1HR0I

Crystal structure of initiation factor if1 bound to the 30s ribosomal subunit
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGRFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Crystal structure of an initiation factor bound to the 30S ribosomal subunit.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ribosome
total genus 31
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2000-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1hr0I00
1D6TA 2ZITA 2ZM6I 4DPYA 5LMNE 1N34I 1KKHA 2LJPA 5L3JA 1S16A 2A2DA 4DV1E 4P7AA 4DV5E 4R1FA 4JV5I 1J5EI 1PKPA 4LF7I 1Z0TA 4JI3I 4UTGA 4DUYE 1Z5BA 4P52A 2UUAI 2BM1A 2UUBI 4GKJE 4LFBI 3WU4A 1NHIA 3OTOE 4DPXA 3QT7A 4DV6E 2GS8A 3M6AA 1RR9A 2OI2A 1FKAE 5A2QC 4DU8A 2X36A 4LFCE 1Z0BA 1Z0VA 4JI1E 4B3RI 4USMA 4HXZA 4JI7I 4DPTA 1XMQE 1DARA 1ZXMA 2J7KA 4AQYI 4FWGA 4YY3I 4DR4I 4RPFA 4X65I 5IT9C 1VISA 2V34A 1Z0GA 5LMNI 2UU9I 4DV7E 3B8HA 4DR3E 4LF6I 4X62I 4JYAE 3T1HE 3J7AG 3JAMQ 1WUUA 1XNRI 4HYMA 1IBLI 4K0KE 4GKKE 4DV1I 4LF4E 4DV5I 2UXDE 4FWHA 2UXCE 1H7SA 4PRVA 2HKJA 3WU3A 1FNMA 1K47A 4LF5I 1HR0I 4DR1I 4X64E 5IWAE 4WUCA 4DXLA 2DEJA 1QZRA 4JI2I 1IBKE 1N32E 5LMUE 2HK2A 4DPUA 4HACA 4X66I 3CWVA 4USKA 2HKEA 4Z7CA 4PU9A 4JI5E 3J80C 1EI1A 4YHHE 4JI4E 4LF9I 2BV3A 4NXME 2X7IA 2UXBE 4ED4A 4LF8I 2XEXA 3LNUA 1UEKA 1EA6A 5BR8E 1MX0A 4DR3I 4DV0E 3ZKBA 2WW4A 4NXNE 4JYAI 3ZKDA 3T1HI 4K0KI 2E5LE 4GKKI 4LF4I 4DUZE 2VQEE 3B82A 4DPWA 2UUCI 4DR7E 2VQFE 3T1YE 1XMOE 1I94E 1H74A 3HULA 3LTOA 1IBME 1FJGI 4JI8I 2F4VE 1HNZE 4B3TI 4KHPE 4JI0E 4DV3I 2ZBKB 1Z0CA 4HY1A 5LMUI 1ZM2A 3K1JA 1XNQE 4JI6E 1Z59A 4DR6E 2HHHI 3JAMC 4URLA 4EMDA 4ZVIA 5FLXC 4NXMI 4DV4E 4DR5E 1ZM9A 5A2QQ 1B62A 2ZM6E 1N34E 1FWLA 1Z5CA 4NXNI 1FWKA 2Q2EB 2HFUA 4DUYI 3QT8A 4JV5E 3J81Q 4JI3E 4GKJI 2BM0A 3OTOI 4UT4A 5IT9Q 1XHKA 1N33E 2NPFA 1KTVA 4DV6I 2VF3A 4WUDA 2UUBE 2UUAE 3ZZTA 4LFBE 3D4JA 3K17A 1Z5AA 3QT6A 2F4VI 3QT5A 4LFCI 4KHPI 4JI1I 4OX9E 1HNXE 1XMQI 1OJ4A 2V2ZA 4HACB 3V2UC 2HFSA 1ZXNA 3PYGA 3F0NA 1PVGA 1N36E 1ZM4A 3PYEA 4JI7E 4AQYE 1ELOA 4DV4I 2AJ4A 4DV7I 4B3ME 4YY3E 2A2CA 2V2VA 4DR4E 4X65E 1N0VC 3LPSA 2UU9E 1FI4A 3H4LA 2UXDI 4XTJA 4LF6E 4X62E 4DV2E 3PYDA 2UXCI 4WUBA 1NZ0A 1XNRE 1IBLE 3GONA 4MYUA 4Z7YA 3J80Q 1HNWE 4DR2E 1Z0EA 2V2QA 1NHHA 1N33I 4I3HA 4X64I 1MU5A 2R3VA 4FWDA 5IWAI 4LF5E 4LFAE 1HR0E 4DR1E 4DU7A 1IBKI 1N32I 2DEIA 3ZZ0A 4JI2E 2R42A 4JI5I 1ZM3A 1H7UA 4OX9I 4B3SE 3ZM7A 1HNXI 4YHHI 3B78A 4X66E 4JI4I 1KIJA 2UXBI 1N36I 2CZ9A 4LF9E 1A6FA 1MG7A 5GMEA 3J81C 4JG4A 2E1RA 4B3MI 5BR8I 3Q1QA 1BKNA 4DV0I 5GMDA 1N0UA 4FW9A 4LF8E 4KQVA 2E5LI 4DUZI 1U2RA 2VQEI 1J5EE 4LF7E 4DR7I 2VQFI 3T1YI 1XMOI 1I94I 4DV2I 4FN5A 1KVKA 1IBMI 1HNWI 2HK3A 4DR2I 5FLXQ 3PYFA 2UUCE 1B63A 4PRXA 3J7AM 2EFGA 3WU6A 1HNZI 1H73A 1PIEA 1FJGE 4M1KA 1H72C 4JI0I 1Z0WA 4LFAI 4JI8E 5LL6R 2V8PA 4B3TE 1RREA 4MYTA 4DV3E 1XNQI 3ZZUA 4JI6I 4DR6I 3WU5A 4B3RE 1NHJA 4B3SI 1S4EA 2HHHE 4DR5I 3V5RA
chains in the Genus database with same CATH superfamily
4OO1D 1D6TA 5JEAC 2ZITA 2PNLA 2ZM6I 4GQUA 4DPYA 5LMNE 1N34I 1KKHA 2LJPA 2NN6E 5L3JA 1S16A 4J3DA 2A2DA 4DV1E 2NN6D 4P7AA 4DV5E 4R1FA 4JV5I 1J5EI 1PKPA 4LF7I 2JE6A 1Z0TA 2C38A 4JI3I 4UTGA 4AIDA 4MU0A 4DUYE 2GO4A 2O1WA 1Z5BA 1HK7A 4P52A 4MU3A 2UUAI 2BM1A 2UUBI 1OYPA 4GKJE 4LFBI 3CDJA 2BR2A 1NHIA 3WU4A 4DPXA 3OTOE 2IOQA 3QT7A 4DV6E 2GS8A 3M6AA 1RR9A 2OI2A 1FKAE 5A2QC 4BA2B 4DU8A 2X36A 4LFCE 1UDSA 1Z0BA 4IFDC 1Z0VA 4JI1E 2WP8A 4B3RI 4USMA 2PNMA 4HXZA 5C0XF 4OO1F 4JI7I 1DARA 2Z5EA 1ZXMA 5DRQA 4DPTA 1XMQE 2J7KA 4AQYI 2O1TA 4FWGA 3UHMA 4YY3I 5JEAD 2WP8B 4DR4I 4RPFA 4X65I 5IT9C 2VESA 1VISA 3K85A 2V34A 1Z0GA 5LMNI 2UU9I 4DV7E 2NN6F 2Z5BB 3B8HA 4DR3E 4LF6I 4X62I 4JYAE 3T1HE 3J7AG 3JAMQ 2JEAB 1WUUA 1XNRI 4MU1A 4HYMA 1IBLI 4K0KE 2CVEA 4GKKE 4DV1I 4LF4E 4DV5I 2CG9A 3P3CA 4BA1A 4FWHA 2UXDE 5K36B 5DNLA 4IZJD 3NZKA 2UXCE 1H7SA 4PRVA 2HKJA 3H1CA 3WU3A 2Z5CA 2GO3A 1FNMA 5DRRA 1K47A 4IFDB 3PS1A 4LF5I 1HR0I 4DR1I 4X64E 5IWAE 4IS9A 4FW5A 4WUCA 1UDQA 4DXLA 3Q6NA 5C0XA 2DEJA 4OO1A 1QZRA 4FW3A 1YH8A 4JI2I 1IBKE 1N32E 2PO1B 5LMUE 2HK2A 4DPUA 4HACA 4X66I 3CWVA 4USKA 4LCFA 2HKEA 2O1VA 4PU9A 1Y60A 4Z7CA 4JI5E 3HKMA 2PO0A 3PRYA 5JEAF 2NN6A 3J80C 1EI1A 4YHHE 4JI4E 4LF9I 2BV3A 4NXME 2WNRB 2X7IA 2UXBE 2C37A 4ED4A 5FWKA 4LF8I 2XEXA 3LNUA 1UEKA 1EA6A 4U3BA 5BR8E 1MX0A 4DR3I 1Y4UA 3ZKBA 2WW4A 4DV0E 4NXNE 4JYAI 3ZKDA 3T1HI 4K0KI 2E5LE 3GLLA 4GKKI 4LF4I 4DUZE 2F1DA 2VQEE 3B82A 4DPWA 2UUCI 4DR7E 2VQFE 3T1YE 2C39A 2JE6B 1XMOE 1I94E 2C38B 1H74A 3P06A 3HULA 3L7ZA 3LTOA 1XXEA 1IBME 3GCMA 1FJGI 2C39B 5K36C 1Y5YA 2BR2B 3L7ZB 4JI8I 2PO2A 2F4VE 3M7NG 2JEBA 1HNZE 4B3TI 3M7ND 4KHPE 2AE8A 4JI0E 4DV3I 3HJCA 5JEAA 4AIMA 2PO2B 2ZBKB 1Z0CA 4HY1A 5JEAE 5LMUI 1ZM2A 3K1JA 1XNQE 4JI6E 1Z59A 4DR6E 2HHHI 3JAMC 4URLA 4EMDA 5DROA 4ZVIA 5FLXC 4NXMI 4DV4E 4DR5E 1ZM9A 4IZJA 5C0XC 5A2QQ 1B62A 4OO1C 2ZM6E 4FW6A 1N34E 3P3GA 1FWLA 1Z5CA 4NXNI 1FWKA 2Q2EB 2HFUA 4DUYI 4MU4A 4LCGA 4IZKA 2NN6C 4MDTA 3QT8A 4BA1B 4JV5E 3J81Q 4JI3E 3U1YA 4GKJI 2BM0A 4UT4A 3OTOI 1OYSA 1XHKA 5IT9Q 1N33E 2NPFA 2Z5CB 1KTVA 4DV6I 2VF3A 4ISAA 4WUDA 3Q6MA 4OZEA 2UUBE 2UUAE 5K36D 3ZZTA 4LFBE 3D4JA 4IFDE 3K17A 1Z5AA 3QT6A 2F4VI 3PS3A 2JT2A 3QT5A 4LFCI 1USUA 4IFDD 4KHPI 5C0XB 4OO1B 4JI1I 4N3OA 4OX9E 1HNXE 1XMQI 1OJ4A 2V2ZA 4HACB 3V2UC 2HFSA 1ZXNA 3PYGA 3F0NA 1PVGA 1RHYA 1N36E 1ZM4A 2J65A 3PYEA 2PO0B 1E3PA 4JI7E 2NN6B 4AQYE 1ELOA 4DV4I 2AJ4A 5C0XD 4DV7I 4B3ME 4YY3E 2A2CA 2V2VA 4DR4E 4X65E 1N0VC 3LPSA 4LCHA 1P42A 2C37B 2HHHE 2UU9E 1FI4A 3H4LA 2UXDI 4XTJA 4LF6E 4X62E 4DV2E 3PYDA 2UXCI 4WUBA 1NZ0A 1XNRE 1IBLE 3GONA 4MYUA 4Z7YA 3J80Q 1HNWE 4DR2E 1Z0EA 2V2QA 4QNJA 4QNKA 1NHHA 3U1KA 5EL9A 5K36F 5DNXA 1N33I 5DRPA 4I3HA 4X64I 1MU5A 2R3VA 4FWDA 5IWAI 4LF5E 4LFAE 1HR0E 4DR1E 4DU7A 4IFDF 4BA2A 4NBQA 1IBKI 1E3HA 1N32I 2DEIA 1R6LA 2CGEA 2O3ZA 2JEBB 3ZZ0A 3M85G 3M85D 2IOPA 4JI2E 5JEAB 3PS2A 2R42A 4JI5I 1ZM3A 1H7UA 4OX9I 4B3SE 3ZM7A 1HNXI 4YHHI 3B78A 4X66E 4JI4I 1KIJA 2UXBI 1N36I 2BA0G 4LPFA 2CZ9A 4LF9E 1A6FA 1MG7A 2BA0D 2O1UA 5GMEA 3J81C 4JG4A 2Z5BA 2E1RA 4B3MI 5BR8I 1R6MA 3Q1QA 1BKNA 4IZJB 5GMDA 4DV0I 1N0UA 1OYRA 4FW9A 2JEAA 1Y4SA 4LF8E 1UDNA 3B4TA 1Y6ZA 4KQVA 2E5LI 4AM3A 4DUZI 1U2RA 5K36A 2VQEI 1J5EE 3DD6A 4LF7E 4DR7I 1YHCA 2VQFI 3T1YI 1XMOI 1I94I 4DV2I 4FN5A 3GMEA 1VI7A 5K36E 1KVKA 1IBMI 1HNWI 2HK3A 4IZKB 4DR2I 4IFDA 5FLXQ 3PYFA 2UUCE 1B63A 2IESA 4PRXA 2PNZA 3J7AM 2EFGA 3WU6A 1HNZI 1H73A 3P3EA 1PIEA 4MQYA 2BA1G 1FJGE 4M1KA 1H72C 3CDIA 4OKGA 1Z0WA 2BA1D 4JI0I 4LFAI 4JI8E 4FW4A 2PNZB 5LL6R 2PO1A 4U3DA 2V8PA 4B3TE 1RREA 4MYTA 4DV3E 1XNQI 1UDOA 3ZZUA 4JI6I 2GQ0A 4DR6I 3WU5A 5EKWA 5ELWA 3P76A 4B3RE 5C0XE 4OO1E 1NHJA 1USVA 4B3SI 3KRNA 1S4EA 4FW7A 2IERA 2WNRA 4LOMA 4DR5I 3V5RA
chains in the Genus database with same CATH topology
1D6TA 2ZITA 2PNLA 2ZM6I 4DPYA 5LMNE 1N34I 1KKHA 2LJPA 5L3JA 1S16A 2A2DA 4DV1E 4P7AA 4DV5E 4R1FA 4JV5I 1J5EI 1PKPA 4LF7I 1Z0TA 4JI3I 4UTGA 4DUYE 2O1WA 1Z5BA 1HK7A 4P52A 2UUAI 2BM1A 2UUBI 4GKJE 4LFBI 3WU4A 1NHIA 3OTOE 4DPXA 2IOQA 3QT7A 4DV6E 2GS8A 3M6AA 1RR9A 2OI2A 1FKAE 5A2QC 4DU8A 2X36A 4LFCE 1Z0BA 1Z0VA 4JI1E 4B3RI 4USMA 2PNMA 4HXZA 4JI7I 4DPTA 1XMQE 1DARA 1ZXMA 2Z5EA 2J7KA 4AQYI 2O1TA 4FWGA 4YY3I 4DR4I 4RPFA 4X65I 5IT9C 1VISA 3K85A 2V34A 1Z0GA 5LMNI 2UU9I 4DV7E 2Z5BB 3B8HA 4DR3E 4LF6I 4X62I 4JYAE 3T1HE 3J7AG 3JAMQ 1WUUA 1XNRI 4HYMA 1IBLI 4K0KE 4GKKE 4DV1I 4LF4E 4DV5I 2CG9A 2UXDE 4FWHA 4IZJD 2UXCE 1H7SA 4PRVA 2HKJA 3WU3A 2Z5CA 1FNMA 1K47A 4LF5I 1HR0I 4DR1I 4X64E 5IWAE 4WUCA 4DXLA 3Q6NA 2DEJA 1QZRA 4JI2I 1IBKE 1N32E 5LMUE 2HK2A 4DPUA 4HACA 4X66I 3CWVA 4USKA 2HKEA 2O1VA 4PU9A 4Z7CA 4JI5E 3PRYA 3J80C 1EI1A 4YHHE 4JI4E 4LF9I 2BV3A 4NXME 2X7IA 2UXBE 4ED4A 5FWKA 4LF8I 2XEXA 3LNUA 1UEKA 1EA6A 5BR8E 1MX0A 4DR3I 1Y4UA 3ZKBA 2WW4A 4DV0E 4NXNE 4JYAI 3ZKDA 3T1HI 4K0KI 2E5LE 4GKKI 4LF4I 4DUZE 2VQEE 3B82A 4DPWA 2UUCI 4DR7E 2VQFE 3T1YE 1XMOE 1I94E 1H74A 3P06A 3HULA 3LTOA 1IBME 1FJGI 4JI8I 2F4VE 1HNZE 4B3TI 4KHPE 4JI0E 4DV3I 3HJCA 2ZBKB 1Z0CA 4HY1A 5LMUI 1ZM2A 3K1JA 1XNQE 4JI6E 1Z59A 4DR6E 2HHHI 3JAMC 4URLA 4EMDA 4ZVIA 5FLXC 4NXMI 4DV4E 4DR5E 1ZM9A 4IZJA 5A2QQ 1B62A 2ZM6E 1N34E 1FWLA 1Z5CA 4NXNI 1FWKA 2Q2EB 2HFUA 4DUYI 4IZKA 3QT8A 4JV5E 3J81Q 4JI3E 4GKJI 2BM0A 3OTOI 5IT9Q 1XHKA 1N33E 2NPFA 2Z5CB 1KTVA 4DV6I 2VF3A 4WUDA 3Q6MA 2UUBE 2UUAE 3ZZTA 4LFBE 3D4JA 3K17A 1Z5AA 3QT6A 2F4VI 3QT5A 4LFCI 1USUA 4KHPI 4JI1I 4N3OA 4OX9E 1HNXE 1XMQI 1OJ4A 2V2ZA 4HACB 3V2UC 2HFSA 1ZXNA 3PYGA 3F0NA 1PVGA 1N36E 1ZM4A 3PYEA 4JI7E 4AQYE 1ELOA 4DV4I 2AJ4A 4DV7I 4B3ME 4YY3E 2A2CA 2V2VA 4DR4E 4X65E 1N0VC 3LPSA 2HHHE 2UU9E 1FI4A 3H4LA 2UXDI 4XTJA 4LF6E 4X62E 4DV2E 3PYDA 2UXCI 4WUBA 1NZ0A 1XNRE 1IBLE 3GONA 4MYUA 4Z7YA 3J80Q 1HNWE 4DR2E 1Z0EA 2V2QA 1NHHA 1N33I 4I3HA 4X64I 1MU5A 2R3VA 4FWDA 5IWAI 4LF5E 4LFAE 1HR0E 4DR1E 4DU7A 1IBKI 1N32I 2DEIA 2CGEA 3ZZ0A 2IOPA 4JI2E 2R42A 4JI5I 1ZM3A 1H7UA 4OX9I 4B3SE 3ZM7A 1HNXI 4YHHI 3B78A 4X66E 4JI4I 1KIJA 2UXBI 1N36I 2CZ9A 4LF9E 1A6FA 1MG7A 2O1UA 5GMEA 3J81C 4JG4A 2Z5BA 2E1RA 4B3MI 5BR8I 3Q1QA 1BKNA 4IZJB 5GMDA 4DV0I 1N0UA 4FW9A 1Y4SA 4LF8E 1Y6ZA 4KQVA 2E5LI 4DUZI 1U2RA 2VQEI 1J5EE 4LF7E 4DR7I 2VQFI 3T1YI 1XMOI 1I94I 4DV2I 4FN5A 1KVKA 1IBMI 1HNWI 2HK3A 4IZKB 4DR2I 5FLXQ 3PYFA 2UUCE 1B63A 4PRXA 3J7AM 2EFGA 3WU6A 1HNZI 1H73A 1PIEA 1FJGE 4M1KA 1H72C 4JI0I 1Z0WA 4LFAI 4JI8E 5LL6R 2V8PA 4B3TE 1RREA 4MYTA 4DV3E 1XNQI 3ZZUA 4JI6I 2GQ0A 4DR6I 3WU5A 4B3RE 1NHJA 1USVA 4B3SI 1S4EA 4UT4A 4DR5I 3V5RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1D6T A;  2ZIT A;  2ZM6 I;  4DPY A;  5LMN E;  1N34 I;  1KKH A;  2LJP A;  5L3J A;  1S16 A;  2A2D A;  4DV1 E;  4P7A A;  4DV5 E;  4R1F A;  4JV5 I;  1J5E I;  1PKP A;  4LF7 I;  1Z0T A;  4JI3 I;  4UTG A;  4DUY E;  1Z5B A;  4P52 A;  2UUA I;  2BM1 A;  2UUB I;  4GKJ E;  4LFB I;  3WU4 A;  1NHI A;  3OTO E;  4DPX A;  3QT7 A;  4DV6 E;  2GS8 A;  3M6A A;  1RR9 A;  2OI2 A;  1FKA E;  5A2Q C;  4DU8 A;  2X36 A;  4LFC E;  1Z0B A;  1Z0V A;  4JI1 E;  4B3R I;  4USM A;  4HXZ A;  4JI7 I;  4DPT A;  1XMQ E;  1DAR A;  1ZXM A;  2J7K A;  4AQY I;  4FWG A;  4YY3 I;  4DR4 I;  4RPF A;  4X65 I;  5IT9 C;  1VIS A;  2V34 A;  1Z0G A;  5LMN I;  2UU9 I;  4DV7 E;  3B8H A;  4DR3 E;  4LF6 I;  4X62 I;  4JYA E;  3T1H E;  3J7A G;  3JAM Q;  1WUU A;  1XNR I;  4HYM A;  1IBL I;  4K0K E;  4GKK E;  4DV1 I;  4LF4 E;  4DV5 I;  2UXD E;  4FWH A;  2UXC E;  1H7S A;  4PRV A;  2HKJ A;  3WU3 A;  1FNM A;  1K47 A;  4LF5 I;  1HR0 I;  4DR1 I;  4X64 E;  5IWA E;  4WUC A;  4DXL A;  2DEJ A;  1QZR A;  4JI2 I;  1IBK E;  1N32 E;  5LMU E;  2HK2 A;  4DPU A;  4HAC A;  4X66 I;  3CWV A;  4USK A;  2HKE A;  4Z7C A;  4PU9 A;  4JI5 E;  3J80 C;  1EI1 A;  4YHH E;  4JI4 E;  4LF9 I;  2BV3 A;  4NXM E;  2X7I A;  2UXB E;  4ED4 A;  4LF8 I;  2XEX A;  3LNU A;  1UEK A;  1EA6 A;  5BR8 E;  1MX0 A;  4DR3 I;  4DV0 E;  3ZKB A;  2WW4 A;  4NXN E;  4JYA I;  3ZKD A;  3T1H I;  4K0K I;  2E5L E;  4GKK I;  4LF4 I;  4DUZ E;  2VQE E;  3B82 A;  4DPW A;  2UUC I;  4DR7 E;  2VQF E;  3T1Y E;  1XMO E;  1I94 E;  1H74 A;  3HUL A;  3LTO A;  1IBM E;  1FJG I;  4JI8 I;  2F4V E;  1HNZ E;  4B3T I;  4KHP E;  4JI0 E;  4DV3 I;  2ZBK B;  1Z0C A;  4HY1 A;  5LMU I;  1ZM2 A;  3K1J A;  1XNQ E;  4JI6 E;  1Z59 A;  4DR6 E;  2HHH I;  3JAM C;  4URL A;  4EMD A;  4ZVI A;  5FLX C;  4NXM I;  4DV4 E;  4DR5 E;  1ZM9 A;  5A2Q Q;  1B62 A;  2ZM6 E;  1N34 E;  1FWL A;  1Z5C A;  4NXN I;  1FWK A;  2Q2E B;  2HFU A;  4DUY I;  3QT8 A;  4JV5 E;  3J81 Q;  4JI3 E;  4GKJ I;  2BM0 A;  3OTO I;  4UT4 A;  5IT9 Q;  1XHK A;  1N33 E;  2NPF A;  1KTV A;  4DV6 I;  2VF3 A;  4WUD A;  2UUB E;  2UUA E;  3ZZT A;  4LFB E;  3D4J A;  3K17 A;  1Z5A A;  3QT6 A;  2F4V I;  3QT5 A;  4LFC I;  4KHP I;  4JI1 I;  4OX9 E;  1HNX E;  1XMQ I;  1OJ4 A;  2V2Z A;  4HAC B;  3V2U C;  2HFS A;  1ZXN A;  3PYG A;  3F0N A;  1PVG A;  1N36 E;  1ZM4 A;  3PYE A;  4JI7 E;  4AQY E;  1ELO A;  4DV4 I;  2AJ4 A;  4DV7 I;  4B3M E;  4YY3 E;  2A2C A;  2V2V A;  4DR4 E;  4X65 E;  1N0V C;  3LPS A;  2UU9 E;  1FI4 A;  3H4L A;  2UXD I;  4XTJ A;  4LF6 E;  4X62 E;  4DV2 E;  3PYD A;  2UXC I;  4WUB A;  1NZ0 A;  1XNR E;  1IBL E;  3GON A;  4MYU A;  4Z7Y A;  3J80 Q;  1HNW E;  4DR2 E;  1Z0E A;  2V2Q A;  1NHH A;  1N33 I;  4I3H A;  4X64 I;  1MU5 A;  2R3V A;  4FWD A;  5IWA I;  4LF5 E;  4LFA E;  1HR0 E;  4DR1 E;  4DU7 A;  1IBK I;  1N32 I;  2DEI A;  3ZZ0 A;  4JI2 E;  2R42 A;  4JI5 I;  1ZM3 A;  1H7U A;  4OX9 I;  4B3S E;  3ZM7 A;  1HNX I;  4YHH I;  3B78 A;  4X66 E;  4JI4 I;  1KIJ A;  2UXB I;  1N36 I;  2CZ9 A;  4LF9 E;  1A6F A;  1MG7 A;  5GME A;  3J81 C;  4JG4 A;  2E1R A;  4B3M I;  5BR8 I;  3Q1Q A;  1BKN A;  4DV0 I;  5GMD A;  1N0U A;  4FW9 A;  4LF8 E;  4KQV A;  2E5L I;  4DUZ I;  1U2R A;  2VQE I;  1J5E E;  4LF7 E;  4DR7 I;  2VQF I;  3T1Y I;  1XMO I;  1I94 I;  4DV2 I;  4FN5 A;  1KVK A;  1IBM I;  1HNW I;  2HK3 A;  4DR2 I;  5FLX Q;  3PYF A;  2UUC E;  1B63 A;  4PRX A;  3J7A M;  2EFG A;  3WU6 A;  1HNZ I;  1H73 A;  1PIE A;  1FJG E;  4M1K A;  1H72 C;  4JI0 I;  1Z0W A;  4LFA I;  4JI8 E;  5LL6 R;  2V8P A;  4B3T E;  1RRE A;  4MYT A;  4DV3 E;  1XNQ I;  3ZZU A;  4JI6 I;  4DR6 I;  3WU5 A;  4B3R E;  1NHJ A;  4B3S I;  1S4E A;  2HHH E;  4DR5 I;  3V5R A; 
#chains in the Genus database with same CATH topology
 4OO1 D;  1D6T A;  5JEA C;  2ZIT A;  2PNL A;  2ZM6 I;  4GQU A;  4DPY A;  5LMN E;  1N34 I;  1KKH A;  2LJP A;  2NN6 E;  5L3J A;  1S16 A;  4J3D A;  2A2D A;  4DV1 E;  2NN6 D;  4P7A A;  4DV5 E;  4R1F A;  4JV5 I;  1J5E I;  1PKP A;  4LF7 I;  2JE6 A;  1Z0T A;  2C38 A;  4JI3 I;  4UTG A;  4AID A;  4MU0 A;  4DUY E;  2GO4 A;  2O1W A;  1Z5B A;  1HK7 A;  4P52 A;  4MU3 A;  2UUA I;  2BM1 A;  2UUB I;  1OYP A;  4GKJ E;  4LFB I;  3CDJ A;  2BR2 A;  1NHI A;  3WU4 A;  4DPX A;  3OTO E;  2IOQ A;  3QT7 A;  4DV6 E;  2GS8 A;  3M6A A;  1RR9 A;  2OI2 A;  1FKA E;  5A2Q C;  4BA2 B;  4DU8 A;  2X36 A;  4LFC E;  1UDS A;  1Z0B A;  4IFD C;  1Z0V A;  4JI1 E;  2WP8 A;  4B3R I;  4USM A;  2PNM A;  4HXZ A;  5C0X F;  4OO1 F;  4JI7 I;  1DAR A;  2Z5E A;  1ZXM A;  5DRQ A;  4DPT A;  1XMQ E;  2J7K A;  4AQY I;  2O1T A;  4FWG A;  3UHM A;  4YY3 I;  5JEA D;  2WP8 B;  4DR4 I;  4RPF A;  4X65 I;  5IT9 C;  2VES A;  1VIS A;  3K85 A;  2V34 A;  1Z0G A;  5LMN I;  2UU9 I;  4DV7 E;  2NN6 F;  2Z5B B;  3B8H A;  4DR3 E;  4LF6 I;  4X62 I;  4JYA E;  3T1H E;  3J7A G;  3JAM Q;  2JEA B;  1WUU A;  1XNR I;  4MU1 A;  4HYM A;  1IBL I;  4K0K E;  2CVE A;  4GKK E;  4DV1 I;  4LF4 E;  4DV5 I;  2CG9 A;  3P3C A;  4BA1 A;  4FWH A;  2UXD E;  5K36 B;  5DNL A;  4IZJ D;  3NZK A;  2UXC E;  1H7S A;  4PRV A;  2HKJ A;  3H1C A;  3WU3 A;  2Z5C A;  2GO3 A;  1FNM A;  5DRR A;  1K47 A;  4IFD B;  3PS1 A;  4LF5 I;  1HR0 I;  4DR1 I;  4X64 E;  5IWA E;  4IS9 A;  4FW5 A;  4WUC A;  1UDQ A;  4DXL A;  3Q6N A;  5C0X A;  2DEJ A;  4OO1 A;  1QZR A;  4FW3 A;  1YH8 A;  4JI2 I;  1IBK E;  1N32 E;  2PO1 B;  5LMU E;  2HK2 A;  4DPU A;  4HAC A;  4X66 I;  3CWV A;  4USK A;  4LCF A;  2HKE A;  2O1V A;  4PU9 A;  1Y60 A;  4Z7C A;  4JI5 E;  3HKM A;  2PO0 A;  3PRY A;  5JEA F;  2NN6 A;  3J80 C;  1EI1 A;  4YHH E;  4JI4 E;  4LF9 I;  2BV3 A;  4NXM E;  2WNR B;  2X7I A;  2UXB E;  2C37 A;  4ED4 A;  5FWK A;  4LF8 I;  2XEX A;  3LNU A;  1UEK A;  1EA6 A;  4U3B A;  5BR8 E;  1MX0 A;  4DR3 I;  1Y4U A;  3ZKB A;  2WW4 A;  4DV0 E;  4NXN E;  4JYA I;  3ZKD A;  3T1H I;  4K0K I;  2E5L E;  3GLL A;  4GKK I;  4LF4 I;  4DUZ E;  2F1D A;  2VQE E;  3B82 A;  4DPW A;  2UUC I;  4DR7 E;  2VQF E;  3T1Y E;  2C39 A;  2JE6 B;  1XMO E;  1I94 E;  2C38 B;  1H74 A;  3P06 A;  3HUL A;  3L7Z A;  3LTO A;  1XXE A;  1IBM E;  3GCM A;  1FJG I;  2C39 B;  5K36 C;  1Y5Y A;  2BR2 B;  3L7Z B;  4JI8 I;  2PO2 A;  2F4V E;  3M7N G;  2JEB A;  1HNZ E;  4B3T I;  3M7N D;  4KHP E;  2AE8 A;  4JI0 E;  4DV3 I;  3HJC A;  5JEA A;  4AIM A;  2PO2 B;  2ZBK B;  1Z0C A;  4HY1 A;  5JEA E;  5LMU I;  1ZM2 A;  3K1J A;  1XNQ E;  4JI6 E;  1Z59 A;  4DR6 E;  2HHH I;  3JAM C;  4URL A;  4EMD A;  5DRO A;  4ZVI A;  5FLX C;  4NXM I;  4DV4 E;  4DR5 E;  1ZM9 A;  4IZJ A;  5C0X C;  5A2Q Q;  1B62 A;  4OO1 C;  2ZM6 E;  4FW6 A;  1N34 E;  3P3G A;  1FWL A;  1Z5C A;  4NXN I;  1FWK A;  2Q2E B;  2HFU A;  4DUY I;  4MU4 A;  4LCG A;  4IZK A;  2NN6 C;  4MDT A;  3QT8 A;  4BA1 B;  4JV5 E;  3J81 Q;  4JI3 E;  3U1Y A;  4GKJ I;  2BM0 A;  4UT4 A;  3OTO I;  1OYS A;  1XHK A;  5IT9 Q;  1N33 E;  2NPF A;  2Z5C B;  1KTV A;  4DV6 I;  2VF3 A;  4ISA A;  4WUD A;  3Q6M A;  4OZE A;  2UUB E;  2UUA E;  5K36 D;  3ZZT A;  4LFB E;  3D4J A;  4IFD E;  3K17 A;  1Z5A A;  3QT6 A;  2F4V I;  3PS3 A;  2JT2 A;  3QT5 A;  4LFC I;  1USU A;  4IFD D;  4KHP I;  5C0X B;  4OO1 B;  4JI1 I;  4N3O A;  4OX9 E;  1HNX E;  1XMQ I;  1OJ4 A;  2V2Z A;  4HAC B;  3V2U C;  2HFS A;  1ZXN A;  3PYG A;  3F0N A;  1PVG A;  1RHY A;  1N36 E;  1ZM4 A;  2J65 A;  3PYE A;  2PO0 B;  1E3P A;  4JI7 E;  2NN6 B;  4AQY E;  1ELO A;  4DV4 I;  2AJ4 A;  5C0X D;  4DV7 I;  4B3M E;  4YY3 E;  2A2C A;  2V2V A;  4DR4 E;  4X65 E;  1N0V C;  3LPS A;  4LCH A;  1P42 A;  2C37 B;  2HHH E;  2UU9 E;  1FI4 A;  3H4L A;  2UXD I;  4XTJ A;  4LF6 E;  4X62 E;  4DV2 E;  3PYD A;  2UXC I;  4WUB A;  1NZ0 A;  1XNR E;  1IBL E;  3GON A;  4MYU A;  4Z7Y A;  3J80 Q;  1HNW E;  4DR2 E;  1Z0E A;  2V2Q A;  4QNJ A;  4QNK A;  1NHH A;  3U1K A;  5EL9 A;  5K36 F;  5DNX A;  1N33 I;  5DRP A;  4I3H A;  4X64 I;  1MU5 A;  2R3V A;  4FWD A;  5IWA I;  4LF5 E;  4LFA E;  1HR0 E;  4DR1 E;  4DU7 A;  4IFD F;  4BA2 A;  4NBQ A;  1IBK I;  1E3H A;  1N32 I;  2DEI A;  1R6L A;  2CGE A;  2O3Z A;  2JEB B;  3ZZ0 A;  3M85 G;  3M85 D;  2IOP A;  4JI2 E;  5JEA B;  3PS2 A;  2R42 A;  4JI5 I;  1ZM3 A;  1H7U A;  4OX9 I;  4B3S E;  3ZM7 A;  1HNX I;  4YHH I;  3B78 A;  4X66 E;  4JI4 I;  1KIJ A;  2UXB I;  1N36 I;  2BA0 G;  4LPF A;  2CZ9 A;  4LF9 E;  1A6F A;  1MG7 A;  2BA0 D;  2O1U A;  5GME A;  3J81 C;  4JG4 A;  2Z5B A;  2E1R A;  4B3M I;  5BR8 I;  1R6M A;  3Q1Q A;  1BKN A;  4IZJ B;  5GMD A;  4DV0 I;  1N0U A;  1OYR A;  4FW9 A;  2JEA A;  1Y4S A;  4LF8 E;  1UDN A;  3B4T A;  1Y6Z A;  4KQV A;  2E5L I;  4AM3 A;  4DUZ I;  1U2R A;  5K36 A;  2VQE I;  1J5E E;  3DD6 A;  4LF7 E;  4DR7 I;  1YHC A;  2VQF I;  3T1Y I;  1XMO I;  1I94 I;  4DV2 I;  4FN5 A;  3GME A;  1VI7 A;  5K36 E;  1KVK A;  1IBM I;  1HNW I;  2HK3 A;  4IZK B;  4DR2 I;  4IFD A;  5FLX Q;  3PYF A;  2UUC E;  1B63 A;  2IES A;  4PRX A;  2PNZ A;  3J7A M;  2EFG A;  3WU6 A;  1HNZ I;  1H73 A;  3P3E A;  1PIE A;  4MQY A;  2BA1 G;  1FJG E;  4M1K A;  1H72 C;  3CDI A;  4OKG A;  1Z0W A;  2BA1 D;  4JI0 I;  4LFA I;  4JI8 E;  4FW4 A;  2PNZ B;  5LL6 R;  2PO1 A;  4U3D A;  2V8P A;  4B3T E;  1RRE A;  4MYT A;  4DV3 E;  1XNQ I;  1UDO A;  3ZZU A;  4JI6 I;  2GQ0 A;  4DR6 I;  3WU5 A;  5EKW A;  5ELW A;  3P76 A;  4B3R E;  5C0X E;  4OO1 E;  1NHJ A;  1USV A;  4B3S I;  3KRN A;  1S4E A;  4FW7 A;  2IER A;  2WNR A;  4LOM A;  4DR5 I;  3V5R A; 
#chains in the Genus database with same CATH homology
 1D6T A;  2ZIT A;  2PNL A;  2ZM6 I;  4DPY A;  5LMN E;  1N34 I;  1KKH A;  2LJP A;  5L3J A;  1S16 A;  2A2D A;  4DV1 E;  4P7A A;  4DV5 E;  4R1F A;  4JV5 I;  1J5E I;  1PKP A;  4LF7 I;  1Z0T A;  4JI3 I;  4UTG A;  4DUY E;  2O1W A;  1Z5B A;  1HK7 A;  4P52 A;  2UUA I;  2BM1 A;  2UUB I;  4GKJ E;  4LFB I;  3WU4 A;  1NHI A;  3OTO E;  4DPX A;  2IOQ A;  3QT7 A;  4DV6 E;  2GS8 A;  3M6A A;  1RR9 A;  2OI2 A;  1FKA E;  5A2Q C;  4DU8 A;  2X36 A;  4LFC E;  1Z0B A;  1Z0V A;  4JI1 E;  4B3R I;  4USM A;  2PNM A;  4HXZ A;  4JI7 I;  4DPT A;  1XMQ E;  1DAR A;  1ZXM A;  2Z5E A;  2J7K A;  4AQY I;  2O1T A;  4FWG A;  4YY3 I;  4DR4 I;  4RPF A;  4X65 I;  5IT9 C;  1VIS A;  3K85 A;  2V34 A;  1Z0G A;  5LMN I;  2UU9 I;  4DV7 E;  2Z5B B;  3B8H A;  4DR3 E;  4LF6 I;  4X62 I;  4JYA E;  3T1H E;  3J7A G;  3JAM Q;  1WUU A;  1XNR I;  4HYM A;  1IBL I;  4K0K E;  4GKK E;  4DV1 I;  4LF4 E;  4DV5 I;  2CG9 A;  2UXD E;  4FWH A;  4IZJ D;  2UXC E;  1H7S A;  4PRV A;  2HKJ A;  3WU3 A;  2Z5C A;  1FNM A;  1K47 A;  4LF5 I;  1HR0 I;  4DR1 I;  4X64 E;  5IWA E;  4WUC A;  4DXL A;  3Q6N A;  2DEJ A;  1QZR A;  4JI2 I;  1IBK E;  1N32 E;  5LMU E;  2HK2 A;  4DPU A;  4HAC A;  4X66 I;  3CWV A;  4USK A;  2HKE A;  2O1V A;  4PU9 A;  4Z7C A;  4JI5 E;  3PRY A;  3J80 C;  1EI1 A;  4YHH E;  4JI4 E;  4LF9 I;  2BV3 A;  4NXM E;  2X7I A;  2UXB E;  4ED4 A;  5FWK A;  4LF8 I;  2XEX A;  3LNU A;  1UEK A;  1EA6 A;  5BR8 E;  1MX0 A;  4DR3 I;  1Y4U A;  3ZKB A;  2WW4 A;  4DV0 E;  4NXN E;  4JYA I;  3ZKD A;  3T1H I;  4K0K I;  2E5L E;  4GKK I;  4LF4 I;  4DUZ E;  2VQE E;  3B82 A;  4DPW A;  2UUC I;  4DR7 E;  2VQF E;  3T1Y E;  1XMO E;  1I94 E;  1H74 A;  3P06 A;  3HUL A;  3LTO A;  1IBM E;  1FJG I;  4JI8 I;  2F4V E;  1HNZ E;  4B3T I;  4KHP E;  4JI0 E;  4DV3 I;  3HJC A;  2ZBK B;  1Z0C A;  4HY1 A;  5LMU I;  1ZM2 A;  3K1J A;  1XNQ E;  4JI6 E;  1Z59 A;  4DR6 E;  2HHH I;  3JAM C;  4URL A;  4EMD A;  4ZVI A;  5FLX C;  4NXM I;  4DV4 E;  4DR5 E;  1ZM9 A;  4IZJ A;  5A2Q Q;  1B62 A;  2ZM6 E;  1N34 E;  1FWL A;  1Z5C A;  4NXN I;  1FWK A;  2Q2E B;  2HFU A;  4DUY I;  4IZK A;  3QT8 A;  4JV5 E;  3J81 Q;  4JI3 E;  4GKJ I;  2BM0 A;  3OTO I;  5IT9 Q;  1XHK A;  1N33 E;  2NPF A;  2Z5C B;  1KTV A;  4DV6 I;  2VF3 A;  4WUD A;  3Q6M A;  2UUB E;  2UUA E;  3ZZT A;  4LFB E;  3D4J A;  3K17 A;  1Z5A A;  3QT6 A;  2F4V I;  3QT5 A;  4LFC I;  1USU A;  4KHP I;  4JI1 I;  4N3O A;  4OX9 E;  1HNX E;  1XMQ I;  1OJ4 A;  2V2Z A;  4HAC B;  3V2U C;  2HFS A;  1ZXN A;  3PYG A;  3F0N A;  1PVG A;  1N36 E;  1ZM4 A;  3PYE A;  4JI7 E;  4AQY E;  1ELO A;  4DV4 I;  2AJ4 A;  4DV7 I;  4B3M E;  4YY3 E;  2A2C A;  2V2V A;  4DR4 E;  4X65 E;  1N0V C;  3LPS A;  2HHH E;  2UU9 E;  1FI4 A;  3H4L A;  2UXD I;  4XTJ A;  4LF6 E;  4X62 E;  4DV2 E;  3PYD A;  2UXC I;  4WUB A;  1NZ0 A;  1XNR E;  1IBL E;  3GON A;  4MYU A;  4Z7Y A;  3J80 Q;  1HNW E;  4DR2 E;  1Z0E A;  2V2Q A;  1NHH A;  1N33 I;  4I3H A;  4X64 I;  1MU5 A;  2R3V A;  4FWD A;  5IWA I;  4LF5 E;  4LFA E;  1HR0 E;  4DR1 E;  4DU7 A;  1IBK I;  1N32 I;  2DEI A;  2CGE A;  3ZZ0 A;  2IOP A;  4JI2 E;  2R42 A;  4JI5 I;  1ZM3 A;  1H7U A;  4OX9 I;  4B3S E;  3ZM7 A;  1HNX I;  4YHH I;  3B78 A;  4X66 E;  4JI4 I;  1KIJ A;  2UXB I;  1N36 I;  2CZ9 A;  4LF9 E;  1A6F A;  1MG7 A;  2O1U A;  5GME A;  3J81 C;  4JG4 A;  2Z5B A;  2E1R A;  4B3M I;  5BR8 I;  3Q1Q A;  1BKN A;  4IZJ B;  5GMD A;  4DV0 I;  1N0U A;  4FW9 A;  1Y4S A;  4LF8 E;  1Y6Z A;  4KQV A;  2E5L I;  4DUZ I;  1U2R A;  2VQE I;  1J5E E;  4LF7 E;  4DR7 I;  2VQF I;  3T1Y I;  1XMO I;  1I94 I;  4DV2 I;  4FN5 A;  1KVK A;  1IBM I;  1HNW I;  2HK3 A;  4IZK B;  4DR2 I;  5FLX Q;  3PYF A;  2UUC E;  1B63 A;  4PRX A;  3J7A M;  2EFG A;  3WU6 A;  1HNZ I;  1H73 A;  1PIE A;  1FJG E;  4M1K A;  1H72 C;  4JI0 I;  1Z0W A;  4LFA I;  4JI8 E;  5LL6 R;  2V8P A;  4B3T E;  1RRE A;  4MYT A;  4DV3 E;  1XNQ I;  3ZZU A;  4JI6 I;  2GQ0 A;  4DR6 I;  3WU5 A;  4B3R E;  1NHJ A;  1USV A;  4B3S I;  1S4E A;  4UT4 A;  4DR5 I;  3V5R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...