAI 5LMNE 4X65I 4DV4E 4FW7A 2GQ0A 5BR8E 1S16A 4DR2E 1ZM4A 3PRYA 1KTVA 2UU9E 4OO1F 4DV0I 1FI4A 3P76A 4N3OA 3M6AA 4LF9E 4FW5A 4DR1I 4ZVIA 2Z5CA 1Y5YA 4LF8I 2NN6C 5GMDA 2NN6F 4X64I 1Z0GA 4B3MI 4PRXA 1J5EI 2V2VA 2BA1G 2C37B 4DV7I 3B8HA 2GO4A 3PS3A 4JI4E 4GKJE 5C0XD 1XHKA 2UXDI 4IFDC 4R1FA 3Q6MA 4DU7A 4MU3A 4IFDF 5EL9A 4OO1E 2JEAA 1RR9A 5C0XC 2NN6E 1IBKI 1KKHA 1EA6A 3D4JA 4BA1A 4PRVA 3PYFA 1KVKA 4U3DA 4RPFA 4MYTA 4DPYA 4DUYE 2VQEI 5IWAI 4JYAE 4DV3I 4JI3I 1WUUA 3ZZ0A 4LFAE 1UDNA 2CZ9A 3B4TA 4WUCA 4X65E 4DV1I 4USKA 4FN5A 4LF6E 2JEBA 3ZZTA 1ZXNA 5JEAA 1Z0CA 4DV0E 2PO2A 2BA0D 1DARA 4DR1E 1N36E 3WU4A 3B82A 4X64E 1OYPA 2UUBI 4AM3A 2HKJA 4DR4I 4B3ME 5DRQA 2ZM6E 4DV5I 1J5EE 4P52A 2C39B 2Z5EA 1IBME 1XNRI 4QNJA 1HR0E 2JE6A 2J7KA 2PO1A 4DUZI 4JI8I 3J81Q 1HNZI 4FWDA 1XNQI 1Z0BA 5JEAD 2GO3A 3WU5A 4LOMA 2IERA 2V2ZA 2NPFA 2VQEE 5JEAC 3P06A 4JI3E 1Y4SA 4WUBA 5K36B 2A2DA 1N0VC 4GKKE 3K85A 2WP8A 4LFCE 4LF4I 2PO0A 3PYDA 4NXMI 3QT8A 4NXNI 4DPWA 1HNXI 2AJ4A 2BA0G 3GLLA 4AQYI 2C38B 1B63A 5K36D 2HFSA 1ZM2A 4HACB 4DU8A 2F1DA 2AE8A 2UUAE 1FNMA 1XMQI 2O3ZA 4DR4E 3GCMA 2J65A 3P3GA 4X66I 4DV5E 4KHPI 3LNUA 5EKWA 3ZKBA 2WNRB 2DEJA 4OO1B 1XNRE 4HYMA 2R3VA 3L7ZB 4JI5E 2VQFI 4JI7I 2C37A 4DXLA 4MDTA 1FJGI 2UUCI 1N33I 2NN6B 2BR2B 2Q2EB 2O1VA 3T1YI 4K0KI 4JI8E 4DV2I 2HHHI 1HNZE 2LJPA 1K47A 4JI1E 4JI2I 1XNQE 4FW9A 2A2CA 1IBLE 3T1HE 4OO1D 4ISAA 4ED4A 1XMOI 1PVGA 4DV6E 2PNZB 4MQYA 3WU3A 1N0UA 3CDIA 1N32E 2X36A 4NBQA 5C0XF 5LL6R 2Z5BB 1H7SA 4LF4E 4B3TI 4IZKB 4DPTA 1HNXE 4NXNE 1QZRA 4MU0A 3DD6A 3K17A 4AQYE 4IFDE 1Z0WA 5DROA 2BM1A 4AIMA 1YH8A 4LFBE 5C0XE 1VISA 4DR7I 3ZM7A 1USUA 4FW4A 4KHPE 3WU6A 3KRNA 3CWVA 3PS2A 4AIDA 1R6MA 1FWLA 2C39A 4YHHI 2UUCE 1A6FA 4DR6I 3J80C 1H74A 3QT6A 2OI2A 3F0NA 4DV2E 1I94I 2HHHE 4LF8E 5ELWA 5FLXC 4BA2B 1RREA 1H73A 2ZBKB 4LF5I 3J7AM 4DV7E 3UHMA 4YY3I 2UXDE 4M1KA 2IOPA 4B3SI 1UDQA 2IOQA 2WW4A 2HKEA 3B78A 4JV5I 4J3DA 2HK3A 4IZJB 1IBKE 5K36A 1D6TA 1NHHA 2VF3A
chains in the Genus database with same CATH topology
4DR3I 5A2QC 5LMNI 4KQVA 1N34I 1FWKA 1MU5A 4X62I 5IWAE 1ZM9A 3GONA 4DR2I 4DV3E 1NHJA 3LTOA 1H72C 1Y4UA 1MG7A 2O1WA 4LF9I 4IZJD 1ELOA 4HACA 4DV1E 3K1JA 3JAMC 3OTOI 4PU9A 3Q1QA 2E5LI 5FLXQ 4JI4I 2ZITA 1I94E 3J7AG 1Z59A 2UUBE 2R42A 1USVA 2V8PA 2EFGA 4URLA 1PKPA 2XEXA 4Z7CA 4B3SE 1Z5CA 4DPXA 4DUZE 1BKNA 4JYAI 1HK7A 2E1RA 4EMDA 1U2RA 2Z5BA 4Z7YA 1EI1A 4IZKA 1N34E 1Z0VA 2HK2A 4X62E 4LF6I 4LF7I 1H7UA 3JAMQ 2GS8A 1N36I 4NXME 3OTOE 4I3HA 3ZZUA 1PIEA 2ZM6I 2UXCI 3Q6NA 4FWHA 2E5LE 1Z0EA 2X7IA 5FWKA 1IBMI 4DPUA 4B3RI 2Z5CB 1XMQE 1HR0I 4HY1A 4X66E 3HJCA 1MX0A 2PNLA 2CGEA 2PNMA 2V2QA 3PYGA 2BV3A 2F4VI 2VQFE 1HNWI 4JI7E 4P7AA 3J81C 2UXBI 1FJGE 1N33E 3H4LA 3T1YE 4K0KE 4UTGA 2BM0A 4JI2E 3LPSA 2DEIA 4HXZA 2V34A 4UT4A 4GKKI 1S4EA 1UEKA 4IZJA 4JI0I 4LFCI 4JI6I 1XMOE 1NHIA 4LF7E 3V5RA 4DR5I 2CG9A 5LMUI 4USMA 3QT7A 1Y6ZA 4B3TE 3QT5A 5IT9C 2UUAI 4OX9I 1Z0TA 1OJ4A 2UXCE 4DV4I 5BR8I 4JI5I 1FKAE 4B3RE 5GMEA 2UU9I 4DR7E 1ZM3A 3V2UC 5L3JA 4JI1I 3J80Q 3PYEA 2F4VE 1HNWE 1IBLI 1ZXMA 3ZKDA 1NZ0A 3T1HI 4YHHE 2UXBE 4JG4A 4DR6E 4GKJI 2O1TA 4DV6I 4XTJA 1KIJA 1N32I 1B62A 4LF5E 4JI0E 4JI6E 1Z5BA 2O1UA 4YY3E 3HULA 4DR5E 5IT9Q 5LMUE 4JV5E 4WUDA 1Z5AA 4DUYI 5A2QQ 4LFBI 4FWGA 4OX9E 2HFUA 4DR3E 4MYUA 4LFAI 5LMNE 4X65I 4DV4E 2GQ0A 5BR8E 1S16A 4DR2E 1ZM4A 3PRYA 1KTVA 2UU9E 4DV0I 1FI4A 3M6AA 4N3OA 4LF9E 4DR1I 4ZVIA 2Z5CA 4LF8I 4X64I 5GMDA 1Z0GA 4B3MI 4PRXA 1J5EI 2V2VA 4DV7I 3B8HA 4GKJE 4JI4E 1XHKA 2UXDI 4R1FA 3Q6MA 4DU7A 1RR9A 1IBKI 1KKHA 1EA6A 3D4JA 4PRVA 3PYFA 1KVKA 4RPFA 4MYTA 4DPYA 4DUYE 2VQEI 5IWAI 4JYAE 4DV3I 4JI3I 1WUUA 3ZZ0A 4LFAE 2CZ9A 4WUCA 4DV1I 4X65E 4USKA 4FN5A 4LF6E 3ZZTA 1ZXNA 1Z0CA 4DV0E 1DARA 4DR1E 1N36E 3WU4A 3B82A 4X64E 2UUBI 2HKJA 4DR4I 4B3ME 2ZM6E 4DV5I 1J5EE 4P52A 2Z5EA 1IBME 1XNRI 1HR0E 2J7KA 4DUZI 4JI8I 3J81Q 1HNZI 4FWDA 1XNQI 1Z0BA 3WU5A 2V2ZA 2NPFA 2VQEE 3P06A 4JI3E 1Y4SA 4WUBA 2A2DA 1N0VC 4GKKE 3K85A 4LFCE 4LF4I 3PYDA 4NXMI 3QT8A 4NXNI 4DPWA 1HNXI 2AJ4A 4AQYI 1B63A 2HFSA 1ZM2A 4HACB 4DU8A 2UUAE 1FNMA 1XMQI 4DR4E 4X66I 4DV5E 4KHPI 3LNUA 3ZKBA 2DEJA 1XNRE 4HYMA 2R3VA 4JI5E 2VQFI 4JI7I 4DXLA 1FJGI 2UUCI 1N33I 2Q2EB 2O1VA 3T1YI 4K0KI 4JI8E 4DV2I 2HHHI 1HNZE 2LJPA 1K47A 4JI1E 4JI2I 1XNQE 4FW9A 2A2CA 1IBLE 3T1HE 4ED4A 1XMOI 1PVGA 4DV6E 3WU3A 1N0UA 1N32E 2X36A 5LL6R 2Z5BB 1H7SA 4LF4E 4B3TI 4IZKB 4DPTA 1HNXE 4NXNE 1QZRA 3K17A 4AQYE 1Z0WA 2BM1A 4LFBE 1VISA 4DR7I 3ZM7A 1USUA 4KHPE 3WU6A 3CWVA 1FWLA 4YHHI 2UUCE 1A6FA 4DR6I 3J80C 1H74A 3QT6A 2OI2A 3F0NA 4DV2E 1I94I 2HHHE 4LF8E 5FLXC 1RREA 1H73A 2ZBKB 4LF5I 3J7AM 4DV7E 4YY3I 2UXDE 4M1KA 2IOPA 4B3SI 2IOQA 2WW4A 2HKEA 3B78A 4JV5I 2HK3A 4IZJB 1IBKE 1D6TA 1NHHA 2VF3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR3 I;  5A2Q C;  5LMN I;  4KQV A;  1N34 I;  1FWK A;  1MU5 A;  4X62 I;  5IWA E;  1ZM9 A;  3GON A;  4DR2 I;  4DV3 E;  1NHJ A;  3LTO A;  1H72 C;  1MG7 A;  4LF9 I;  1ELO A;  4HAC A;  4DV1 E;  3K1J A;  3JAM C;  3OTO I;  4PU9 A;  3Q1Q A;  2E5L I;  5FLX Q;  4JI4 I;  2ZIT A;  1I94 E;  3J7A G;  1Z59 A;  2UUB E;  2R42 A;  2V8P A;  2EFG A;  4URL A;  1PKP A;  2XEX A;  4Z7C A;  4B3S E;  1Z5C A;  4DPX A;  4DUZ E;  1BKN A;  4JYA I;  2E1R A;  4EMD A;  1U2R A;  4Z7Y A;  1EI1 A;  1N34 E;  1Z0V A;  2HK2 A;  4X62 E;  4LF6 I;  4LF7 I;  1H7U A;  3JAM Q;  2GS8 A;  1N36 I;  4NXM E;  3OTO E;  4I3H A;  3ZZU A;  1PIE A;  2ZM6 I;  2UXC I;  4FWH A;  2E5L E;  1Z0E A;  2X7I A;  1IBM I;  4DPU A;  4B3R I;  1XMQ E;  1HR0 I;  4HY1 A;  4X66 E;  1MX0 A;  2V2Q A;  3PYG A;  2BV3 A;  2F4V I;  2VQF E;  1HNW I;  4JI7 E;  4P7A A;  3J81 C;  2UXB I;  1FJG E;  1N33 E;  3H4L A;  3T1Y E;  4K0K E;  4UTG A;  2BM0 A;  4JI2 E;  3LPS A;  2DEI A;  4HXZ A;  2V34 A;  4UT4 A;  4GKK I;  1S4E A;  1UEK A;  4JI0 I;  4LFC I;  4JI6 I;  1XMO E;  1NHI A;  4LF7 E;  3V5R A;  4DR5 I;  5LMU I;  4USM A;  3QT7 A;  4B3T E;  3QT5 A;  5IT9 C;  2UUA I;  4OX9 I;  1Z0T A;  1OJ4 A;  2UXC E;  4DV4 I;  5BR8 I;  4JI5 I;  1FKA E;  4B3R E;  5GME A;  2UU9 I;  4DR7 E;  1ZM3 A;  3V2U C;  5L3J A;  4JI1 I;  3J80 Q;  3PYE A;  2F4V E;  1HNW E;  1IBL I;  1ZXM A;  3ZKD A;  1NZ0 A;  3T1H I;  4YHH E;  2UXB E;  4JG4 A;  4DR6 E;  4GKJ I;  4DV6 I;  4XTJ A;  1KIJ A;  1N32 I;  1B62 A;  4LF5 E;  4JI0 E;  4JI6 E;  1Z5B A;  4YY3 E;  3HUL A;  4DR5 E;  5IT9 Q;  5LMU E;  4JV5 E;  4WUD A;  1Z5A A;  4DUY I;  5A2Q Q;  4LFB I;  4FWG A;  4OX9 E;  2HFU A;  4DR3 E;  4MYU A;  4LFA I;  5LMN E;  4X65 I;  4DV4 E;  5BR8 E;  1S16 A;  4DR2 E;  1ZM4 A;  1KTV A;  2UU9 E;  4DV0 I;  1FI4 A;  3M6A A;  4LF9 E;  4DR1 I;  4ZVI A;  4LF8 I;  4X64 I;  5GMD A;  1Z0G A;  4B3M I;  4PRX A;  1J5E I;  2V2V A;  4DV7 I;  3B8H A;  4GKJ E;  4JI4 E;  1XHK A;  2UXD I;  4R1F A;  4DU7 A;  1RR9 A;  1IBK I;  1KKH A;  1EA6 A;  3D4J A;  4PRV A;  3PYF A;  1KVK A;  4RPF A;  4MYT A;  4DPY A;  4DUY E;  2VQE I;  5IWA I;  4JYA E;  4DV3 I;  4JI3 I;  1WUU A;  3ZZ0 A;  4LFA E;  2CZ9 A;  4WUC A;  4DV1 I;  4X65 E;  4USK A;  4FN5 A;  4LF6 E;  3ZZT A;  1ZXN A;  1Z0C A;  4DV0 E;  1DAR A;  4DR1 E;  1N36 E;  3WU4 A;  3B82 A;  4X64 E;  2UUB I;  2HKJ A;  4DR4 I;  4B3M E;  2ZM6 E;  4DV5 I;  1J5E E;  4P52 A;  1IBM E;  1XNR I;  1HR0 E;  2J7K A;  4DUZ I;  4JI8 I;  3J81 Q;  1HNZ I;  4FWD A;  1XNQ I;  1Z0B A;  3WU5 A;  2V2Z A;  2NPF A;  2VQE E;  4JI3 E;  4WUB A;  2A2D A;  1N0V C;  4GKK E;  4LFC E;  4LF4 I;  3PYD A;  4NXM I;  3QT8 A;  4NXN I;  4DPW A;  1HNX I;  2AJ4 A;  4AQY I;  1B63 A;  2HFS A;  1ZM2 A;  4HAC B;  4DU8 A;  2UUA E;  1FNM A;  1XMQ I;  4DR4 E;  4X66 I;  4DV5 E;  4KHP I;  3LNU A;  3ZKB A;  2DEJ A;  1XNR E;  4HYM A;  2R3V A;  4JI5 E;  2VQF I;  4JI7 I;  4DXL A;  1FJG I;  2UUC I;  1N33 I;  2Q2E B;  3T1Y I;  4K0K I;  4JI8 E;  4DV2 I;  2HHH I;  1HNZ E;  2LJP A;  1K47 A;  4JI1 E;  4JI2 I;  1XNQ E;  4FW9 A;  2A2C A;  1IBL E;  3T1H E;  4ED4 A;  1XMO I;  1PVG A;  4DV6 E;  3WU3 A;  1N0U A;  1N32 E;  2X36 A;  5LL6 R;  1H7S A;  4LF4 E;  4B3T I;  4DPT A;  1HNX E;  4NXN E;  1QZR A;  3K17 A;  4AQY E;  1Z0W A;  2BM1 A;  4LFB E;  1VIS A;  4DR7 I;  3ZM7 A;  4KHP E;  3WU6 A;  3CWV A;  1FWL A;  4YHH I;  2UUC E;  1A6F A;  4DR6 I;  3J80 C;  1H74 A;  3QT6 A;  2OI2 A;  3F0N A;  4DV2 E;  1I94 I;  2HHH E;  4LF8 E;  5FLX C;  1RRE A;  1H73 A;  2ZBK B;  4LF5 I;  3J7A M;  4DV7 E;  4YY3 I;  2UXD E;  4M1K A;  4B3S I;  2WW4 A;  2HKE A;  3B78 A;  4JV5 I;  2HK3 A;  1IBK E;  1D6T A;  1NHH A;  2VF3 A; 
#chains in the Genus database with same CATH topology
 4DR3 I;  5A2Q C;  5LMN I;  3U1Y A;  4KQV A;  1N34 I;  1FWK A;  1MU5 A;  4X62 I;  5IWA E;  1ZM9 A;  1R6L A;  3GON A;  5JEA F;  4DV3 E;  1NHJ A;  3LTO A;  4DR2 I;  1H72 C;  1Y4U A;  1MG7 A;  2C38 A;  2O1W A;  4LF9 I;  4IZJ D;  1ELO A;  4OZE A;  4HAC A;  4DV1 E;  3K1J A;  3JAM C;  3OTO I;  4IS9 A;  4PU9 A;  3Q1Q A;  3M85 D;  2E5L I;  4FW3 A;  2WNR A;  5JEA E;  2JT2 A;  5FLX Q;  4OO1 A;  4JI4 I;  2ZIT A;  3H1C A;  3L7Z A;  1I94 E;  3J7A G;  1Z59 A;  2UUB E;  2R42 A;  1USV A;  2V8P A;  2NN6 A;  2BR2 A;  3P3E A;  5K36 C;  5DRP A;  2EFG A;  4QNK A;  4URL A;  1PKP A;  2XEX A;  4Z7C A;  4B3S E;  5DNL A;  1Z5C A;  4DPX A;  2CVE A;  2PNZ A;  4DUZ E;  1BKN A;  4JYA I;  3M7N D;  1HK7 A;  2E1R A;  4EMD A;  1U2R A;  2Z5B A;  4Z7Y A;  4IFD B;  1EI1 A;  4IZK A;  1N34 E;  1Z0V A;  2HK2 A;  4X62 E;  4LF6 I;  4MU1 A;  4LF7 I;  1H7U A;  3JAM Q;  5C0X B;  1YHC A;  2NN6 D;  4OO1 C;  1UDS A;  4GQU A;  2GS8 A;  1N36 I;  1E3P A;  4NXM E;  3OTO E;  4I3H A;  3M85 G;  3P3C A;  4IFD D;  3ZZU A;  1PIE A;  2ZM6 I;  2UXC I;  3Q6N A;  4FWH A;  4LCH A;  2E5L E;  1Z0E A;  2X7I A;  5FWK A;  1IBM I;  4DPU A;  4B3R I;  2Z5C B;  1XMQ E;  1HR0 I;  4HY1 A;  4FW6 A;  4X66 E;  3HJC A;  1MX0 A;  2PNL A;  4OKG A;  4MU4 A;  1OYS A;  1UDO A;  3U1K A;  2CGE A;  2PNM A;  2V2Q A;  4BA2 A;  3PYG A;  2BV3 A;  2F4V I;  2VQF E;  1HNW I;  4JI7 E;  4P7A A;  4LCF A;  3J81 C;  2JEA B;  2UXB I;  1FJG E;  1N33 E;  3M7N G;  3H4L A;  3T1Y E;  4K0K E;  1Y60 A;  4UTG A;  2BM0 A;  1XXE A;  4JI2 E;  3LPS A;  2DEI A;  3NZK A;  4HXZ A;  2V34 A;  4BA1 B;  4UT4 A;  4GKK I;  1S4E A;  1UEK A;  4IZJ A;  4JI0 I;  4LFC I;  4JI6 I;  1XMO E;  5DNX A;  1NHI A;  3HKM A;  4LF7 E;  3V5R A;  4DR5 I;  2CG9 A;  5LMU I;  4USM A;  3QT7 A;  1Y6Z A;  1RHY A;  2IES A;  1OYR A;  3CDJ A;  4LPF A;  4B3T E;  3QT5 A;  5IT9 C;  2UUA I;  4OX9 I;  1P42 A;  4U3B A;  1Z0T A;  2JEB B;  1OJ4 A;  2UXC E;  3GME A;  5JEA B;  2VES A;  4DV4 I;  2PO2 B;  5BR8 I;  4JI5 I;  1FKA E;  4B3R E;  5GME A;  2UU9 I;  4DR7 E;  1ZM3 A;  3V2U C;  3PS1 A;  5L3J A;  4JI1 I;  3J80 Q;  3PYE A;  2F4V E;  1HNW E;  1IBL I;  1ZXM A;  3ZKD A;  1NZ0 A;  3T1H I;  4YHH E;  2UXB E;  4JG4 A;  4DR6 E;  4GKJ I;  1E3H A;  2JE6 B;  5DRR A;  2BA1 D;  2O1T A;  4DV6 I;  4LCG A;  2PO1 B;  4XTJ A;  1KIJ A;  1N32 I;  1B62 A;  5K36 F;  4LF5 E;  4JI0 E;  4JI6 E;  1VI7 A;  1Z5B A;  2O1U A;  4YY3 E;  3HUL A;  4DR5 E;  4IFD A;  5IT9 Q;  5LMU E;  4JV5 E;  4WUD A;  1Z5A A;  4DUY I;  2WP8 B;  5A2Q Q;  5C0X A;  4LFB I;  4FWG A;  2PO0 B;  4OX9 E;  5K36 E;  2HFU A;  4DR3 E;  4MYU A;  4LFA I;  5LMN E;  4X65 I;  4DV4 E;  4FW7 A;  2GQ0 A;  5BR8 E;  1S16 A;  4DR2 E;  1ZM4 A;  3PRY A;  1KTV A;  2UU9 E;  4OO1 F;  4DV0 I;  1FI4 A;  3P76 A;  4N3O A;  3M6A A;  4LF9 E;  4FW5 A;  4DR1 I;  4ZVI A;  2Z5C A;  1Y5Y A;  4LF8 I;  2NN6 C;  5GMD A;  2NN6 F;  4X64 I;  1Z0G A;  4B3M I;  4PRX A;  1J5E I;  2V2V A;  2BA1 G;  2C37 B;  4DV7 I;  3B8H A;  2GO4 A;  3PS3 A;  4JI4 E;  4GKJ E;  5C0X D;  1XHK A;  2UXD I;  4IFD C;  4R1F A;  3Q6M A;  4DU7 A;  4MU3 A;  4IFD F;  5EL9 A;  4OO1 E;  2JEA A;  1RR9 A;  5C0X C;  2NN6 E;  1IBK I;  1KKH A;  1EA6 A;  3D4J A;  4BA1 A;  4PRV A;  3PYF A;  1KVK A;  4U3D A;  4RPF A;  4MYT A;  4DPY A;  4DUY E;  2VQE I;  5IWA I;  4JYA E;  4DV3 I;  4JI3 I;  1WUU A;  3ZZ0 A;  4LFA E;  1UDN A;  2CZ9 A;  3B4T A;  4WUC A;  4X65 E;  4DV1 I;  4USK A;  4FN5 A;  4LF6 E;  2JEB A;  3ZZT A;  1ZXN A;  5JEA A;  1Z0C A;  4DV0 E;  2PO2 A;  2BA0 D;  1DAR A;  4DR1 E;  1N36 E;  3WU4 A;  3B82 A;  4X64 E;  1OYP A;  2UUB I;  4AM3 A;  2HKJ A;  4DR4 I;  4B3M E;  5DRQ A;  2ZM6 E;  4DV5 I;  1J5E E;  4P52 A;  2C39 B;  2Z5E A;  1IBM E;  1XNR I;  4QNJ A;  1HR0 E;  2JE6 A;  2J7K A;  2PO1 A;  4DUZ I;  4JI8 I;  3J81 Q;  1HNZ I;  4FWD A;  1XNQ I;  1Z0B A;  5JEA D;  2GO3 A;  3WU5 A;  4LOM A;  2IER A;  2V2Z A;  2NPF A;  2VQE E;  5JEA C;  3P06 A;  4JI3 E;  1Y4S A;  4WUB A;  5K36 B;  2A2D A;  1N0V C;  4GKK E;  3K85 A;  2WP8 A;  4LFC E;  4LF4 I;  2PO0 A;  3PYD A;  4NXM I;  3QT8 A;  4NXN I;  4DPW A;  1HNX I;  2AJ4 A;  2BA0 G;  3GLL A;  4AQY I;  2C38 B;  1B63 A;  5K36 D;  2HFS A;  1ZM2 A;  4HAC B;  4DU8 A;  2F1D A;  2AE8 A;  2UUA E;  1FNM A;  1XMQ I;  2O3Z A;  4DR4 E;  3GCM A;  2J65 A;  3P3G A;  4X66 I;  4DV5 E;  4KHP I;  3LNU A;  5EKW A;  3ZKB A;  2WNR B;  2DEJ A;  4OO1 B;  1XNR E;  4HYM A;  2R3V A;  3L7Z B;  4JI5 E;  2VQF I;  4JI7 I;  2C37 A;  4DXL A;  4MDT A;  1FJG I;  2UUC I;  1N33 I;  2NN6 B;  2BR2 B;  2Q2E B;  2O1V A;  3T1Y I;  4K0K I;  4JI8 E;  4DV2 I;  2HHH I;  1HNZ E;  2LJP A;  1K47 A;  4JI1 E;  4JI2 I;  1XNQ E;  4FW9 A;  2A2C A;  1IBL E;  3T1H E;  4OO1 D;  4ISA A;  4ED4 A;  1XMO I;  1PVG A;  4DV6 E;  2PNZ B;  4MQY A;  3WU3 A;  1N0U A;  3CDI A;  1N32 E;  2X36 A;  4NBQ A;  5C0X F;  5LL6 R;  2Z5B B;  1H7S A;  4LF4 E;  4B3T I;  4IZK B;  4DPT A;  1HNX E;  4NXN E;  1QZR A;  4MU0 A;  3DD6 A;  3K17 A;  4AQY E;  4IFD E;  1Z0W A;  5DRO A;  2BM1 A;  4AIM A;  1YH8 A;  4LFB E;  5C0X E;  1VIS A;  4DR7 I;  3ZM7 A;  1USU A;  4FW4 A;  4KHP E;  3WU6 A;  3KRN A;  3CWV A;  3PS2 A;  4AID A;  1R6M A;  1FWL A;  2C39 A;  4YHH I;  2UUC E;  1A6F A;  4DR6 I;  3J80 C;  1H74 A;  3QT6 A;  2OI2 A;  3F0N A;  4DV2 E;  1I94 I;  2HHH E;  4LF8 E;  5ELW A;  5FLX C;  4BA2 B;  1RRE A;  1H73 A;  2ZBK B;  4LF5 I;  3J7A M;  4DV7 E;  3UHM A;  4YY3 I;  2UXD E;  4M1K A;  2IOP A;  4B3S I;  1UDQ A;  2IOQ A;  2WW4 A;  2HKE A;  3B78 A;  4JV5 I;  4J3D A;  2HK3 A;  4IZJ B;  1IBK E;  5K36 A;  1D6T A;  1NHH A;  2VF3 A; 
#chains in the Genus database with same CATH homology
 4DR3 I;  5A2Q C;  5LMN I;  4KQV A;  1N34 I;  1FWK A;  1MU5 A;  4X62 I;  5IWA E;  1ZM9 A;  3GON A;  4DR2 I;  4DV3 E;  1NHJ A;  3LTO A;  1H72 C;  1Y4U A;  1MG7 A;  2O1W A;  4LF9 I;  4IZJ D;  1ELO A;  4HAC A;  4DV1 E;  3K1J A;  3JAM C;  3OTO I;  4PU9 A;  3Q1Q A;  2E5L I;  5FLX Q;  4JI4 I;  2ZIT A;  1I94 E;  3J7A G;  1Z59 A;  2UUB E;  2R42 A;  1USV A;  2V8P A;  2EFG A;  4URL A;  1PKP A;  2XEX A;  4Z7C A;  4B3S E;  1Z5C A;  4DPX A;  4DUZ E;  1BKN A;  4JYA I;  1HK7 A;  2E1R A;  4EMD A;  1U2R A;  2Z5B A;  4Z7Y A;  1EI1 A;  4IZK A;  1N34 E;  1Z0V A;  2HK2 A;  4X62 E;  4LF6 I;  4LF7 I;  1H7U A;  3JAM Q;  2GS8 A;  1N36 I;  4NXM E;  3OTO E;  4I3H A;  3ZZU A;  1PIE A;  2ZM6 I;  2UXC I;  3Q6N A;  4FWH A;  2E5L E;  1Z0E A;  2X7I A;  5FWK A;  1IBM I;  4DPU A;  4B3R I;  2Z5C B;  1XMQ E;  1HR0 I;  4HY1 A;  4X66 E;  3HJC A;  1MX0 A;  2PNL A;  2CGE A;  2PNM A;  2V2Q A;  3PYG A;  2BV3 A;  2F4V I;  2VQF E;  1HNW I;  4JI7 E;  4P7A A;  3J81 C;  2UXB I;  1FJG E;  1N33 E;  3H4L A;  3T1Y E;  4K0K E;  4UTG A;  2BM0 A;  4JI2 E;  3LPS A;  2DEI A;  4HXZ A;  2V34 A;  4UT4 A;  4GKK I;  1S4E A;  1UEK A;  4IZJ A;  4JI0 I;  4LFC I;  4JI6 I;  1XMO E;  1NHI A;  4LF7 E;  3V5R A;  4DR5 I;  2CG9 A;  5LMU I;  4USM A;  3QT7 A;  1Y6Z A;  4B3T E;  3QT5 A;  5IT9 C;  2UUA I;  4OX9 I;  1Z0T A;  1OJ4 A;  2UXC E;  4DV4 I;  5BR8 I;  4JI5 I;  1FKA E;  4B3R E;  5GME A;  2UU9 I;  4DR7 E;  1ZM3 A;  3V2U C;  5L3J A;  4JI1 I;  3J80 Q;  3PYE A;  2F4V E;  1HNW E;  1IBL I;  1ZXM A;  3ZKD A;  1NZ0 A;  3T1H I;  4YHH E;  2UXB E;  4JG4 A;  4DR6 E;  4GKJ I;  2O1T A;  4DV6 I;  4XTJ A;  1KIJ A;  1N32 I;  1B62 A;  4LF5 E;  4JI0 E;  4JI6 E;  1Z5B A;  2O1U A;  4YY3 E;  3HUL A;  4DR5 E;  5IT9 Q;  5LMU E;  4JV5 E;  4WUD A;  1Z5A A;  4DUY I;  5A2Q Q;  4LFB I;  4FWG A;  4OX9 E;  2HFU A;  4DR3 E;  4MYU A;  4LFA I;  5LMN E;  4X65 I;  4DV4 E;  2GQ0 A;  5BR8 E;  1S16 A;  4DR2 E;  1ZM4 A;  3PRY A;  1KTV A;  2UU9 E;  4DV0 I;  1FI4 A;  3M6A A;  4N3O A;  4LF9 E;  4DR1 I;  4ZVI A;  2Z5C A;  4LF8 I;  4X64 I;  5GMD A;  1Z0G A;  4B3M I;  4PRX A;  1J5E I;  2V2V A;  4DV7 I;  3B8H A;  4GKJ E;  4JI4 E;  1XHK A;  2UXD I;  4R1F A;  3Q6M A;  4DU7 A;  1RR9 A;  1IBK I;  1KKH A;  1EA6 A;  3D4J A;  4PRV A;  3PYF A;  1KVK A;  4RPF A;  4MYT A;  4DPY A;  4DUY E;  2VQE I;  5IWA I;  4JYA E;  4DV3 I;  4JI3 I;  1WUU A;  3ZZ0 A;  4LFA E;  2CZ9 A;  4WUC A;  4DV1 I;  4X65 E;  4USK A;  4FN5 A;  4LF6 E;  3ZZT A;  1ZXN A;  1Z0C A;  4DV0 E;  1DAR A;  4DR1 E;  1N36 E;  3WU4 A;  3B82 A;  4X64 E;  2UUB I;  2HKJ A;  4DR4 I;  4B3M E;  2ZM6 E;  4DV5 I;  1J5E E;  4P52 A;  2Z5E A;  1IBM E;  1XNR I;  1HR0 E;  2J7K A;  4DUZ I;  4JI8 I;  3J81 Q;  1HNZ I;  4FWD A;  1XNQ I;  1Z0B A;  3WU5 A;  2V2Z A;  2NPF A;  2VQE E;  3P06 A;  4JI3 E;  1Y4S A;  4WUB A;  2A2D A;  1N0V C;  4GKK E;  3K85 A;  4LFC E;  4LF4 I;  3PYD A;  4NXM I;  3QT8 A;  4NXN I;  4DPW A;  1HNX I;  2AJ4 A;  4AQY I;  1B63 A;  2HFS A;  1ZM2 A;  4HAC B;  4DU8 A;  2UUA E;  1FNM A;  1XMQ I;  4DR4 E;  4X66 I;  4DV5 E;  4KHP I;  3LNU A;  3ZKB A;  2DEJ A;  1XNR E;  4HYM A;  2R3V A;  4JI5 E;  2VQF I;  4JI7 I;  4DXL A;  1FJG I;  2UUC I;  1N33 I;  2Q2E B;  2O1V A;  3T1Y I;  4K0K I;  4JI8 E;  4DV2 I;  2HHH I;  1HNZ E;  2LJP A;  1K47 A;  4JI1 E;  4JI2 I;  1XNQ E;  4FW9 A;  2A2C A;  1IBL E;  3T1H E;  4ED4 A;  1XMO I;  1PVG A;  4DV6 E;  3WU3 A;  1N0U A;  1N32 E;  2X36 A;  5LL6 R;  2Z5B B;  1H7S A;  4LF4 E;  4B3T I;  4IZK B;  4DPT A;  1HNX E;  4NXN E;  1QZR A;  3K17 A;  4AQY E;  1Z0W A;  2BM1 A;  4LFB E;  1VIS A;  4DR7 I;  3ZM7 A;  1USU A;  4KHP E;  3WU6 A;  3CWV A;  1FWL A;  4YHH I;  2UUC E;  1A6F A;  4DR6 I;  3J80 C;  1H74 A;  3QT6 A;  2OI2 A;  3F0N A;  4DV2 E;  1I94 I;  2HHH E;  4LF8 E;  5FLX C;  1RRE A;  1H73 A;  2ZBK B;  4LF5 I;  3J7A M;  4DV7 E;  4YY3 I;  2UXD E;  4M1K A;  2IOP A;  4B3S I;  2IOQ A;  2WW4 A;  2HKE A;  3B78 A;  4JV5 I;  2HK3 A;  4IZJ B;  1IBK E;  1D6T A;  1NHH A;  2VF3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...