1HR0J

Crystal structure of initiation factor if1 bound to the 30s ribosomal subunit
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
98
structure length
98
Chain Sequence
KIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPFKHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of an initiation factor bound to the 30S ribosomal subunit.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 9
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2000-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 1hr0J00
4LFAJ 4LF6J 1I94J 2E5LJ 2VQFJ 4PWWA 4RJVA 3T1YJ 4LF4J 4KYZA 4DUZJ 3D3BJ 5IT9U 5FLXU 5IWAJ 1IBLJ 4LFBJ 1XMOJ 1N34J 4DV2J 2MQ8A 4DV4J 1HR0J 4JI8J 4AQYJ 4GKJJ 5LM7E 4LF7J 4B3RJ 4X66J 4DR6J 4YHHJ 5LMNJ 1N32J 3R2DJ 4LF8J 5AJ3J 2MTLA 4JI4J 4DV3J 1IBMJ 4JI0J 4LF5J 4DV1J 4LFCJ 5LMUJ 4DR5J 4DR4J 4K0KJ 1HNXJ 2VQEJ 4YY3J 4JI1J 3OTOJ 2HHHJ 4DUYJ 2ZM6J 4DR3J 4B3SJ 4OX9J 4NXMJ 4DV6J 4KHPJ 4X65J 3D3CJ 2KL8A 2UUBJ 4NEZA 4KY3A 3J81U 2UXDJ 1N33J 3IMQJ 1XMQJ 2UXBJ 2KVQE 4JI6J 4LF9J 4JV5J 3J7AN 4HHUA 4JI5J 4DR7J 4GKKJ 1FJGJ 4JI2J 2UU9J 4JYAJ 3JAMU 4DV5J 4B3TJ 3T1HJ 4DR1J 4NEYA 4NXNJ 2UXCJ 1XNQJ 4DV7J 2MEWA 4DV0J 1HNZJ 2UUAJ 1IBKJ 4X64J 3R2CJ 3W1YC 4X62J 5BR8J 2F4VJ 1J5EJ 2UUCJ 4V1Ak 5A2QU 4B3MJ 3J80U 4DR2J 1N36J 1XNRJ 4JI3J 1HNWJ 4JI7J
chains in the Genus database with same CATH superfamily
1S1TB 2E66A 3BJYA 2HHWA 3FZ2A 3M2VB 5K9FA 1WC6A 1ZOTA 1HPZB 2YQ1A 1LXJA 3MCNA 2PMZD 4BWJA 2CVEA 3ISZA 2HFVA 2JOQA 2NZCA 2RF2B 3M2RB 1DRZA 2CQPA 3BEGB 3DOKB 3H59A 3G6VA 1FJ7A 4ZVHA 1WD6A 3D9BA 5HP1A 2I2YA 3TARA 2RDIA 4DUTA 2MQPA 4X64F 1MW7A 6AT1B 4DFMA 5HROA 1X8DA 2MQ8A 2BOPA 2PI4A 2KB2A 3R5GA 1RAEB 1FTRA 2O5DA 3BS9A 2RDJA 3L4BC 4AQYJ 3QLHA 2XS7A 2MJNA 5KTQA 2X1AA 1QSLA 3HVTA 4NA2A 4PG8A 2HKEA 1RT3A 5KFZA 5AE2A 2ZOFA 3CD7A 1S1XB 2XMJA 3JTNA 4YHHJ 2XO6A 3CUNA 3PX4A 4LF8J 1KS2A 1PYOB 1O6XA 3TVZA 3SQOP 2FVSA 4C3LA 3N79A 3SIPB 2KZMA 3MM5A 3S1TA 5KG1A 5KG6A 2IPOB 2JFKA 4IDKA 4WIIA 2VC1A 2ZDPA 5KFHA 3K5LA 4YN3B 4NYOA 2PMHA 3DLLQ 5DDOC 4OL8A 2GMJA 4HDHA 2DRDA 4OZLA 4Z7YA 1KTVA 4P74A 2KJWA 5ETRA 1RUSA 3P96A 4ANEA 1X4AA 5HJXA 4Q44A 3TQ1A 5C42A 2GJIA 3DI6A 5H1SV 2ADCA 3NWGA 2HLUA 3Q8RB 4DN9A 1UVIA 2NYHA 1IM4A 1ZPVA 5ETLA 3K5OA 3T6BA 3MPVA 4CNZA 5CA5A 4RNNA 4DLGA 4M1KA 5I4MA 3P5TL 3RB0A 2DCUB 3MCOA 2JRSA 4FYDA 2ASYA 1V3SA 2ZM6J 1HW8A 5DM7Q 3BSCA 1KOOA 2ALYB 4HTIA 3CCLS 2AJ4A 1RTJA 5HN0A 2CDQA 3VHQA 5IC6B 4IFYB 2CDRB 3CULA 1UFKA 4PXEA 1MWYA 2G0JA 1NZ8A 2KT2A 4OZ2A 4DFKA 4ILLA 5JMNA 2XS2A 2KKHA 3M6VA 4PWDB 2UXCF 2G13A 2WHOA 2AJ2A 3O3LA 4FS1A 3ZTOA 1IJFB 2E7WA 3C16B 5L9XA 3EZUA 1HBOB 3T19A 5B0CA 7FDRA 3H25A 3M2VA 3PW4A 1TELA 2H48B 4TQSA 2B9EA 2RS2A 2N7CA 5SUHA 3BKUA 4BDPA 1AZSB 1UWAA 2VUGA 3M8YA 2AIRB 4TVAB 1NU4A 5IWAF 3OLAA 3MUVP 2Y8YA 1IKWB 2N4DA 3LP2B 4USHA 1T3OA 2GS8A 3FC9A 1Y7PA 4MFBA 1S1WA 4BCAA 4WKRA 4NLRA 1JLBA 1QM9A 1RLCL 3JTPA 1NK8A 3VGTA 1S1UA 3QIPB 4F3MA 4DV7F 1DZ5A 2GVZB 3VQSA 4LJMA 3KUGA 4RW6A 4ZVSB 4ED3A 2GHVC 4OYWA 2XEXA 3JSMB 1T8EA 3SFUA 3MMBB 4X4VA 3ENVA 1WHWA 2CPIA 2ZVSA 3L09A 5KOWA 5K8OA 5KFJA 3TUPA 1GXLA 1TMJA 3PY8A 1NKCA 3PYEA 1QUVA 3T5KA 2QLXA 1TK8A 1KD1T 5HBMA 1U48A 1CBKA 1E6VA 3CW2C 2Q6BA 3A3NB 3E51A 1RT1B 4Y34A 5ETPA 5HAOA 1KQFB 1L3VA 2XNRA 1FRMA 2PC6A 4I6YA 4YQWA 1N54B 5AXNA 4DSJA 3S8SA 4YOEA 4LVNP 4OX7A 4M5KA 3JXOA 3VTIA 1N52B 3GFXA 3X3UA 2VASA 2YX4A 3GFZA 5LXRA 5HLFA 4NYPA 1XMQF 1KHWA 4FPRA 2QFIA 1U24A 2W7AA 1MU2B 3CCJS 1RT4A 5HBMB 1GMWA 2M3DA 3CCQS 3UCUP 4GC7A 2XMUA 2VB6A 1U1NA 2IYIA 3E01A 1IBMF 5DRKA 3MHYA 1RAAB 5F0WA 4O3OA 2KVIA 3KLHA 1H7XA 1NK6A 1GX6A 3U1LA 4OI4A 1PAEX 5DQIA 1KLNA 3JSRA 1EP4A 5E3QA 5IOLA 2ZFHA 2W4CA 1OS5A 4HL9A 3FBEA 2BX6A 4FKXA 4RW6B 1HWIA 2ZZTA 5LM7E 3AD8C 4B9MA 3IM9A 3KLEA 4P2XA 4J37A 2K8GA 3R1HA 5F8HA 3F44A 2IJNA 4JOUA 3DLGA 2BANA 4YY3F 4EBEA 2R7XA 3HX9A 1APSA 1TKZA 2VOOA 3MM7A 3NS7B 1QTMA 2U1AA 5D78A 4EEYA 3OVBA 3LGMA 1RBOB 3DDNA 2FGOA 4HDGA 2F63A 1OYEA 3EVWA 5E41A 1RA6A 1XEZA 4DUZF 1RTDA 5E3PA 1OY9A 1S5ZA 1S9GB 2BM1A 3QGHA 1X4HA 1KRPA 4LFCJ 3OUYA 1TK5A 1I94F 1QE1B 1RT5B 2BE2A 3W8GA 3N6LA 4LFAF 2A10A 1FRJA 1JLBB 1FXDA 2HSEB 3CO0P 3KLIB 5D3GA 1UFWA 2J9DA 3FRYA 2W2OP 4LVOP 3D5MA 3MEDB 5T7LB 1F5BA 1NDCA 4P75A 2YXLA 2AEMA 2ROEA 2HQIA 1YJNS 1G1XA 3JSMA 1IWAA 1X4DA 2E1MC 3J7ZT 2WBRA 1L3SA 4IQMA 3HM9A 1N5QA 3O6QA 1R0AA 4ETXA 2B43A 3C14B 4FXWA 3C16A 1XMOF 1TKTB 2DO0A 4Y2KA 1D9FA 4LF8F 4ERDA 3W2VB 3D68A 3CJ0A 4WK3A 4N56A 3T41A 4YMEA 1BWEA 3RAMA 2XWYA 4AUKA 1X0FA 4C8YA 2DGSA 2EPIA 2QEXS 3ENQA 3FSIA 1DTTA 2H9ZA 3LP1B 3SBMA 2FZCB 4LF9J 2DHGA 4P7TA 2FDNA 3SCKE 1S6PB 3NGSA 4ED6A 3V81B 2BOAA 2YKOA 3TA1A 4XDDA 3DGPB 3M30B 5EHHA 2WB1D 4QYZK 4C9DA 1FHTA 3Q83A 2W9BA 2XM3A 3FCHA 1JWWA 1PILA 2DGWA 3H98A 4OYOA 4RUBA 4A8OA 1WUUA 3E3XA 3ILLA 4I56A 2P6SA 5DGAA 4LIRA 2IAJA 1N5YA 4RKUC 3HI9A 4ZIVA 1HWLA 2E9ZA 2MLZA 2OTJS 1TUWA 2VJUA 2XNQA 2JLGA 2JLFA 2XZTB 5KFMA 3LGHA 4IOBA 1HNZJ 4DV4F 4O3SA 2HZVA 1B70B 2J9CA 4RW4A 4NCBA 2B0GA 1TKZB 1TUGB 1GNKA 3DGVA 2R8HA 3PJ9A 1X5TA 1Z2ZA 4LRFA 4DSIA 3O1LA 5C5JA 2DRBA 2AJFE 3MPUB 2ZEJA 5D6GA 2A6OA 2ACYA 3AD7C 2MB0B 1WNEA 2NXNA 3UN3A 4M5JA 3PVXA 4I2PA 3EMTA 3JSBA 1I5OB 1AYEA 3HK2A 3HSZA 4ECZA 1UZHA 3SFGA 1I6JA 2HQGA 3LP0A 3UO0A 1PJ6A 4KJIA 4FYWB 1TFYA 2W24A 4ZA1A 2UVVA 2RJZA 2J6SA 2HS4A 4ECQA 3BZQA 4I68A 2AU0A 1FK9B 1PYSB 2XYHB 5FLXY 4FYVB 2PI5A 1OIAA 2EG2A 4MJKA 3M9NB 4FP9A 1FT8A 1GXTA 2WSFC 3BO2A 3D1HA 4PPZA 3UI3A 5HVFA 4HR2A 4F50A 1SUQB 1X60A 3HFZB 2XI2A 4P6QA 2H5IB 2WRMA 3MZIA 2N4CA 1S9GA 3OTCA 1N88A 1NPKA 4FNHA 3MEEB 2VOPA 4NE9C 1CC8A 4OYXA 4NA1A 2Q3PA 2ZC3A 3EGWB 1RAJA 1TL5A 5GAEU 3MAQA 2HHSA 2YKPA 4N7TA 4HH1A 3WHIA 2NR0A 1JLFA 1R0BG 1GMWD 4A8WA 1U6BA 3A8KA 5I3UA 5DDRC 3O2IA 5J1PA 2CWKA 2ZKUA 1RHJB 4LF5J 4DV1J 4KHRA 4YR0A 2D9PA 2CQBA 3CCES 4WXOA 3KLEB 3DLHA 3I5CA 2DNOA 4YB1P 4FBUA 4RW7A 4CCHA 3NAIA 4U8VA 4DL0C 2AWZA 4K0KJ 4NOHA 4YY3J 2AJ1A 4YS2A 5F9LA 2LEAA 4DL3A 2YWEA 3GU0A 3HZEA 4LRBA 1NJXA 3IRWP 2GZOA 2CZVC 1KQSR 1D0EA 3IFEA 4M5NA 4TU8A 4M5GA 1CS4A 3IS9A 4F2SA 1U1QA 3KLFA 1P8GA 2YKNA 3GTYX 2HNZA 4CO3A 2UUAJ 1JLEB 2QX0A 3QT6A 1DFDA 4DX8H 1D3WA 3OJUA 3NNCA 1ZH5A 1Q7LB 2YNHB 4LF2A 3F41A 4DXLA 4ZP7A 4N47A 4ILMA 2QYGA 3NCQA 3H4DA 2ZJQQ 3T5JA 4QIVA 1WC1A 3EVMA 3KG1A 3I96A 2KFYA 4OI0A 2VPWB 4P2SA 1WC3A 2BA9A 2LLZA 3NKYA 2OGUA 2XWXA 3IMQJ 1FO1A 3M8QA 2NUHA 5KG5A 5T14A 3U27A 2L9DA 3POTB 5IM0A 2LEBA 1XMQJ 4CT8A 3KK2B 3P3DA 1RYSA 2ZBCA 4DDFA 4WJBA 3DRPA 4WFAQ 1AROP 4WF9Q 3ULHA 4KV8B 3OSNA 5FD1A 3OLBA 1CJUA 4J9RA 4QWCA 4C8OA 1VQYA 1YJTA 2XY5A 1B64A 3QJLA 2FJBB 1S9EB 2HIYA 2DTJA 2QLBB 4USWA 3RBEA 1ZTTA 4KTQA 2VC0A 3R7NB 3K5NA 1M5VC 1PGZA 1FWLA 2RQKA 3AQOA 1VR6A 4I6WA 4NEYA 2G0CA 2PD1A 2RMLA 4QW8A 2BVZA 3B8HA 2H54B 1K0TA 5D15A 3AB2B 3I6PA 2V8HA 3Q86A 3DM2B 2LKZA 2OLWA 4BHQA 2RKIB 2M52A 4DV0J 4PUOB 4UOCA 1W26A 3TJ8A 1N34F 1YLXA 2NXEA 4XTTA 4WP9A 4OX9F 3PRDA 3LW5C 2CADA 2HEKA 2Z8QA 5EX0A 1U1OA 2OO4A 1N5YB 3CJ4A 1PC4A 1IKYA 1N5SA 4RWXA 2V8DA 1T3NA 5A2QU 2ZD1A 4RX6A 3FFIA 1F9EB 4BLGA 2R2TA 3VAJA 1U2FA 1WF1A 2JC0A 2CJBA 5F0UA 1QUPA 4TY8A 5CABA 5IT4A 3CJTA 4KR0B 4B9SA 1X4FA 4JI7F 2X1GA 4UY85 2FHOB 2O67A 1M5SA 1HNWJ 2LYVA 4KV8A 3PYDA 4F25A 3Q8SB 5K14A 3OL8A 4F4KA 4IRKA 1U8WA 5AXLA 3O44A 5JJBA 1YSJA 4QWBA 2M7SA 3MM9B 4ZLLA 4DS5A 1URNA 4KT0C 1YIJS 2H5JB 1HI1A 1FFGB 2GIFA 1JLEA 5LJ3Y 2CQ3A 1Y3JA 1TL3A 2HNYA 4MKAA 2LP4A 2V8VA 2V68A 4OQJA 5CQGA 4CLPA 4DV2J 4DS4A 5D0GA 5J2MA 1S97A 3JQMA 2M8DB 3TAPA 3PFEA 4U9RA 1FJEB 2OPQA 3BQ2A 1RZMA 3DRYA 1U25A 3KMSA 2YKAA 2H4YB 2MZQA 3DMJB 2G0IA 2H3EB 3FZBA 5LMNJ 2RRNA 2BE2B 4RW9B 4J9KA 5DZ7A 2DKOB 2LQ8A 3R3TA 3QIDA 2WVFA 1KWMA 2ZWPA 3ZTQA 4WFXA 2A2DA 3O8WA 1WC0A 4OYZA 3CWJA 1SKUB 5CYQB 4ETZA 5HL7Q 1LWCA 5F8LA 3K57A 3BQ0A 4CLFA 1UVMA 4ZCMA 1U0SA 3MECB 2ZH3A 4PG4A 2XB2D 2VFSA 2DB1A 3VWSA 2DVIA 4U67Q 1X31C 4O3NA 2IVYA 3RW7A 3A3OB 3ZTPA 4PQUB 1HBNB 2LXFA 4HACB 2BJ7A 2DCLA 4PR6A 5K8NA 2MQNA 4DG1B 3PW2A 1FNMA 4P73A 1OMSA 2GMHA 4B3SJ 4J9PA 1DLOA 3QT5A 1FF2A 1I1GA 1DQ9A 1LXNA 1NMEB 2DD8S 2R7QA 3X1LB 1U26A 2OSQA 2HWTA 3PXGa 4WTOB 2YWFA 4DZ6A 5JXSA 1ULRA 3SYZA 4UOFA 4KPCA 5B09A 2KL8A 3TX8A 1HBNA 2VPZB 4HACA 1RQ0A 4WKYA 3PW0A 4ZCKA 3MR2A 2IA0A 3PKYA 1FDNA 2BW2A 3GYGA 2M9KA 3RRHA 3TANA 3H2VE 2NYIA 3R5AA 3PX0A 4U7UD 5KFQA 4UUXA 4IG3B 1RWWB 3UPFA 1UPMB 1U4BA 1O51A 2DR7A 1A7GE 2Q43A 4A48A 2HQ3A 1LWCB 1UPPA 2MSTA 4I2QB 2F5GA 3PEJA 3SCIE 3FSYA 1YJRA 5IV4A 1LW2B 3EYZA 2Y0SD 4OZ3A 3RAXA 3ILIA 1FI4A 1S4FA 1S0OA 3BGRA 5KT4A 2HVHA 4PWDA 3R27A 3RB6A 4M5DA 3V2UC 3CCWA 3QBCA 3QAEA 1N32F 5KT5A 2AYEA 2IDLA 4X4OA 2K7KA 2E9TA 5LSRA 5C25A 1VDHA 5F3ZA 1S1VB 1MNEA 1YZ7A 2CJKA 5LT5A 4C8MA 2NREA 4GC6A 4RU9A 3NWRA 4TU7A 2PMWA 3MGJA 5J1EB 4PAAA 1BWVA 5L1JA 4CYUA 4ECYA 2KHCA 4B02A 5I42A 1UA0A 2OP5A 5EDWA 1S79A 3HD1A 4YDDB 2XMVA 2WK4A 3DHWC 2I5JA 4M63A 1XMBA 1ZPWX 2J7UA 2W25A 2YWKA 4IKAA 3TI0A 2FHJD 2GVZA 1GMVA 1UP1A 3CCVS 2D3UA 2CPFA 2ZITA 4ED7A 2IDEA 2UUCJ 1U0HA 2E5GA 2FVPA 2CPJA 5CYMB 4H4MB 4DR2J 2W2MP 1JNZB 3T5HA 4F8RA 1DAXA 1LKZA 2FJAB 4B9NA 3W61A 1C0TA 4LRCA 1S0VA 2QJ3A 4AXIA 4ZPAA 4DR7J 3OV7A 2K2PA 3FGVA 1HHSA 4ENOA 4B3MF 2UZAA 2BKPA 2CUYA 2RUGA 1HMVA 1YJVA 3L7OA 5L39A 3M1VB 4MFBB 4Y0FA 1OWXA 4ANDA 3OSPA 3FBBA 2OEJA 2YKQA 2ZH5A 1K8AT 2ZNYA 1TU0B 3EJMA 2X1FA 2OEMA 2V9KA 2MSSA 2V50A 2V4QA 2XYGB 3R5CA 1HNVA 2VG6A 3UCGA 1D9DA 1XNQF 1SJ1A 5D8HB 3MM6A 5E3RA 4Y2MA 2B9XA 2U2FA 2M88A 2MLYA 3DM2A 3JAMY 5DETA 5KFWA 1H74A 4I69A 3B78A 5HP1B 1RT5A 3HZGA 4FYYB 4C8NA 3T1HF 2LCWA 4UUWA 1F2GA 2ZZMA 5JVGQ 3UW1A 5IM0B 2ACMA 1DTTB 4DMZA 1RTIA 1K1SA 3KK3B 3I9V9 2VDHA 6FDRA 4ELVA 1YDLA 3DLEB 4G1IA 1N5VA 4QR1A 3M6WA 3FSXA 4WCEQ 1J5OA 2BRLA 3UD5A 3EGVA 4KAIA 4AL6A 1CJKA 5GAEI 3TX0A 4N41A 2W7PA 1YRTA 2KTQA 2QA2A 4K4VA 2XZDB 2YVSA 5GAGI 3NGUA 2L3MA 1WOPA 1X5PA 2HHHJ 2DISA 4X66F 4LR9A 4OHYA 2W1BA 4Q2MA 1PO6A 4QIWD 4NLSA 2JEGA 2DHSA 3MCSA 4MYUA 3VQTA 3TYTA 2KM8B 4ED5A 3KNGA 1VRUB 1ZTWA 2B6AB 5KT7A 1RAHB 1VQOS 3DRPB 1O0PA 3EE3A 5GVQA 4EFAC 4O0NA 3HPOA 3EPIA 5C24B 5CXTA 3NY0A 1A6LA 3NMAA 5T7LA 2VBWA 5ETSA 1N8RT 3BO3A 4NWBA 1ZAWA 1RT3B 4M5DB 2ZHBA 4PG7A 1U1PA 2AGOA 1S48A 5C7PA 2XQCA 1JQGA 3ZZRA 1UW4A 3KG0A 1GFWB 3TAMA 1LEOA 3RG6A 2QL9B 2LVWA 5M2PA 1Z2LA 2GHWA 1WI8A 1C1BB 1CQNA 2MPUA 3EVOA 1S99A 3M6UA 4WWSA 5KFVA 2KG0A 2OPPA 4OHXA 4FPIA 3MAHA 3VGSA 3C6TB 4ICLB 3U7JA 2HMIB 3CO9A 4Q0BA 3BGOP 5H9FJ 3DCAA 3OVSA 1U1RA 3MOZA 2OEKA 3G6ES 3V6DA 4WU3A 2XMTA 5B0DA 4ZJQA 1E6VB 1KFSA 4OV1A 1Q8KA 2GGPA 1FRLA 2YKMB 3OTBA 3UN5A 4NZ6A 2F8HA 5JUMA 1RAGB 3IS9B 4U7UK 1BHNA 2C3UA 4CQ1A 5A8WB 4AL5A 2KFZA 1NLKL 4LQ3A 1WKLA 1KTQA 2RU9A 1N0UA 1NPRA 1T03B 1YITS 4J91A 1FRIA 5EX3A 2VZ9A 3RUBL 2YWWA 3WX8A 1NXIA 3G6YA 1NH7A 4RL1A 5J2QB 2EFNA 1F2HA 4K7QA 1S0MA 4P10A 4PXCA 3KMQA 1R0CB 2DNLA 4GKKF 5A8KB 1C2PA 2CNNB 2CPYA 2V67A 4AL7A 3L7PA 2N82B 4IG0A 1A0OB 3DU5A 1FRKA 2QYCA 3OXFA 4J5OA 2CQCA 4MTPA 1P1LA 4WU2A 1I3OB 3PO4A 3I5BA 3VAMA 2CPZA 5DS7A 1RDRA 4Q8FA 5KFXA 3QJPA 4LFAJ 1EETA 3G6XA 2CKWA 3MR6A 3G9CA 3CVKA 3LANA 3CTRA 2E5LJ 4G1QB 1C1BA 5J1NA 3U1MA 5LMUF 1WC5A 1RWMB 2LEPA 4ZVQB 4JI2F 3BO4A 4GVLA 5KFRA 4P7VA 4DUZJ 3VVTA 5IWAJ 1NAQA 1H2UX 1IBLJ 4X62F 2GO8A 1C1CA 2VG7A 2J8SA 3MF5A 3N4WA 2BJ1A 2VPXB 3VF0B 2L41A 2B6AA 5AJ3F 5ETTA 1NK5A 1QSSA 3RRKA 4ZP8A 3KYLA 1U1MA 3Q22A 3NMRA 2DNRA 3M2UA 4K4SA 5KT2A 3K5PA 2CA9A 2I9SA 1FDAA 3HCXA 1J5OB 2DYAA 3GSIA 5BYSA 4YR2A 2R2RA 3QSYB 4DR6J 2B7BB 1VQ9S 1RTZA 4WFBQ 3EWGA 3SDEB 1UTAA 3VALA 1U02A 1SKSA 1VIOA 2BE9B 2RS8A 1BQMB 4USJC 5AJ3J 3KK1A 2AGQA 3SZ2A 2FLNA 2KO1A 4PYDA 4ZP6A 5D0RA 3S7RA 2J0XA 2QE5A 1Q7YT 4B9LA 3MM6B 4J90A 3MOJB 3AOCA 1NEEA 4OI3A 1SH3A 4RNHA 2DNGA 3R6LB 5LMUJ 4E98A 1HFEL 3H5UA 2UV8A 1TL4A 3HVWA 1EB0A 4NPOA 1ROFA 2R8JA 1VQNS 4I0WA 2IRYA 2P8IA 2KRRA 2F8EX 4PG6A 2C1EB 1JLCA 4R5PA 1HBUA 4USUA 1WJ9A 2JJ4D 5I3PA 1JJCB 4NLDA 5DZ6A 3R8YA 2ZJRQ 1MMNA 2EK1A 1W2IA 4CYUB 3CDEA 3UE2A 2ZH6A 5J2NA 1UJ4A 1JXLA 1KVJA 1ZS6A 4ZVRB 1X4BA 3D3CJ 5LOQA 4YHHF 1UMJA 4L73A 5CZXA 1G6BA 1D8ZA 1WG5A 2CVIA 2GO9A 1F9HA 1WSVA 2YNIB 1R89A 3AOBA 1CS4B 1NM2A 3G82A 3KFWX 4A47A 1S9EA 4J9VA 4U6PA 3WX4A 4CT9A 3SSSA 5K5MA 5THWA 3PZPA 4DQIA 2KVQE 5B0GA 3IG1B 1GTHA 1S1VA 1SH0A 1TKTA 2CJAA 3AT1B 1KC8T 3P4UB 1DQAA 1HPZA 4FVMA 1AT1B 3BV8A 2RU3A 1RGVA 2FHJA 2XMAA 2AX1A 2IC3B 4KH0B 3H7HB 4L3NA 1N0VC 4ZVUB 3QWPA 1NZAA 5HO4A 3P5BP 5D77A 1VC5A 1NSKL 2HFUA 4YB5A 5CHCB 2HLTA 2KFNA 3LPEA 2AX0A 4FF1A 2V4RA 2FTRA 3AFGA 5IQQA 1SV5B 2VHGA 2GAHC 2ZBRA 2Y1IA 3IWXA 3PX6A 1OPIA 1FEEA 3LALA 5B0EA 3R7BB 3UR3C 5CCMA 3UD4P 1N36F 4QU6A 2UXCJ 1V3RA 1ELOA 2H51B 3MAAA 1EJ7L 2MEWA 1TR0A 3CT9A 4NA3A 4ZVEA 2GV1A 4ITSA 1D09B 2GQQA 1FE0A 3BH7B 3CNQP 3N01A 2EFVA 1LK5A 2J5AA 4CTAB 2J76E 1FKOA 4DFJA 1K9MT 4N76A 4LMZA 4X4SA 1L3UA 1BY9A 2CJYB 2Y1RI 2B5JB 3EXYA 3HHLB 1T02A 3G71S 2YH1A 1SJ3P 4DSKA 2AJQA 5FJ4A 2PSZA 2COLA 3K89A 4RU2A 4AFFA 1FVQA 2MQMA 3NCPA 1RWXB 3DDIA 4V1Ak 3A12A 3VCDA 4ECRA 5A8WA 1AUDA 2OTLS 1TL7B 2WAQD 2FC8A 5ADZA 3EDQB 2IYGA 4RW7B 3EPGA 3UDLA 4DR1F 4I4BA 3GP9A 1XNRJ 2UXBF 3G86A 4CTAA 3QQCD 4YB6A 2QLFB 1FKAF 3ICLA 1TQLA 3LA0A 4CH0S 1NRKA 2XI3A 4K4ZA 3M32A 4U96A 2UUBF 3AJDA 2ILZA 2B7CB 1UWBA 1WOSA 1RP5A 1YQHA 2BJEA 1RCXB 1M1GA 1FNOA 1N5TA 1RA7A 3GJTB 4FDFA 1JXVA 2LXIA 1HQUA 4UQTA 2XLJA 1GTEA 1HLWA 2RH3A 4I7FA 3ZZOA 4A8MP 2KJVA 4WYLA 3ISNC 4F4XA 1VRUA 1RACB 2C22A 4A8SA 3P6YC 3R6GB 2UUAF 2X3GA 2FGCA 4ES2A 1VK8A 2VPYB 4Z7CA 5J2NB 2HVZA 2XC9A 3DKDA 4PWUA 2NXJA 2E1CA 4LF7J 3M05A 2E1AA 3OFFA 2BJ9A 4USVA 1U1LA 4GKJJ 4OJ3A 4WIQA 2EEYA 2MKCA 1H73A 2B4UA 1RISA 3M8ZA 2IM0A 4MKBA 3EZ5A 2IMOA 1H2TZ 2YWHA 4A8QA 2CG8A 4ID5B 2M2BA 1B0VA 1IJEB 4MK7A 4QR2A 3UDCA 1TVRB 4CLKA 3MM8B 3D2WA 1SKRA 2E9RX 3MI7X 3I4PA 4K4YA 2FIUA 1SC6A 2CG4A 3GFYA 4LSLB 3TUIC 1S10A 4C0HA 4NYZA 2XSJA 5ETKA 5KFCA 2DNYA 1OJ4A 2E29A 4Y3CA 3THTA 3C19A 3DRRB 1T7PA 1IKWA 2ZUGA 3LP2A 4NLOA 4R25A 5DLFA 1T05B 4X4TA 2RDDA 3DLKB 4HT5A 4DOZA 4KGKA 4P9SA 1RT6B 2APOA 1JJHA 3W8PA 3BN7A 4JV0A 4DR2F 2XO7A 2OD6A 5CYQA 4DL2A 1CJVB 3G96A 5A76A 2DGOA 2CQ1A 3Q8QB 1DJ0A 1U1KA 4MIAA 3CIMA 2W9CA 4E8UA 4ED2A 1TL3B 1WTBA 2V2ZA 4ZKAA 2JH3A 3OT9A 4L74A 2CPEA 1HBOA 1TUVA 2VH7A 4DX6A 2FJXA 4L72B 2J7KA 4L75A 1CEZA 1VI7A 4TXSA 1OY8A 3PACA 1HBUB 5C2CA 3HVTB 4ZVTB 4P72A 4Q2LA 4PEOA 5F8GA 3PR5B 3J81U 1NJWA 2PFDA 2RIJA 4OI1A 3KDNA 2VBYA 1S49A 4ZHRA 4KC5A 1WTFA 2ZZNA 1T95A 4QYRA 1HYSB 1RU2A 5BXIA 1EETB 2HAFA 1BMQB 4UT4A 1CJTA 2B9YA 4K5RA 3FMWA 5J1EA 3ZZ0A 2F4FA 2O66A 5EWGA 1WF0A 3J7Z5 2MZJA 2RF2A 3F56A 2G9OA 3FVYA 3M2RA 2CQDA 3HF5A 4OYMA 1Q95G 4DU8A 4ED4A 2VU5A 4MIBA 2DPIA 2UU9J 3I4HX 4QIGA 2V69A 4DEZA 4CLTA 1M5OC 4NI2A 3U02A 3W60A 2PO4A 2EFQA 4KSEB 2J6TA 2MY7A 2FJVA 1JLCB 2YNFB 3T1HJ 1RT7B 2Y8WA 2L08A 2HRYA 5D0EA 3PJXA 3JSYA 2KDOA 2DIUA 5DG9A 2ZWOA 3NRBA 5D4PA 1UEKA 1T9XA 4DQRA 4I2QA 2R42A 4W4MA 5HANA 3OHBA 3KJVB 1LV5A 1XNQJ 2WVCA 2YBVA 3CIZA 1R31A 2R7OA 3NBPB 1D9AA 2WONA 3EICA 4X65F 1T11A 2CZ4A 3GCWP 1P27B 4HI2A 3JQKA 3BGUA 4UF4A 3KK1B 3CC2S 1H38A 1HL6A 2B8QA 1VQ7S 4Y00A 1TL1A 4CO0A 3OXGA 4ED0A 2GCFA 2ZBIA 2LQ5A 3E01B 2H1YA 2G4BA 4C97A 2DGUA 4IG3A 5E3CA 2B4PA 4NLTA 3KK2A 2HFNA 1YK9A 5CH7B 1IUJA 3DOLA 2EBGA 1EP4B 2J0QD 1HI0P 4FKYA 5E0OA 4C6AA 4LF6J 3M2UB 4JUZA 5CD4A 1UVLA 3R1LA 3QJJA 2YPZA 4PWWA 2GX8A 3HJVA 1R6YA 3NXZA 3DRSA 4KBIA 3UVJB 1DQ8A 3Q23A 2R9LA 2OPPB 3R5BA 3ILJA 4IO1A 1ZZNA 2C3PA 4OYBA 5FLXU 1VRQC 4JI5F 3CJ2A 4ZPBA 3DLGB 1JLQA 1FERA 1RAIB 3W63A 5LJ5Y 4WPAA 1RHRB 1YZ6A 2BEFA 2ZBPA 4LUBA 2YKMA 2G1DA 1YRUA 1UJ5A 3HVAA 3M32B 1P1TA 3BPDA 9RUBA 1FNXH 3OTOF 3RZAA 1L3KA 4WZQA 3J7YI 3HO1A 1F0XA 3MEKA 4H4KA 4DFPA 1HNXF 3VAHA 4DWIA 5IV3A 1R8BA 2D69A 4K4UA 4OLOA 2IHR1 2NQPA 2HFSA 3JS9A 4NCGA 4NXMF 1AB8A 2N3OA 2D41A 4ED1A 1FDBA 2X51A 4DV3J 4BC9A 2OPQB 3IR6B 3ZO7A 4DX7A 1RYRA 5HSPA 4JV5F 1B7YB 1PBAA 1Y10A 4OHZA 5KFEA 2JFDA 3ADAC 3TQEA 1QAYA 4Q0BB 5J2PB 1IWGA 2NUUG 4RW9A 1DY3A 2ZHOA 4F36A 3T9NA 1WORA 3G2XA 2VQEJ 1HNWF 1SIZA 4WFNQ 4J9SA 1MU2A 5C24A 2BKOA 4IOCQ 2CPDA 1BXNA 4LR8A 1VBXA 5KT3A 2Z57B 3HFKA 1YJWS 5K8PA 1XERA 4U7CA 4G3IA 4PG5A 2E7XA 1KEKA 4J9UE 3DLBA 4OX9J 4LREA 5KG3A 5LXYA 2N3LA 3RU0A 1E6YB 1N6QA 4KHPJ 3QFWA 4X4PA 2XHCA 1PIEA 3C15A 4CLSA 1C4CA 3HT3A 4A8YA 2ZH8A 4B3SF 3L9ZA 3QPIA 3SXLA 5DQHA 1GT8A 1R43A 3H0PA 3HHLC 4TYAA 3T1YF 5GMDA 2QO3A 5CCLA 1JMTA 5MAOA 1RB0A 2OMOA 2QMWA 4KFBA 2NS1B 3LPYA 5CZVA 1OSDA 3ITHB 4KKOB 1SJRA 1QTNB 4BWMA 1OSCA 3CJKA 1SCJB 2KI2A 3IGVA 3KWMA 2IAJB 4URSA 2J0SD 3DLEA 1HQEA 3EUNA 4JB8B 4UTGA 4DR7F 2I0XA 4JYAF 4JV5J 2FY8A 2OKQA 4KIAA 2E1RA 1DHMA 1WI6A 5DQGA 3L3CA 3R9LA 1PCAA 3BBCA 3FKBA 1RHUB 3SQGB 1IQZA 1TV6A 1TK0A 4LF4F 3TR5A 3UFCX 3H20A 2J0WA 3KJNB 3AXKA 1RADB 2E5IA 4IOAQ 2ADBA 2V2QA 1YI2S 2IJRA 1REGX 4ZVPB 5KFDA 3PCOB 3HHEA 3MEDA 3KJFB 4NXNJ 2VG6B 2W01A 4CO1A 1IR2A 1VK3A 4DBQA 3DGPA 3M30A 2QMXA 3FFIB 4YB7A 1R7IA 2UP1A 2K3IA 2PDAA 1VBKA 3HSDA 4RBUA 4PQAA 6FD1A 4RUAA 3G8SA 1AW0A 4F3OA 1QJHA 4YFUA 2W2QP 5LL6d 2ATLA 2DGVA 3P49B 1C0TB 1TVRA 2QSFA 4NI2B 1UL3A 1GH8A 3GIKA 1IBKJ 5IS2A 1CQMA 2HFOA 3JTOA 4G1QA 4HHJA 3CDWA 3KKFA 4ZVFA 8RUCA 2ZDOA 4WYWA 2AZ1A 5A0YA 1S4EA 1S59A 5G0RA 3WQPA 1ZAVA 5B0AA 1O8BA 4NLXA 4ZK7M 2HBQB 2QN6B 4F04B 5M2UA 4ECVA 3LP1A 1QY7A 5HK4A 2P5VA 1JLAA 4JI3J 1HYSA 4JI7J 1R8CA 3HKZD 2CJXB 3HHLD 4YDXA 4K0KF 4Q43A 4FNIA 1DARA 1HHQA 2HHVA 1NK0A 3GMGA 4CO2A 2BYCA 4IRCA 1AUSL 3GR1A 2I38A 1AA1B 2HQCA 1K1QA 4DV1F 5GADU 4FF2A 1QAJA 3D3BJ 5A6WA 3SQGA 1PAUB 1HIYA 4QW9A 4KGXB 2XG8A 5CYMA 5A6PA 2W8KA 4OX8A 3CPWR 1N34J 2W8LA 1GMUA 3A4TA 2LQJA 1JIHA 4ALZA 2FJDB 2QMUB 4LBIA 4OHVA 4QR0A 1VJWA 3LO3A 1RTDB 2UXDF 1RWKB 3MXHP 2KYZA 3QO9A 3VAFA 3IWNC 1T03A 5H9FK 3BYPA 3AXMA 2FPHX 4KGMA 4LR7A 5GMEA 4I7FB 3CEDA 2MQQA 4GO7X 3TOQA 2R2UA 1NO8A 2MTLA 1WSRA 4I6AA 3D1OA 1T9VA 1Q4RA 1VLYA 3NOCA 4IG0B 2DGQA 2QT7A 4QBUA 4DL5A 3JB9k 4JI4J 4NLGA 1JLGB 1KKHA 3Q8UA 3VZHA 2HRTA 2OPRB 5RUBA 4DUYF 1Q79A 5L1IA 4KPYA 3LOUA 2OD4A 1C4AA 2EG1A 3IGNA 3N28A 2HWIA 4M95A 1N56A 1YJ7A 3G87A 3OTOJ 4DR5F 1Y0HA 2FB0A 3C66A 2EFOA 1SL2A 2BACA 2JEJA 1RT2B 4LRDA 3AJ2A 3W62A 3ZTRA 1G2EA 4GVBA 1FKPA 3D1QA 1BE4A 3GWCA 1TKXA 4W92B 3GV5B 1JLGA 1Q1KA 1F5AA 2OFGX 3M8RA 3TO8A 3MPDA 1Y00A 2C3OA 3CC4S 3H8YA 3K7RA 2MZ1A 1PSDA 1IXKA 1XIQA 2DEJA 2Z2YB 4OJ1A 2ZJPQ 2PFFB 1IR0A 3HDSA 3QAUA 3Q0AA 2JX2A 5BYRA 5KG0A 4KRWA 3D4JA 3SCJE 3KDOA 4CWBA 1KLMA 3ETMA 3UDEA 2VFVA 3V4IB 2ASJA 4F3QA 1S1WB 4ANCA 1X9SA 4LF6F 1GXUA 3FQKA 3TZZA 1AFJA 1UEUA 3TZWA 2J7WA 3ENAA 2ALZA 1HR0F 2MHNA 5HQMA 1CULB 4F26A 2VICA 4HT7A 1FD8A 1Y4ZB 4CLZA 1X0PA 3RR7A 3SCLE 3JYTB 2L48A 2Y3YA 5F8IA 4PRFA 4Y65A 1EQ0A 2AJ0A 3I0RB 4J9QA 1Q86T 1CJKB 1FJGJ 2O3DA 1Q8BA 2CQGA 5HQ8A 3LQVA 3IM8A 2CJ9A 3KHRA 5KOXA 2HNYB 5D4NA 4LFBJ 3RAQA 1WG4A 2UVRA 2HZAA 1DBDA 2VL1A 2PGCA 1R6VA 3L95X 5KFBA 2CQ4A 1G4CA 2CNKB 2DNHA 1R27B 1RE1B 3I9ZA 2ZD1B 1AZSA 4GKJF 1NK9A 2K7JA 3OR1A 3ZZUA 1EARA 3TEHB 2HNDB 1M5HA 1WG1A 1S57A 1VQSA 2M8HA 4OZNA 1VFJA 4TNOA 3UD3P 4RNFA 2GW8A 4H54A 4X84A 2R2SA 1SL1A 2KT3A 2NSBA 3G8QA 3VGVA 1MMLA 1S6OA 2GQ2A 4Q7AA 3MM5B 3NL0A 3R5JB 2HGMA 2UV8G 4DJBA 4D3GA 1YHQS 4RLEA 1KR4A 2CPXA 3QGPA 2FHKA 3IG1A 4R8UB 4PPDA 1XNRF 1MN9A 4RW4B 4DR4F 3W65A 1F60B 2V2KA 4LF1A 4TYBA 1ZYQA 1S6UA 1I94J 1B3TA 1Q16B 1OYDA 4GMKA 4HI1A 2RHQB 5IZHA 4KYZA 1Z4UA 3BDPA 1CJVA 4O3PA 3V5RA 5HQLA 4I67A 2RHSB 3PIOQ 2YWGA 2C3MA 3GG1A 2XHWA 4C7QA 1IR1A 4ZOSA 5B0BA 3D6FB 3VAGA 3MD3A 2FZGB 2MGZB 2ERRA 1R0AB 3TUZC 3PW5A 4DV4J 1HR0J 1SXLA 2H65B 1SIWB 2EW9A 2LDYA 2CYYA 1R8AA 2QA4S 3B54A 1UAWA 1FD2A 2BV3A 2DHXA 2ZVIA 1TKDA 2HS0A 1NHVA 4WP3A 3QZ7A 5I42B 3PRVA 4PXDA 3RB3A 1IVZA 4C98A 1SH2A 3KHLA 3ZFVA 4LSZB 4IH6A 2MGZA 2XZWA 4MK9A 4LBPA 1IKVA 2WZ1A 4JV1A 1HBMB 1OY6A 2M70A 2MHEA 3QNWB 2Q66A 1LQ9A 4JP8A 4C11A 3C2PA 3DOMB 4EU0A 1IBMJ 4QYZJ 2Y1JA 3W2WB 2RUSA 4O23A 1GEHA 1WACA 3EM1A 1VISA 2DT9A 2FC9A 3HD2A 4CP5A 2DRAA 3HHNB 1TV6B 1TAUA 4R8UA 4DR5J 5AE3A 4MYTA 2YPYA 1XTZA 2QC3A 2E44A 2DIVA 3DC2A 2QL7B 4P52A 5E7OB 2J8AA 2ZOMA 3AODA 5HJYA 3H40A 2XSFA 4QPXA 3W5ZA 4LSLA 4N8NA 1FDDA 1S77D 4KE5A 2MZSA 1JK9B 2GGPB 2B8PA 3DOKA 3TA0A 4DUYJ 4C8KA 5D4LA 1OQ3A 2EKYA 1WKJA 1MN7A 2ROPA 3RJMB 4KKOA 2WOMB 3K2YA 4JI4F 4OJGA 4NCAA 2DY9A 3QRPA 4DV6J 3PNIA 3LF0A 5IC4B 3FK4A 4P71A 1QD1A 3IWLA 2RILA 3GFHA 1FE4A 2H4WB 3TVKA 1SJFA 1X4EA 1KN6A 1S0NA 4L76A 2GJFA 3CXCR 1WKKA 2J9EA 2UUBJ 3D28A 1RT1A 2MXYA 2JEFA 2VF3A 4DCOB 1V5VA 1R8HA 2UXDJ 1EKSA 4WE1A 2XY7A 4JV2A 3I5AA 4F67A 4F0MA 2UXBJ 2KXNB 4J7CA 2MQOA 3ZZPA 3MM7B 4OZ5A 2HHXA 4DPWA 3PV8A 1VQPS 2HK2A 2WVEA 3H4BA 3FEZA 2G2YA 5SZTA 3PIPQ 2A1BA 1JX4A 3KOAA 4CLYA 4ZVGA 1T9TA 4EBCA 2EXUA 1NBEB 1SC1B 1SQFA 5BR8F 2F4VF 4X4UA 1UKUA 1SVDA 4LBHA 3M7VA 4BBYA 3LTOA 5J2QA 5H9EJ 3BM7A 1LWFB 1U47A 1B7FA 1YVFA 3HHLA 3PEHA 4NL5A 1SPBP 3W7BA 4BC7A 4QIEA 3K0JA 1FKPB 4K5SA 4RPFA 2XCPA 1WF2A 1KVIA 8AT1B 4XPCA 4A8FA 1MWQA 2VDIA 4FF3A 3MMCB 5ITHA 3KHGA 1BGXT 5ETOA 3KJQB 1V6HA 3TA2A 1MLAA 2QL5B 1MMDA 4FBTA 2ZKTA 1Q78A 3A13A 3CDAA 2XCAA 4ECXA 3N6MA 3NCRA 4HEA9 3HKWA 2DXDA 1CLFA 3H5SA 4X62J 5BR8J 2YNFA 1KSPA 2F4VJ 2VBZA 1ZA2B 5KFTA 3OTDA 3UR0A 1RLDA 2JDJA 3DN9A 1HWKA 2YNIA 2QSWA 3DOMA 2CIMA 2ZM6F 1T0TV 1Y9OA 2RNEA 1WEXA 2ZNZA 4ID8A 4IUFA 3KJVA 1FK9A 2E5LF 3TJAA 3PYGA 2KYXA 2KZZA 4LIWA 3UN2A 3THPA 2ZHAA 4K8RA 4CI0B 1KP6A 4DL4A 4LT6A 4RR5A 1X9WA 1Y5NB 1HA1A 4WTYA 3CD0A 1HI8A 3NP5A 2UVWA 2JL9A 1VQ8S 4LF4J 2E1PA 1URRA 5AE1A 5CAAA 4KO0B 1HKAA 2F65A 3ONQA 5KAKA 3KXDA 5KFNA 2LA4A 2HGLA 1XR7A 1RKIA 1G7CB 1HW9A 1UFLA 2DNMA 2I1RA 2MKYA 2Z30B 2HVEA 3GZ7A 4XAKA 3CC7S 1Q5YA 4DCJB 4K50A 2V6AA 1IQTA 2VV5A 4DL6A 4K4TA 2Z58B 2BQUA 3OR1B 4ZJOA 2XLIA 2HZCA 4ILRA 2AP6A 3NBPA 4ECTA 2RE1A 4NRTA 5C42B 1FRHA 2DNQA 4YUDA 2E7VA 2HRUA 1VC0A 4OYIA 1ZM2A 3QATA 4NASA 1ZM3A 3J7A1 1FJCA 1CC7A 2HG4A 1NB2A 1XJWB 1REVA 4IH5A 1VBZA 3V81A 1HQEB 2DXFA 1X7VA 4N5SA 3V6KA 3QLHB 1Q53A 3M9OB 2AYGA 8ATCB 2FUG9 2BKNA 2ILYA 2MY8A 2VFTA 2HFZA 1H0HB 2ZE2A 3AY0A 1RHKB 4IFVB 4M8LA 5AXKA 3R97A 2MKIA 3SEOA 5HVGA 3Q8PB 4KB7A 4O0IA 2DHHA 1VBYA 1K44A 3IXQA 3N5BA 1WHYA 3M8WA 4ZDNA 5GAGU 4DR6F 2ZH2A 3S01A 1YG0A 3A8JA 1ZAXA 2NLWA 1WOOA 3B4DA 4MK8A 1MROB 5GMKa 3M8QB 4Y6IA 4AD6A 3L7UA 4FS2A 1S76D 3RW6A 3ETOA 3DU6A 4TKTA 2AF6A 2GVDB 2OHDA 5J2PA 4NXMJ 4IQXA 1NJZA 2OJ3A 2F8MA 3HFVA 1S6PA 3EZOA 2BXJA 3ZNUA 4C3KA 1Q82T 4M94A 4USTA 2JVOA 1VQ5S 3NNAA 1CJUB 2IVFB 2ZH4A 3SI8A 1KVKA 3THVA 2AKWB 4KY3A 3AOAA 3I55S 4GVBB 2EBEA 3WC2A 3BF4A 3IP0A 3NS6A 3KLGA 3KLFB 2HHHF 1TL7A 3QZ8A 3GV7B 3DFEA 1SC3B 2D1CA 1Z1ZA 3IBCB 4JI8F 4Z37A 5GAHI 5C25B 1E6YA 5DLGA 5I3UB 2E5JA 3IAS9 3GYNA 3IBWA 4PXBA 1V9OA 4QQBA 3J7AN 3QRQA 3DLJA 2R3VA 3ZZTA 2GIQA 1KLMB 3OFGA 3HHDA 1W2BR 4ZVOB 4JI5J 4F4WA 2MYFA 2PEBA 3WZ0A 1NB7A 3OL7A 2DNKA 4ZMMA 2GHPA 1S7HA 2R7RA 2WVBA 4C0BA 4TLQA 1JLQB 1OPZA 1W7WA 2C2NA 5KFSA 3J7YU 5KFLA 2X1BA 4DSEA 3FRZA 1VQKS 5HROB 4AXJA 3HULA 3KLIA 4PZVA 3QSIA 1NKEA 3NS5A 2IRUA 2M5YA 3WIUA 5HMYA 1AXQA 1RWPB 1S7IA 4UZCA 3GJSB 2KG1A 1JKHA 5C2GA 2C2DA 2NPIA 1M0SA 1X4CA 2IVMA 3DYAB 4AQYF 3MEEA 1DLOB 1WEYA 2LXUA 3AQPA 3I87A 3OFEA 2AEJA 2OPSA 2HK3A 3CMQA 3NAHA 3QGIA 2HBZB 4PCQA 4RNMA 1H7WA 1YBUA 3MFHA 2G2OA 1VJQA 2OFHX 4R0EA 4X64J 2VA2A 1CPZA 3MPYA 2RQCA 1H3DA 2QTWA 2DK2A 1Q81T 2BE7D 2JWNA 5L46A 2FQQB 1U2RA 3MMBA 5HVHA 1SB6A 1FWPA 1F3VA 4M5IA 3KLHB 4B3MJ 3MTKA 1ITPA 3VR1A 3S6EA 3I31A 5F41A 2V2VA 2DR5A 1IN0A 5MLCV 1LW0A 3ET6B 2FY1A 2MDAA 2AT1B 5HATA 1LWEB 1H72C 3D6TB 2Y9HA 2F1FA 2D9OA 3GE9A 4QWDA 4K4WA 3BDEA 3ILOA 3NOGA 4NLQA 1T9WA 4CO5A 1FTCA 2YH0A 4P2MA 5DGBA 5G0RB 4ICLA 5DDPC 5D4OA 2D3ZA 3TNVA 2JHEA 2C2ZB 4FN5A 1X4GA 4DU7A 4UOGA 3PR4A 4F2RA 4HHHA 3MURP 2R7VA 1HARA 4TY8B 3WC0A 1QDUB 1JLAB 1LOUA 1HBMA 1UVKA 2WB4A 4OFZA 1XC9A 3DDKA 2KXFA 3GILA 2YX1A 4JI8J 1CVJA 2OIHA 2R7UA 1RWNB 2Z56B 3AAWB 4E2FB 1MG7A 5K14B 4OIXA 5B7WA 4RZRA 4QCLA 2HHPA 3RR8A 3UVJA 1F5CA 1VQ6S 1XR6A 3FNNA 4TU9A 2CQHA 3TUJC 1BUXA 2QA1A 4O44A 4OZ0A 3BGFA 1N32J 1F3FA 1PG5B 3R2DJ 4MKVA 3FJ2A 4NX9A 4DPTA 4R5PB 1G3OA 3EGNA 3H42A 5J2MB 1K0VA 4DSLA 4CH7A 1CJTB 3K5MA 4GO5X 2RD5C 4A46A 4YP3A 1UW9A 4RBVA 5GADI 1OO0B 2WOMA 2W9BB 1U6FA 2DH7A 3SDEA 4K2JA 4O4RA 2XGPA 3FBFA 2BR0A 4V19J 4IFYA 2AQ4A 4J9OA 3ZNJ1 2BDPA 2RT3A 5K20B 2CXEA 1Y5LB 3IC1A 1X9MA 2DGTA 4EYHB 5D0HA 3GQCA 2VODA 2HHTA 1HMVB 5KFPA 1PJ5A 2CNLB 3MM9A 1WDDA 4TLRA 5BJRA 4CIOA 2Q1LA 1F6TA 2PIIA 1YRXA 2CPHA 4Y2CA 3BPSP 4A8KA 3PDNA 1VRTB 2DXEA 2IM3A 3CJKB 1T05A 4FVCA 1WHXA 4DSFA 3DI6B 3DRXA 3OR2A 2B3TB 2I5JB 4OV6A 3BGLA 4DF4A 1GX5A 2A0FB 3W9HA 3IRXA 4IR9A 3T6JA 2HBRB 3PKMA 4DN0A 2KU7A 3B82A 2LMIA 1ZBTA 4P2FA 1IKYB 2QA4G 3PM9A 4IYQA 3GIIA 3GIJA 1R8PA 3MM8A 3QT8A 3CJRA 2FLLA 2IJFA 5IXUA 3RBDA 2IBOA 1N6QB 3CE8A 2KHDA 2QIFA 2EK6A 2Q79A 2XSJB 2BABA 4IDKB 3UWTA 9ATCB 3A3PB 1FESA 4HLBA 3GIMA 4HHUA 3LGNA 1UETA 2IA6A 1F1BB 3QGGA 1TP7A 3FQLA 4A4JA 2GMLA 3CD5A 3M1VA 5KFKA 1VYAA 3V4IA 1ICEB 3O5TB 1KNZA 4ZHRB 3W9IA 4JI6F 4LRAA 1U45A 3UNGC 1CULA 1FEHA 5EGYA 3CMES 3OW2R 4HTJA 3C3LA 1XBWA 2EC2A 2CQIA 4RBTA 2R7SA 4H4OA 4NXNF 4F0HA 5KFGA 4CM0A 3C6TA 2OMLA 1LW0B 2LU1A 3ET6A 4DV2F 1S1TA 4M5LA 3CJ3A 2F3JA 4ELTA 3QRRA 5IT9Y 2DBBA 2K3KA 4HVZA 3SSRA 3KHHA 2ASLA 2CZ9A 5JVHQ 1UVJA 4ZN3A 1S12A 4ECUA 1HNIA 2N7YA 2WSEC 1JKHB 1NNDA 1T9UA 2GIRA 2HQDA 2VBXA 4M5HA 3W64A 2XMMA 2OPRA 3CGIA 3GYXB 5GAHU 1N36J 2GJ2A 1QVFR 4KHMA 4ES1A 4J9NA 1QE1A 4QPTA 2A3JA 1VHIA 2OPSB 4TN2A 3IBFB 3HP6A 1DTQB 2Y0BB 2LQ9A 1V5IB 4MH8A 1U2CA 4NLUA 1RU1A 2BZ2A 2FVCA 2K1RB 2GNKA 2B5JA 2P9CA 4USKA 1SQEA 5A8KA 2G2ZA 3T1YJ 2C2RA 1C0UA 1LWXA 3ISND 3LUYA 4JI0F 1NKBA 1PC5A 2JEIA 4U8YA 5DM6Q 2H5EA 3NEKA 4FZVA 1SC4B 1U09A 3D0GE 1Y11A 1PKUA 1T94A 4X4QA 1YJUA 2GA7A 2Z0GA 2IY5B 2YNHA 3Q8VA 1UCNA 3D66A 4OMFG 4I64A 4WP8A 5E5NA 4Y2IA 2VJVA 4DV0F 4CZCA 5A8RB 5DJBA 4ZITA 4UQGA 1LNQA 3BKTA 3TWZA 2KH9A 4MT1A 2YQ0A 3ZZZA 5KFIA 3CMAS 3CF5Q 1KOHA 4I1TA 4A8XA 1EHWA 4X4NA 4V19X 3DXBA 4LSNB 2PA3A 4KGVB 4HYKA 2D3O1 2EI5A 3OL6A 2NZ4A 3ZTSA 3BBBA 4FF4A 1SQGA 2EC0A 4MIWA 3ELHA 4NLYA 3Q8YA 3UNYA 4EWTA 5DDQC 4L6V3 2VFUA 1NH8A 2R7WA 4ZP9A 2B56A 4B3OA 4EO6A 3CCMS 1FVSA 1NUEA 4XK8C 2ZC4A 2WBMA 3I32A 1IBCB 4EO8A 2ZH1A 2VQFF 1Y3KA 2HMIA 1VQLS 1KDNA 2V9WA 2LDIA 3NGDA 1HNXJ 2DPJA 1YWXA 2FYXA 2QGFB 4JI1J 2K1RA 1RTIB 1NJIT 4DQQA 4NRUA 1P6TA 3H5XA 2V4JB 2BJDA 2NPFA 2GQCA 3AB4B 1J5EF 3MECA 4ATNA 2VFRA 2AMCB 3A1YG 3HMJG 2POKA 1YX2A 2HHQA 1IKXB 1MSWD 1HNVB 1VLOA 4C2MA 2W4PA 2AV5A 3SMZA 2NCKL 4WXWA 1LFPA 3BB5A 3TRGA 4NEZA 4RUHA 1N33F 1RAFB 3BSAA 1JB0C 3H2LA 5CYJA 2DITA 2ZH7A 2D3OR 1NK7A 1WHVA 4H4MA 1QSYA 1Q8IA 4B3TF 2C3YA 3C14A 3M8PB 4I2PB 3ZXWA 1RT7A 2F9JA 4DHVA 3H90A 4DL7A 2ASDA 2VONA 1L3TA 1B0PA 2DGXA 3A8EA 3W2WA 2KN4A 7AT1B 5HMXA 3PW7A 1JXEA 3DHXA 1IBLF 1FFWB 4WZMA 1R3NA 4O4GB 3VAIA 2XBPA 5L9NA 2EFPA 3GCXP 1J2VA 2PA8D 4JI2J 2L9WA 4B9UA 1UEVA 3JAMU 1C1CB 2IM2A 2VG7B 3VAKA 1VC6A 5F8JA 2F7VA 2OH2A 2LQBA 4EGLA 3PHTA 4N77A 3MR3A 2VD3A 4WBFA 4BS2A 3PTWA 2HW3A 3NG8A 5EWEA 2SXLA 4DZDA 5T41A 1VMBA 1JJ4A 2CWXA 1XN9A 2AHOB 2R4FA 1EAYC 4OZ1A 2MQLA 4N8OA 1VOMA 3AA8A 2UUWA 1RTJB 4NLVA 2BQRA 2JVRA 1K73T 2IMWP 3BQ1A 3C15B 3MPWA 4DV6F 3KG4A 1GK8A 2XMWA 3W1YC 5L1LA 3VZIA 2FLPA 1TTHB 2MZRA 3FMBA 5E2QA 4DLEA 1YTYA 3GLJA 3D6HB 5IT0A 4EI2A 4PABA 2GFFA 1ZM4A 3BBFA 1RABB 2W2NP 3LAMA 1B4SA 2VG5A 3BR8A 4D3HA 3OUYB 4CLLA 2W2PP 2KT5A 3EXCX 4ZS6A 3NNHA 1JNRB 4DI6A 1GQEA 2XGQA 3CCTA 2A18A 4QOTA 3CD6S 4C8LA 4RJVA 2EVZA 1ZZFA 4ZLPA 1FJGF 2ROGA 3BGRB 4ZPDA 1B0TA 5IT9U 2B9WA 5K8MA 3T9ZA 2BANB 2Z2ZA 2VKZG 1WELA 3QYYA 3CB4A 2FHMA 2W9AA 4JBCA 4K4XA 2IBKA 1NSPA 4XPEA 2RAQA 4OI6A 3BKFA 3NGRA 1WC4A 3RBZA 4CO4A 1QAXA 5FIIA 3C46A 2Z2LA 2LA6A 2MKJA 1RT4B 4OLPA 4ZPWR 4RNOA 1NK4A 3BR9A 4B3RJ 3HVRA 2M4MA 4ZLJA 4EYIB 3MR5A 3MMCA 5KFOA 3TVYA 2XULA 4KFBB 3I0SA 1ACMB 1H6KX 3J81Y 3MUTP 4QWAA 2HGNA 4B9VA 2IFXA 4CLUA 1WEZA 3OJSA 4LFBF 3OXLA 2GC8A 2Y1LB 4LQ9A 3J81j 1RI7A 2DY1A 3R5DA 3CDUA 3JYTA 3GB0A 5EN1A 4DX5A 5EUHA 1LFWA 2IC3A 2HNZB 4HKQA 2C42A 2DH8A 5F8MA 3V6JA 3MCMA 3N0VA 2Q6CA 4DF8A 3I0SB 4DR4J 4IRDA 4ZIWA 1EX8A 3F0NA 3K17A 3N9UC 4RUCA 4F4YA 3BYRA 3V6DB 1M1KT 4QU7A 1LWFA 2HWHA 5B08A 1KQGB 1BQNB 2AYMA 2CJQA 1NJYA 3PO5A 1A9NB 2WVDA 1BD6A 3AJ1A 4K59A 3IN5A 4LF7F 1XK8A 2LU2A 2WW4A 3H2UB 4WE1B 3IR7B 5F9NA 4X4RA 4DR3J 3RTVA 4E0DA 4RWWA 5HMWA 5KG7A 2AGPA 1U7LA 1X5SA 2CNOB 3HLUA 3UDVA 3LWLA 1JJ2R 2XS5A 3OFHA 2WSCC 3HSGA 2WCXA 5H9EK 4ECSA 1SUQA 2XY6A 4Q45A 4DR3F 4PQUA 1CG2A 2XLKA 1RT2A 2HAIA 2QZ8A 3DMJA 2OI2A 1MROA 1HWJA 4Q5VA 2VG5B 1S1UB 3QIPA 2AW0A 2OSRA 1D1UA 5F8NA 1AFIA 1O5JA 1BC6A 1RCOB 5KFYA 3HJFA 2O1PA 2BRKA 1U6ZA 3SV3A 1M90T 3GR0A 4HH0A 4OI2A 5M2RA 3AHPA 2P6TA 4ZN1A 2M0GB 4PYAA 3Q2TC 1RJJA 3UQSA 2DJWA 5LSOA 1HHTP 3M6XA 3MFIA 2WONB 5F3TA 1KBRA 2EWHA 5DG7A 2X7IA 2HYIB 1L5UA 3N5FA 3EGZA 4B3TJ 4JI3F 1HWUA 2HIQA 1SJ4P 1HNIB 5E33A 2FJEB 4ED8A 1NSQA 4F02A 2HVIA 3JQJA 2R7TA 1ZM9A 3BSNA 4B3RF 3AH6A 2V94A 2WW8A 3FCVA 3D7SB 4OHWA 4MAKA 2W9CB 1S72S 2UUCF 1EZZB 3G8TA 4CM2A 3GJRB 1BQMA 2ABYA 4EUVA 3IRXB 1IKVB 2EFGA 1U8SA 1ZA1B 4WFZA 5AT1B 3MMAA 3TP2A 1YGYA 4QWEA 1TFWA 2MKSA 1J5EJ 3RYLA 3GV8B 2RSQA 2F40A 3G82B 2OUGA 4USIA 2HQFA 4EZ9A 3ITHA 4LF9F 2ZE2B 1FFSB 4IFVA 4JI1F 4O3RA 4DPOA 2R8KA 4DPYA 1QAIA 4MKYA 2ZBQA 3QT7A 2I8EA 4AT1B 1FXLA 1RT6A 3PFOA 1P9QC 2V34A 4TQRA 4IH7A 2VQFJ 3MMAB 1VIXA 2NSCA 2V8PA 3LH2S 2J6UA 5A0YB 2V4JA 2QG9B 5B0FA 1QLNA 2QLWA 3CJ8A 2J9DE 4C4WA 3H5YA 4O44B 2VKRA 3PJWA 1S1XA 1FX2A 4NZ0A 2DNPA 1ZETA 1XMOJ 2PE8A 2B51A 1VRTA 2IM1A 3AD9C 2NXCA 3FEYB 5KFFA 2C2EA 1Q5VA 3OQ2A 2V8GA 1SL0A 4DCPB 4C0OC 2PEHA 3W2VA 1U49A 2L9NA 1F9FA 3LAKA 1NSAA 2HPUA 3V6HA 3I56S 3VV2B 2VIHA 2XMKA 3T3FA 4Y28C 4X2BA 4DPUA 2XTJP 4GRSA 2FJWA 4G1PA 4F4ZA 4IR1A 4DQPA 3MEGA 3IAM9 1BLUA 3Q24A 4Y2AA 1B99A 3CJQA 3M8PA 2DNNA 3US5A 5KG2A 3T1AA 4LFCF 3DNCA 1NDPA 1SJQA 2E5HA 3W9JA 1H2VZ 1OQ6A 3QMQA 4UW2A 3IA0A 2ZOGA 1U0HB 2BW7A 1EQMA 3WIVA 3FEXB 4JI0J 3HXMA 2YKNB 1VCTA 4PKDB 4M5MA 1NCLA 2V0NA 4OZJA 3MDFA 4S0MA 4IO9Q 2OAUA 4NLWA 2ATCB 3CDBA 3MWBA 3SSQA 3SV4A 3RRGA 2LECA 3KUEA 5HLFB 1LWEA 2JLEA 2YY3A 3DXSX 2W7OA 2VQEF 1JLFB 2DR9A 2QFJA 4NCGB 2YX7A 1YKWA 2JZ5A 2YNGA 2HS3A 1RKJA 2MZTA 3ENWA 2IIHA 1RHQB 4B3OB 2QRRA 1PBUA 3MR7A 1M1HA 3E8OA 3IO1A 3DRRA 3DYAA 3MAAB 3N6NA 4WFYA 3KTQA 3P45B 3T5LA 2XYPB 1UA1A 3HHKA 1IBKF 1MWZA 1T9YA 2CAJA 1DURA 1RWOB 3B6BA 4F4AA 4ER8A 1FKOB 5HI7A 4Z2XA 2P9GA 2UUTA 2AD9A 3G4SS 4KQZA 5LMNF 4UZBA 4ZCLA 3I0RA 5DO2A 3WDOA 4C48A 4ZJLA 2ZUAA 1TZ0A 2CFXA 1HD0A 3CJSA 2V63A 3MD1A 1TKXB 1N48A 1YBAA 2BM0A 4G6VB 4ZCIA 4ZLNA 5FDLA 4JI6J 1RTHA 2WTFA 3U1NA 3UCZP 2BUNA 1QVGR 3TEGA 4ZPTR 1S6QA 3OTEA 1M5PC 3E2EA 2HHUA 2B4VA 2PN6A 2HBYB 4B17A 3BN4A 4W90B 1RK8A 4GKKJ 2CRLA 2Z4PA 3FBCA 1CSJA 4H4KC 4JYAJ 1HQUB 3VGUA 3KLGB 1RBLA 1NHKL 3K58A 5A2QY 3W5XA 2YTCA 3R7SB 3CCZA 3M4XA 4USMA 1BQNA 1K47A 3OD2A 3TAMB 2C2KB 7FD1A 2DR8A 5IQ6A 3NLCA 5KT6A 2AYBA 2BQ3A 4B9TA 5KG4A 5L38A 1WWHA 1XR5A 2DNZA 2KM8C 3D54A 3IR5B 4DV7J 2IRXA 2JC1A 2KXHA 2JNJA 4WK1A 4YR3A 3EX7B 1XWLA 3Q89A 4J9LA 4OYAA 1VGYA 2W4DA 4FXVA 2O01C 1DTQA 4KHPF 2AEFA 4G65A 4NLPA 4FXDA 2G1HA 4TY9A 1NDKA 5AXMA 3K59A 2HVDA 3GONA 1REVB 3TZYA 5G4DA 2MKKA 2DH9A 3PG9A 1KONA 4H4OB 4OX6A 4RW8A 2D7SA 1XQIA 2QV6A 1YJ9S 2FVQA 1P9YA 2R8GA 5CD4H 2YQ3A 2RKIA 4NMXA 5ETVA 3OVAA 4CLWA 2RRBA 2V5HG 3I82A 2GAGC 1KQKA 3V4MA 2K06A 4B08A 1TL1B 4O4GA 2ZH9A 2OELA 1RAOA 3C6UA 4DV3F 2C28A 2MKHA 1VQ4S 5BYQA 1M5KC 2QLJB 3GPAA 1W25A 3MTJA 1D8YA 2GVDA 1FRXA 3FUYA 3GSDA 4MMOA 1WDTA 3KK3A 2AZ3A 2CQ2A 1NDLA 1FX4A 3K8VA 3D6MB 1LK7A 4O3QA 4X66J 1HD1A 1EKRA 2A6MA 3KNAA 1NPPA 1RSCA 3FCWA 2A2CA 3D67A 2F9DA 3KLVA 4DV5F 5I3QA 1N4LA 4W98A 3CCSS 2Z2MA 3CSKA 3GG0A 4CNYA 3TAQA 5D3GB 3M8SA 3MMJA 4XO0A 3D0HE 1SKWA 3TW0A 3WBZA 3HT0A 4ELUA 1NHUA 3GIRA 1Y5IB 1LW2A 2DEIA 3K8WA 1H98A 1TAQA 3GJQB 4U95A 2MMYA 3W66A 3NGTA 1RBAA 4ID5A 2LFVA 4QZVB 1IKXA 3HSJA 3OR2B 3B4MA 4NMLA 2P2CB 3TJ9A 2FLOA 4UOHA 3A8IA 4AE5A 4NZ7A 4OJHA 1SI9A 3P8BB 4KO0A 4CDIA 1KHVA 3C6UB 3OPKA 4CRJA 4LF5F 3OBIA 2BJ3A 2CQ0A 2D74B 1RWVB 5L8RC 2C2OB 4L3KA 2HNDA 4XDCA 3VVUA 5FDLB 4URQU 4CH1A 4PUOA 2BMBA 3C8YA 3DLKA 5ETMA 2RRAA 2EKNA 4X65J 1BQXA 2DR6A 1S9FA 5KFUA 3Q2SC 3FDSA 4KGZB 4QJVA 1S6QB 4EMDA 4ECWA 4Q8EA 4UY8T 3PYFA 4AYBD 2JSXA 2KRBA 2RQ4A 3CCRS 4DG1A 1UVNA 1FA0A 3NGKA 1TMMA 1N33J 1HQ2A 1RXOB 4YEAA 4KH1B 3RGIA 4F0KA 3MUMP 4DQSA 1UJ6A 2FD2A 2RVJA 4RO0A 3BSOA 1EIYB 3BREA 2B4OA 4ZPCA 5ETQA 1FWKA 3KUHA 2DO4A 2FZKB 2P9EA 2MLXA 1PJ7A 3OHAA 2UU9F 1J27A 1V3ZA 2DHAA 4ZPVR 2VA3A 1VHFA 4QIFA 1C0UB 1Q0NA 4C3MA 2HURA 4ES3A 1YBTA 3BH6B 1I51B 3PHEA 4F7VA 2NXUA 2FVRA 2R8IA 5L1KA 3TZXA 1SBRA 3POTA 1KFDA 1UZDA 4DV5J 3D0IE 4EZ6A 1RTHB 3QFHA 1Q8LA 4DR1J 1RHMB 2UVUA 2YNGB 5A8RA 4DPXA 5IFMA 3ZC4A 3W3SA 5LSLA 3PRBA 4K2XA 5HMZA 3OL9A 1FCAA 3QO9B 1VS3A 3LWMA 4EBDA 4C8ZA 5DG8A 1PYTA 3QWUA 4LSNA 3EDRB 5U47A 3ZZYA 4URGA 3DOLB 2I6WA 3J80Y 1VQMS 3MEGB 5E3AA 2MJUA 3M9MB 4R0JA 3R2CJ 1IM6A 3LP0B 1HNZF 1SV5A 2RQMA 3DRSB 5ETNA 4C11B 1UWBB 2BBEA 2C2MB 1GAOA 4OYPA 2PT0A 1FXRA 2BJ8A 4RW8B 5EWFA 3F73A 2X3DA 2RB7A 3J80U 4FYXB 4J9MA 3RB4A 3CJ5A 1RWUA 3AA9A 3W5YA 3RBXA 4EK2A 1X5OA 5KFAA 3CCUS 4XIUA
chains in the Genus database with same CATH topology
4LFAJ 4LF6J 1I94J 2E5LJ 2VQFJ 4PWWA 4RJVA 3T1YJ 4LF4J 4KYZA 4DUZJ 3D3BJ 5IT9U 5FLXU 5IWAJ 1IBLJ 4LFBJ 1XMOJ 1N34J 4DV2J 2MQ8A 4DV4J 1HR0J 4JI8J 4AQYJ 4GKJJ 5LM7E 4LF7J 4B3RJ 4X66J 4DR6J 4YHHJ 5LMNJ 1N32J 3R2DJ 4LF8J 5AJ3J 2MTLA 4JI4J 4DV3J 1IBMJ 4JI0J 4LF5J 4DV1J 4LFCJ 5LMUJ 4DR5J 4DR4J 4K0KJ 1HNXJ 2VQEJ 4YY3J 4JI1J 3OTOJ 2HHHJ 4DUYJ 2ZM6J 4DR3J 4B3SJ 4OX9J 4NXMJ 4DV6J 4KHPJ 4X65J 3D3CJ 2KL8A 2UUBJ 4NEZA 4KY3A 3J81U 2UXDJ 1N33J 3IMQJ 1XMQJ 2UXBJ 2KVQE 4JI6J 4LF9J 4JV5J 3J7AN 4HHUA 4JI5J 4DR7J 4GKKJ 1FJGJ 4JI2J 2UU9J 4JYAJ 3JAMU 4DV5J 4B3TJ 3T1HJ 4DR1J 4NEYA 4NXNJ 2UXCJ 1XNQJ 4DV7J 2MEWA 4DV0J 1HNZJ 2UUAJ 1IBKJ 4X64J 3R2CJ 3W1YC 4X62J 5BR8J 2F4VJ 1J5EJ 2UUCJ 4V1Ak 5A2QU 4B3MJ 3J80U 4DR2J 1N36J 1XNRJ 4JI3J 1HNWJ 4JI7J
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LFA J;  4LF6 J;  1I94 J;  2E5L J;  2VQF J;  4PWW A;  4RJV A;  3T1Y J;  4LF4 J;  4KYZ A;  4DUZ J;  3D3B J;  5IT9 U;  5FLX U;  5IWA J;  1IBL J;  4LFB J;  1XMO J;  1N34 J;  4DV2 J;  2MQ8 A;  4DV4 J;  1HR0 J;  4JI8 J;  4AQY J;  4GKJ J;  5LM7 E;  4LF7 J;  4B3R J;  4X66 J;  4DR6 J;  4YHH J;  5LMN J;  1N32 J;  3R2D J;  4LF8 J;  5AJ3 J;  2MTL A;  4JI4 J;  4DV3 J;  1IBM J;  4JI0 J;  4LF5 J;  4DV1 J;  4LFC J;  5LMU J;  4DR5 J;  4DR4 J;  4K0K J;  1HNX J;  2VQE J;  4YY3 J;  4JI1 J;  3OTO J;  2HHH J;  4DUY J;  2ZM6 J;  4DR3 J;  4B3S J;  4OX9 J;  4NXM J;  4DV6 J;  4KHP J;  4X65 J;  3D3C J;  2KL8 A;  2UUB J;  4NEZ A;  4KY3 A;  3J81 U;  2UXD J;  1N33 J;  3IMQ J;  1XMQ J;  2UXB J;  2KVQ E;  4JI6 J;  4LF9 J;  4JV5 J;  3J7A N;  4HHU A;  4JI5 J;  4DR7 J;  4GKK J;  1FJG J;  4JI2 J;  2UU9 J;  4JYA J;  3JAM U;  4DV5 J;  4B3T J;  3T1H J;  4DR1 J;  4NEY A;  4NXN J;  2UXC J;  1XNQ J;  4DV7 J;  2MEW A;  4DV0 J;  1HNZ J;  2UUA J;  1IBK J;  4X64 J;  3R2C J;  3W1Y C;  4X62 J;  5BR8 J;  2F4V J;  1J5E J;  2UUC J;  4V1A k;  5A2Q U;  4B3M J;  3J80 U;  4DR2 J;  1N36 J;  1XNR J;  4JI3 J;  1HNW J;  4JI7 J; 
#chains in the Genus database with same CATH topology
 1S1T B;  2E66 A;  3BJY A;  2HHW A;  3FZ2 A;  3M2V B;  5K9F A;  1WC6 A;  1ZOT A;  1HPZ B;  2YQ1 A;  1LXJ A;  3MCN A;  2PMZ D;  4BWJ A;  2CVE A;  3ISZ A;  2HFV A;  2JOQ A;  2NZC A;  2RF2 B;  3M2R B;  1DRZ A;  2CQP A;  3BEG B;  3DOK B;  3H59 A;  3G6V A;  1FJ7 A;  4ZVH A;  1WD6 A;  3D9B A;  5HP1 A;  2I2Y A;  3TAR A;  2RDI A;  4DUT A;  2MQP A;  4X64 F;  1MW7 A;  6AT1 B;  4DFM A;  5HRO A;  1X8D A;  2MQ8 A;  2BOP A;  2PI4 A;  2KB2 A;  3R5G A;  1RAE B;  1FTR A;  2O5D A;  3BS9 A;  2RDJ A;  3L4B C;  4AQY J;  3QLH A;  2XS7 A;  2MJN A;  5KTQ A;  2X1A A;  1QSL A;  3HVT A;  4NA2 A;  4PG8 A;  2HKE A;  1RT3 A;  5KFZ A;  5AE2 A;  2ZOF A;  3CD7 A;  1S1X B;  2XMJ A;  3JTN A;  4YHH J;  2XO6 A;  3CUN A;  3PX4 A;  4LF8 J;  1KS2 A;  1PYO B;  1O6X A;  3TVZ A;  3SQO P;  2FVS A;  4C3L A;  3N79 A;  3SIP B;  2KZM A;  3MM5 A;  3S1T A;  5KG1 A;  5KG6 A;  2IPO B;  2JFK A;  4IDK A;  4WII A;  2VC1 A;  2ZDP A;  5KFH A;  3K5L A;  4YN3 B;  4NYO A;  2PMH A;  3DLL Q;  5DDO C;  4OL8 A;  2GMJ A;  4HDH A;  2DRD A;  4OZL A;  4Z7Y A;  1KTV A;  4P74 A;  2KJW A;  5ETR A;  1RUS A;  3P96 A;  4ANE A;  1X4A A;  5HJX A;  4Q44 A;  3TQ1 A;  5C42 A;  2GJI A;  3DI6 A;  5H1S V;  2ADC A;  3NWG A;  2HLU A;  3Q8R B;  4DN9 A;  1UVI A;  2NYH A;  1IM4 A;  1ZPV A;  5ETL A;  3K5O A;  3T6B A;  3MPV A;  4CNZ A;  5CA5 A;  4RNN A;  4DLG A;  4M1K A;  5I4M A;  3P5T L;  3RB0 A;  2DCU B;  3MCO A;  2JRS A;  4FYD A;  2ASY A;  1V3S A;  2ZM6 J;  1HW8 A;  5DM7 Q;  3BSC A;  1KOO A;  2ALY B;  4HTI A;  3CCL S;  2AJ4 A;  1RTJ A;  5HN0 A;  2CDQ A;  3VHQ A;  5IC6 B;  4IFY B;  2CDR B;  3CUL A;  1UFK A;  4PXE A;  1MWY A;  2G0J A;  1NZ8 A;  2KT2 A;  4OZ2 A;  4DFK A;  4ILL A;  5JMN A;  2XS2 A;  2KKH A;  3M6V A;  4PWD B;  2UXC F;  2G13 A;  2WHO A;  2AJ2 A;  3O3L A;  4FS1 A;  3ZTO A;  1IJF B;  2E7W A;  3C16 B;  5L9X A;  3EZU A;  1HBO B;  3T19 A;  5B0C A;  7FDR A;  3H25 A;  3M2V A;  3PW4 A;  1TEL A;  2H48 B;  4TQS A;  2B9E A;  2RS2 A;  2N7C A;  5SUH A;  3BKU A;  4BDP A;  1AZS B;  1UWA A;  2VUG A;  3M8Y A;  2AIR B;  4TVA B;  1NU4 A;  5IWA F;  3OLA A;  3MUV P;  2Y8Y A;  1IKW B;  2N4D A;  3LP2 B;  4USH A;  1T3O A;  2GS8 A;  3FC9 A;  1Y7P A;  4MFB A;  1S1W A;  4BCA A;  4WKR A;  4NLR A;  1JLB A;  1QM9 A;  1RLC L;  3JTP A;  1NK8 A;  3VGT A;  1S1U A;  3QIP B;  4F3M A;  4DV7 F;  1DZ5 A;  2GVZ B;  3VQS A;  4LJM A;  3KUG A;  4RW6 A;  4ZVS B;  4ED3 A;  2GHV C;  4OYW A;  2XEX A;  3JSM B;  1T8E A;  3SFU A;  3MMB B;  4X4V A;  3ENV A;  1WHW A;  2CPI A;  2ZVS A;  3L09 A;  5KOW A;  5K8O A;  5KFJ A;  3TUP A;  1GXL A;  1TMJ A;  3PY8 A;  1NKC A;  3PYE A;  1QUV A;  3T5K A;  2QLX A;  1TK8 A;  1KD1 T;  5HBM A;  1U48 A;  1CBK A;  1E6V A;  3CW2 C;  2Q6B A;  3A3N B;  3E51 A;  1RT1 B;  4Y34 A;  5ETP A;  5HAO A;  1KQF B;  1L3V A;  2XNR A;  1FRM A;  2PC6 A;  4I6Y A;  4YQW A;  1N54 B;  5AXN A;  4DSJ A;  3S8S A;  4YOE A;  4LVN P;  4OX7 A;  4M5K A;  3JXO A;  3VTI A;  1N52 B;  3GFX A;  3X3U A;  2VAS A;  2YX4 A;  3GFZ A;  5LXR A;  5HLF A;  4NYP A;  1XMQ F;  1KHW A;  4FPR A;  2QFI A;  1U24 A;  2W7A A;  1MU2 B;  3CCJ S;  1RT4 A;  5HBM B;  1GMW A;  2M3D A;  3CCQ S;  3UCU P;  4GC7 A;  2XMU A;  2VB6 A;  1U1N A;  2IYI A;  3E01 A;  1IBM F;  5DRK A;  3MHY A;  1RAA B;  5F0W A;  4O3O A;  2KVI A;  3KLH A;  1H7X A;  1NK6 A;  1GX6 A;  3U1L A;  4OI4 A;  1PAE X;  5DQI A;  1KLN A;  3JSR A;  1EP4 A;  5E3Q A;  5IOL A;  2ZFH A;  2W4C A;  1OS5 A;  4HL9 A;  3FBE A;  2BX6 A;  4FKX A;  4RW6 B;  1HWI A;  2ZZT A;  5LM7 E;  3AD8 C;  4B9M A;  3IM9 A;  3KLE A;  4P2X A;  4J37 A;  2K8G A;  3R1H A;  5F8H A;  3F44 A;  2IJN A;  4JOU A;  3DLG A;  2BAN A;  4YY3 F;  4EBE A;  2R7X A;  3HX9 A;  1APS A;  1TKZ A;  2VOO A;  3MM7 A;  3NS7 B;  1QTM A;  2U1A A;  5D78 A;  4EEY A;  3OVB A;  3LGM A;  1RBO B;  3DDN A;  2FGO A;  4HDG A;  2F63 A;  1OYE A;  3EVW A;  5E41 A;  1RA6 A;  1XEZ A;  4DUZ F;  1RTD A;  5E3P A;  1OY9 A;  1S5Z A;  1S9G B;  2BM1 A;  3QGH A;  1X4H A;  1KRP A;  4LFC J;  3OUY A;  1TK5 A;  1I94 F;  1QE1 B;  1RT5 B;  2BE2 A;  3W8G A;  3N6L A;  4LFA F;  2A10 A;  1FRJ A;  1JLB B;  1FXD A;  2HSE B;  3CO0 P;  3KLI B;  5D3G A;  1UFW A;  2J9D A;  3FRY A;  2W2O P;  4LVO P;  3D5M A;  3MED B;  5T7L B;  1F5B A;  1NDC A;  4P75 A;  2YXL A;  2AEM A;  2ROE A;  2HQI A;  1YJN S;  1G1X A;  3JSM A;  1IWA A;  1X4D A;  2E1M C;  3J7Z T;  2WBR A;  1L3S A;  4IQM A;  3HM9 A;  1N5Q A;  3O6Q A;  1R0A A;  4ETX A;  2B43 A;  3C14 B;  4FXW A;  3C16 A;  1XMO F;  1TKT B;  2DO0 A;  4Y2K A;  1D9F A;  4LF8 F;  4ERD A;  3W2V B;  3D68 A;  3CJ0 A;  4WK3 A;  4N56 A;  3T41 A;  4YME A;  1BWE A;  3RAM A;  2XWY A;  4AUK A;  1X0F A;  4C8Y A;  2DGS A;  2EPI A;  2QEX S;  3ENQ A;  3FSI A;  1DTT A;  2H9Z A;  3LP1 B;  3SBM A;  2FZC B;  4LF9 J;  2DHG A;  4P7T A;  2FDN A;  3SCK E;  1S6P B;  3NGS A;  4ED6 A;  3V81 B;  2BOA A;  2YKO A;  3TA1 A;  4XDD A;  3DGP B;  3M30 B;  5EHH A;  2WB1 D;  4QYZ K;  4C9D A;  1FHT A;  3Q83 A;  2W9B A;  2XM3 A;  3FCH A;  1JWW A;  1PIL A;  2DGW A;  3H98 A;  4OYO A;  4RUB A;  4A8O A;  1WUU A;  3E3X A;  3ILL A;  4I56 A;  2P6S A;  5DGA A;  4LIR A;  2IAJ A;  1N5Y A;  4RKU C;  3HI9 A;  4ZIV A;  1HWL A;  2E9Z A;  2MLZ A;  2OTJ S;  1TUW A;  2VJU A;  2XNQ A;  2JLG A;  2JLF A;  2XZT B;  5KFM A;  3LGH A;  4IOB A;  1HNZ J;  4DV4 F;  4O3S A;  2HZV A;  1B70 B;  2J9C A;  4RW4 A;  4NCB A;  2B0G A;  1TKZ B;  1TUG B;  1GNK A;  3DGV A;  2R8H A;  3PJ9 A;  1X5T A;  1Z2Z A;  4LRF A;  4DSI A;  3O1L A;  5C5J A;  2DRB A;  2AJF E;  3MPU B;  2ZEJ A;  5D6G A;  2A6O A;  2ACY A;  3AD7 C;  2MB0 B;  1WNE A;  2NXN A;  3UN3 A;  4M5J A;  3PVX A;  4I2P A;  3EMT A;  3JSB A;  1I5O B;  1AYE A;  3HK2 A;  3HSZ A;  4ECZ A;  1UZH A;  3SFG A;  1I6J A;  2HQG A;  3LP0 A;  3UO0 A;  1PJ6 A;  4KJI A;  4FYW B;  1TFY A;  2W24 A;  4ZA1 A;  2UVV A;  2RJZ A;  2J6S A;  2HS4 A;  4ECQ A;  3BZQ A;  4I68 A;  2AU0 A;  1FK9 B;  1PYS B;  2XYH B;  5FLX Y;  4FYV B;  2PI5 A;  1OIA A;  2EG2 A;  4MJK A;  3M9N B;  4FP9 A;  1FT8 A;  1GXT A;  2WSF C;  3BO2 A;  3D1H A;  4PPZ A;  3UI3 A;  5HVF A;  4HR2 A;  4F50 A;  1SUQ B;  1X60 A;  3HFZ B;  2XI2 A;  4P6Q A;  2H5I B;  2WRM A;  3MZI A;  2N4C A;  1S9G A;  3OTC A;  1N88 A;  1NPK A;  4FNH A;  3MEE B;  2VOP A;  4NE9 C;  1CC8 A;  4OYX A;  4NA1 A;  2Q3P A;  2ZC3 A;  3EGW B;  1RAJ A;  1TL5 A;  5GAE U;  3MAQ A;  2HHS A;  2YKP A;  4N7T A;  4HH1 A;  3WHI A;  2NR0 A;  1JLF A;  1R0B G;  1GMW D;  4A8W A;  1U6B A;  3A8K A;  5I3U A;  5DDR C;  3O2I A;  5J1P A;  2CWK A;  2ZKU A;  1RHJ B;  4LF5 J;  4DV1 J;  4KHR A;  4YR0 A;  2D9P A;  2CQB A;  3CCE S;  4WXO A;  3KLE B;  3DLH A;  3I5C A;  2DNO A;  4YB1 P;  4FBU A;  4RW7 A;  4CCH A;  3NAI A;  4U8V A;  4DL0 C;  2AWZ A;  4K0K J;  4NOH A;  4YY3 J;  2AJ1 A;  4YS2 A;  5F9L A;  2LEA A;  4DL3 A;  2YWE A;  3GU0 A;  3HZE A;  4LRB A;  1NJX A;  3IRW P;  2GZO A;  2CZV C;  1KQS R;  1D0E A;  3IFE A;  4M5N A;  4TU8 A;  4M5G A;  1CS4 A;  3IS9 A;  4F2S A;  1U1Q A;  3KLF A;  1P8G A;  2YKN A;  3GTY X;  2HNZ A;  4CO3 A;  2UUA J;  1JLE B;  2QX0 A;  3QT6 A;  1DFD A;  4DX8 H;  1D3W A;  3OJU A;  3NNC A;  1ZH5 A;  1Q7L B;  2YNH B;  4LF2 A;  3F41 A;  4DXL A;  4ZP7 A;  4N47 A;  4ILM A;  2QYG A;  3NCQ A;  3H4D A;  2ZJQ Q;  3T5J A;  4QIV A;  1WC1 A;  3EVM A;  3KG1 A;  3I96 A;  2KFY A;  4OI0 A;  2VPW B;  4P2S A;  1WC3 A;  2BA9 A;  2LLZ A;  3NKY A;  2OGU A;  2XWX A;  3IMQ J;  1FO1 A;  3M8Q A;  2NUH A;  5KG5 A;  5T14 A;  3U27 A;  2L9D A;  3POT B;  5IM0 A;  2LEB A;  1XMQ J;  4CT8 A;  3KK2 B;  3P3D A;  1RYS A;  2ZBC A;  4DDF A;  4WJB A;  3DRP A;  4WFA Q;  1ARO P;  4WF9 Q;  3ULH A;  4KV8 B;  3OSN A;  5FD1 A;  3OLB A;  1CJU A;  4J9R A;  4QWC A;  4C8O A;  1VQY A;  1YJT A;  2XY5 A;  1B64 A;  3QJL A;  2FJB B;  1S9E B;  2HIY A;  2DTJ A;  2QLB B;  4USW A;  3RBE A;  1ZTT A;  4KTQ A;  2VC0 A;  3R7N B;  3K5N A;  1M5V C;  1PGZ A;  1FWL A;  2RQK A;  3AQO A;  1VR6 A;  4I6W A;  4NEY A;  2G0C A;  2PD1 A;  2RML A;  4QW8 A;  2BVZ A;  3B8H A;  2H54 B;  1K0T A;  5D15 A;  3AB2 B;  3I6P A;  2V8H A;  3Q86 A;  3DM2 B;  2LKZ A;  2OLW A;  4BHQ A;  2RKI B;  2M52 A;  4DV0 J;  4PUO B;  4UOC A;  1W26 A;  3TJ8 A;  1N34 F;  1YLX A;  2NXE A;  4XTT A;  4WP9 A;  4OX9 F;  3PRD A;  3LW5 C;  2CAD A;  2HEK A;  2Z8Q A;  5EX0 A;  1U1O A;  2OO4 A;  1N5Y B;  3CJ4 A;  1PC4 A;  1IKY A;  1N5S A;  4RWX A;  2V8D A;  1T3N A;  5A2Q U;  2ZD1 A;  4RX6 A;  3FFI A;  1F9E B;  4BLG A;  2R2T A;  3VAJ A;  1U2F A;  1WF1 A;  2JC0 A;  2CJB A;  5F0U A;  1QUP A;  4TY8 A;  5CAB A;  5IT4 A;  3CJT A;  4KR0 B;  4B9S A;  1X4F A;  4JI7 F;  2X1G A;  4UY8 5;  2FHO B;  2O67 A;  1M5S A;  1HNW J;  2LYV A;  4KV8 A;  3PYD A;  4F25 A;  3Q8S B;  5K14 A;  3OL8 A;  4F4K A;  4IRK A;  1U8W A;  5AXL A;  3O44 A;  5JJB A;  1YSJ A;  4QWB A;  2M7S A;  3MM9 B;  4ZLL A;  4DS5 A;  1URN A;  4KT0 C;  1YIJ S;  2H5J B;  1HI1 A;  1FFG B;  2GIF A;  1JLE A;  5LJ3 Y;  2CQ3 A;  1Y3J A;  1TL3 A;  2HNY A;  4MKA A;  2LP4 A;  2V8V A;  2V68 A;  4OQJ A;  5CQG A;  4CLP A;  4DV2 J;  4DS4 A;  5D0G A;  5J2M A;  1S97 A;  3JQM A;  2M8D B;  3TAP A;  3PFE A;  4U9R A;  1FJE B;  2OPQ A;  3BQ2 A;  1RZM A;  3DRY A;  1U25 A;  3KMS A;  2YKA A;  2H4Y B;  2MZQ A;  3DMJ B;  2G0I A;  2H3E B;  3FZB A;  5LMN J;  2RRN A;  2BE2 B;  4RW9 B;  4J9K A;  5DZ7 A;  2DKO B;  2LQ8 A;  3R3T A;  3QID A;  2WVF A;  1KWM A;  2ZWP A;  3ZTQ A;  4WFX A;  2A2D A;  3O8W A;  1WC0 A;  4OYZ A;  3CWJ A;  1SKU B;  5CYQ B;  4ETZ A;  5HL7 Q;  1LWC A;  5F8L A;  3K57 A;  3BQ0 A;  4CLF A;  1UVM A;  4ZCM A;  1U0S A;  3MEC B;  2ZH3 A;  4PG4 A;  2XB2 D;  2VFS A;  2DB1 A;  3VWS A;  2DVI A;  4U67 Q;  1X31 C;  4O3N A;  2IVY A;  3RW7 A;  3A3O B;  3ZTP A;  4PQU B;  1HBN B;  2LXF A;  4HAC B;  2BJ7 A;  2DCL A;  4PR6 A;  5K8N A;  2MQN A;  4DG1 B;  3PW2 A;  1FNM A;  4P73 A;  1OMS A;  2GMH A;  4B3S J;  4J9P A;  1DLO A;  3QT5 A;  1FF2 A;  1I1G A;  1DQ9 A;  1LXN A;  1NME B;  2DD8 S;  2R7Q A;  3X1L B;  1U26 A;  2OSQ A;  2HWT A;  3PXG a;  4WTO B;  2YWF A;  4DZ6 A;  5JXS A;  1ULR A;  3SYZ A;  4UOF A;  4KPC A;  5B09 A;  2KL8 A;  3TX8 A;  1HBN A;  2VPZ B;  4HAC A;  1RQ0 A;  4WKY A;  3PW0 A;  4ZCK A;  3MR2 A;  2IA0 A;  3PKY A;  1FDN A;  2BW2 A;  3GYG A;  2M9K A;  3RRH A;  3TAN A;  3H2V E;  2NYI A;  3R5A A;  3PX0 A;  4U7U D;  5KFQ A;  4UUX A;  4IG3 B;  1RWW B;  3UPF A;  1UPM B;  1U4B A;  1O51 A;  2DR7 A;  1A7G E;  2Q43 A;  4A48 A;  2HQ3 A;  1LWC B;  1UPP A;  2MST A;  4I2Q B;  2F5G A;  3PEJ A;  3SCI E;  3FSY A;  1YJR A;  5IV4 A;  1LW2 B;  3EYZ A;  2Y0S D;  4OZ3 A;  3RAX A;  3ILI A;  1FI4 A;  1S4F A;  1S0O A;  3BGR A;  5KT4 A;  2HVH A;  4PWD A;  3R27 A;  3RB6 A;  4M5D A;  3V2U C;  3CCW A;  3QBC A;  3QAE A;  1N32 F;  5KT5 A;  2AYE A;  2IDL A;  4X4O A;  2K7K A;  2E9T A;  5LSR A;  5C25 A;  1VDH A;  5F3Z A;  1S1V B;  1MNE A;  1YZ7 A;  2CJK A;  5LT5 A;  4C8M A;  2NRE A;  4GC6 A;  4RU9 A;  3NWR A;  4TU7 A;  2PMW A;  3MGJ A;  5J1E B;  4PAA A;  1BWV A;  5L1J A;  4CYU A;  4ECY A;  2KHC A;  4B02 A;  5I42 A;  1UA0 A;  2OP5 A;  5EDW A;  1S79 A;  3HD1 A;  4YDD B;  2XMV A;  2WK4 A;  3DHW C;  2I5J A;  4M63 A;  1XMB A;  1ZPW X;  2J7U A;  2W25 A;  2YWK A;  4IKA A;  3TI0 A;  2FHJ D;  2GVZ A;  1GMV A;  1UP1 A;  3CCV S;  2D3U A;  2CPF A;  2ZIT A;  4ED7 A;  2IDE A;  2UUC J;  1U0H A;  2E5G A;  2FVP A;  2CPJ A;  5CYM B;  4H4M B;  4DR2 J;  2W2M P;  1JNZ B;  3T5H A;  4F8R A;  1DAX A;  1LKZ A;  2FJA B;  4B9N A;  3W61 A;  1C0T A;  4LRC A;  1S0V A;  2QJ3 A;  4AXI A;  4ZPA A;  4DR7 J;  3OV7 A;  2K2P A;  3FGV A;  1HHS A;  4ENO A;  4B3M F;  2UZA A;  2BKP A;  2CUY A;  2RUG A;  1HMV A;  1YJV A;  3L7O A;  5L39 A;  3M1V B;  4MFB B;  4Y0F A;  1OWX A;  4AND A;  3OSP A;  3FBB A;  2OEJ A;  2YKQ A;  2ZH5 A;  1K8A T;  2ZNY A;  1TU0 B;  3EJM A;  2X1F A;  2OEM A;  2V9K A;  2MSS A;  2V50 A;  2V4Q A;  2XYG B;  3R5C A;  1HNV A;  2VG6 A;  3UCG A;  1D9D A;  1XNQ F;  1SJ1 A;  5D8H B;  3MM6 A;  5E3R A;  4Y2M A;  2B9X A;  2U2F A;  2M88 A;  2MLY A;  3DM2 A;  3JAM Y;  5DET A;  5KFW A;  1H74 A;  4I69 A;  3B78 A;  5HP1 B;  1RT5 A;  3HZG A;  4FYY B;  4C8N A;  3T1H F;  2LCW A;  4UUW A;  1F2G A;  2ZZM A;  5JVG Q;  3UW1 A;  5IM0 B;  2ACM A;  1DTT B;  4DMZ A;  1RTI A;  1K1S A;  3KK3 B;  3I9V 9;  2VDH A;  6FDR A;  4ELV A;  1YDL A;  3DLE B;  4G1I A;  1N5V A;  4QR1 A;  3M6W A;  3FSX A;  4WCE Q;  1J5O A;  2BRL A;  3UD5 A;  3EGV A;  4KAI A;  4AL6 A;  1CJK A;  5GAE I;  3TX0 A;  4N41 A;  2W7P A;  1YRT A;  2KTQ A;  2QA2 A;  4K4V A;  2XZD B;  2YVS A;  5GAG I;  3NGU A;  2L3M A;  1WOP A;  1X5P A;  2HHH J;  2DIS A;  4X66 F;  4LR9 A;  4OHY A;  2W1B A;  4Q2M A;  1PO6 A;  4QIW D;  4NLS A;  2JEG A;  2DHS A;  3MCS A;  4MYU A;  3VQT A;  3TYT A;  2KM8 B;  4ED5 A;  3KNG A;  1VRU B;  1ZTW A;  2B6A B;  5KT7 A;  1RAH B;  1VQO S;  3DRP B;  1O0P A;  3EE3 A;  5GVQ A;  4EFA C;  4O0N A;  3HPO A;  3EPI A;  5C24 B;  5CXT A;  3NY0 A;  1A6L A;  3NMA A;  5T7L A;  2VBW A;  5ETS A;  1N8R T;  3BO3 A;  4NWB A;  1ZAW A;  1RT3 B;  4M5D B;  2ZHB A;  4PG7 A;  1U1P A;  2AGO A;  1S48 A;  5C7P A;  2XQC A;  1JQG A;  3ZZR A;  1UW4 A;  3KG0 A;  1GFW B;  3TAM A;  1LEO A;  3RG6 A;  2QL9 B;  2LVW A;  5M2P A;  1Z2L A;  2GHW A;  1WI8 A;  1C1B B;  1CQN A;  2MPU A;  3EVO A;  1S99 A;  3M6U A;  4WWS A;  5KFV A;  2KG0 A;  2OPP A;  4OHX A;  4FPI A;  3MAH A;  3VGS A;  3C6T B;  4ICL B;  3U7J A;  2HMI B;  3CO9 A;  4Q0B A;  3BGO P;  5H9F J;  3DCA A;  3OVS A;  1U1R A;  3MOZ A;  2OEK A;  3G6E S;  3V6D A;  4WU3 A;  2XMT A;  5B0D A;  4ZJQ A;  1E6V B;  1KFS A;  4OV1 A;  1Q8K A;  2GGP A;  1FRL A;  2YKM B;  3OTB A;  3UN5 A;  4NZ6 A;  2F8H A;  5JUM A;  1RAG B;  3IS9 B;  4U7U K;  1BHN A;  2C3U A;  4CQ1 A;  5A8W B;  4AL5 A;  2KFZ A;  1NLK L;  4LQ3 A;  1WKL A;  1KTQ A;  2RU9 A;  1N0U A;  1NPR A;  1T03 B;  1YIT S;  4J91 A;  1FRI A;  5EX3 A;  2VZ9 A;  3RUB L;  2YWW A;  3WX8 A;  1NXI A;  3G6Y A;  1NH7 A;  4RL1 A;  5J2Q B;  2EFN A;  1F2H A;  4K7Q A;  1S0M A;  4P10 A;  4PXC A;  3KMQ A;  1R0C B;  2DNL A;  4GKK F;  5A8K B;  1C2P A;  2CNN B;  2CPY A;  2V67 A;  4AL7 A;  3L7P A;  2N82 B;  4IG0 A;  1A0O B;  3DU5 A;  1FRK A;  2QYC A;  3OXF A;  4J5O A;  2CQC A;  4MTP A;  1P1L A;  4WU2 A;  1I3O B;  3PO4 A;  3I5B A;  3VAM A;  2CPZ A;  5DS7 A;  1RDR A;  4Q8F A;  5KFX A;  3QJP A;  4LFA J;  1EET A;  3G6X A;  2CKW A;  3MR6 A;  3G9C A;  3CVK A;  3LAN A;  3CTR A;  2E5L J;  4G1Q B;  1C1B A;  5J1N A;  3U1M A;  5LMU F;  1WC5 A;  1RWM B;  2LEP A;  4ZVQ B;  4JI2 F;  3BO4 A;  4GVL A;  5KFR A;  4P7V A;  4DUZ J;  3VVT A;  5IWA J;  1NAQ A;  1H2U X;  1IBL J;  4X62 F;  2GO8 A;  1C1C A;  2VG7 A;  2J8S A;  3MF5 A;  3N4W A;  2BJ1 A;  2VPX B;  3VF0 B;  2L41 A;  2B6A A;  5AJ3 F;  5ETT A;  1NK5 A;  1QSS A;  3RRK A;  4ZP8 A;  3KYL A;  1U1M A;  3Q22 A;  3NMR A;  2DNR A;  3M2U A;  4K4S A;  5KT2 A;  3K5P A;  2CA9 A;  2I9S A;  1FDA A;  3HCX A;  1J5O B;  2DYA A;  3GSI A;  5BYS A;  4YR2 A;  2R2R A;  3QSY B;  4DR6 J;  2B7B B;  1VQ9 S;  1RTZ A;  4WFB Q;  3EWG A;  3SDE B;  1UTA A;  3VAL A;  1U02 A;  1SKS A;  1VIO A;  2BE9 B;  2RS8 A;  1BQM B;  4USJ C;  5AJ3 J;  3KK1 A;  2AGQ A;  3SZ2 A;  2FLN A;  2KO1 A;  4PYD A;  4ZP6 A;  5D0R A;  3S7R A;  2J0X A;  2QE5 A;  1Q7Y T;  4B9L A;  3MM6 B;  4J90 A;  3MOJ B;  3AOC A;  1NEE A;  4OI3 A;  1SH3 A;  4RNH A;  2DNG A;  3R6L B;  5LMU J;  4E98 A;  1HFE L;  3H5U A;  2UV8 A;  1TL4 A;  3HVW A;  1EB0 A;  4NPO A;  1ROF A;  2R8J A;  1VQN S;  4I0W A;  2IRY A;  2P8I A;  2KRR A;  2F8E X;  4PG6 A;  2C1E B;  1JLC A;  4R5P A;  1HBU A;  4USU A;  1WJ9 A;  2JJ4 D;  5I3P A;  1JJC B;  4NLD A;  5DZ6 A;  3R8Y A;  2ZJR Q;  1MMN A;  2EK1 A;  1W2I A;  4CYU B;  3CDE A;  3UE2 A;  2ZH6 A;  5J2N A;  1UJ4 A;  1JXL A;  1KVJ A;  1ZS6 A;  4ZVR B;  1X4B A;  3D3C J;  5LOQ A;  4YHH F;  1UMJ A;  4L73 A;  5CZX A;  1G6B A;  1D8Z A;  1WG5 A;  2CVI A;  2GO9 A;  1F9H A;  1WSV A;  2YNI B;  1R89 A;  3AOB A;  1CS4 B;  1NM2 A;  3G82 A;  3KFW X;  4A47 A;  1S9E A;  4J9V A;  4U6P A;  3WX4 A;  4CT9 A;  3SSS A;  5K5M A;  5THW A;  3PZP A;  4DQI A;  2KVQ E;  5B0G A;  3IG1 B;  1GTH A;  1S1V A;  1SH0 A;  1TKT A;  2CJA A;  3AT1 B;  1KC8 T;  3P4U B;  1DQA A;  1HPZ A;  4FVM A;  1AT1 B;  3BV8 A;  2RU3 A;  1RGV A;  2FHJ A;  2XMA A;  2AX1 A;  2IC3 B;  4KH0 B;  3H7H B;  4L3N A;  1N0V C;  4ZVU B;  3QWP A;  1NZA A;  5HO4 A;  3P5B P;  5D77 A;  1VC5 A;  1NSK L;  2HFU A;  4YB5 A;  5CHC B;  2HLT A;  2KFN A;  3LPE A;  2AX0 A;  4FF1 A;  2V4R A;  2FTR A;  3AFG A;  5IQQ A;  1SV5 B;  2VHG A;  2GAH C;  2ZBR A;  2Y1I A;  3IWX A;  3PX6 A;  1OPI A;  1FEE A;  3LAL A;  5B0E A;  3R7B B;  3UR3 C;  5CCM A;  3UD4 P;  1N36 F;  4QU6 A;  2UXC J;  1V3R A;  1ELO A;  2H51 B;  3MAA A;  1EJ7 L;  2MEW A;  1TR0 A;  3CT9 A;  4NA3 A;  4ZVE A;  2GV1 A;  4ITS A;  1D09 B;  2GQQ A;  1FE0 A;  3BH7 B;  3CNQ P;  3N01 A;  2EFV A;  1LK5 A;  2J5A A;  4CTA B;  2J76 E;  1FKO A;  4DFJ A;  1K9M T;  4N76 A;  4LMZ A;  4X4S A;  1L3U A;  1BY9 A;  2CJY B;  2Y1R I;  2B5J B;  3EXY A;  3HHL B;  1T02 A;  3G71 S;  2YH1 A;  1SJ3 P;  4DSK A;  2AJQ A;  5FJ4 A;  2PSZ A;  2COL A;  3K89 A;  4RU2 A;  4AFF A;  1FVQ A;  2MQM A;  3NCP A;  1RWX B;  3DDI A;  4V1A k;  3A12 A;  3VCD A;  4ECR A;  5A8W A;  1AUD A;  2OTL S;  1TL7 B;  2WAQ D;  2FC8 A;  5ADZ A;  3EDQ B;  2IYG A;  4RW7 B;  3EPG A;  3UDL A;  4DR1 F;  4I4B A;  3GP9 A;  1XNR J;  2UXB F;  3G86 A;  4CTA A;  3QQC D;  4YB6 A;  2QLF B;  1FKA F;  3ICL A;  1TQL A;  3LA0 A;  4CH0 S;  1NRK A;  2XI3 A;  4K4Z A;  3M32 A;  4U96 A;  2UUB F;  3AJD A;  2ILZ A;  2B7C B;  1UWB A;  1WOS A;  1RP5 A;  1YQH A;  2BJE A;  1RCX B;  1M1G A;  1FNO A;  1N5T A;  1RA7 A;  3GJT B;  4FDF A;  1JXV A;  2LXI A;  1HQU A;  4UQT A;  2XLJ A;  1GTE A;  1HLW A;  2RH3 A;  4I7F A;  3ZZO A;  4A8M P;  2KJV A;  4WYL A;  3ISN C;  4F4X A;  1VRU A;  1RAC B;  2C22 A;  4A8S A;  3P6Y C;  3R6G B;  2UUA F;  2X3G A;  2FGC A;  4ES2 A;  1VK8 A;  2VPY B;  4Z7C A;  5J2N B;  2HVZ A;  2XC9 A;  3DKD A;  4PWU A;  2NXJ A;  2E1C A;  4LF7 J;  3M05 A;  2E1A A;  3OFF A;  2BJ9 A;  4USV A;  1U1L A;  4GKJ J;  4OJ3 A;  4WIQ A;  2EEY A;  2MKC A;  1H73 A;  2B4U A;  1RIS A;  3M8Z A;  2IM0 A;  4MKB A;  3EZ5 A;  2IMO A;  1H2T Z;  2YWH A;  4A8Q A;  2CG8 A;  4ID5 B;  2M2B A;  1B0V A;  1IJE B;  4MK7 A;  4QR2 A;  3UDC A;  1TVR B;  4CLK A;  3MM8 B;  3D2W A;  1SKR A;  2E9R X;  3MI7 X;  3I4P A;  4K4Y A;  2FIU A;  1SC6 A;  2CG4 A;  3GFY A;  4LSL B;  3TUI C;  1S10 A;  4C0H A;  4NYZ A;  2XSJ A;  5ETK A;  5KFC A;  2DNY A;  1OJ4 A;  2E29 A;  4Y3C A;  3THT A;  3C19 A;  3DRR B;  1T7P A;  1IKW A;  2ZUG A;  3LP2 A;  4NLO A;  4R25 A;  5DLF A;  1T05 B;  4X4T A;  2RDD A;  3DLK B;  4HT5 A;  4DOZ A;  4KGK A;  4P9S A;  1RT6 B;  2APO A;  1JJH A;  3W8P A;  3BN7 A;  4JV0 A;  4DR2 F;  2XO7 A;  2OD6 A;  5CYQ A;  4DL2 A;  1CJV B;  3G96 A;  5A76 A;  2DGO A;  2CQ1 A;  3Q8Q B;  1DJ0 A;  1U1K A;  4MIA A;  3CIM A;  2W9C A;  4E8U A;  4ED2 A;  1TL3 B;  1WTB A;  2V2Z A;  4ZKA A;  2JH3 A;  3OT9 A;  4L74 A;  2CPE A;  1HBO A;  1TUV A;  2VH7 A;  4DX6 A;  2FJX A;  4L72 B;  2J7K A;  4L75 A;  1CEZ A;  1VI7 A;  4TXS A;  1OY8 A;  3PAC A;  1HBU B;  5C2C A;  3HVT B;  4ZVT B;  4P72 A;  4Q2L A;  4PEO A;  5F8G A;  3PR5 B;  3J81 U;  1NJW A;  2PFD A;  2RIJ A;  4OI1 A;  3KDN A;  2VBY A;  1S49 A;  4ZHR A;  4KC5 A;  1WTF A;  2ZZN A;  1T95 A;  4QYR A;  1HYS B;  1RU2 A;  5BXI A;  1EET B;  2HAF A;  1BMQ B;  4UT4 A;  1CJT A;  2B9Y A;  4K5R A;  3FMW A;  5J1E A;  3ZZ0 A;  2F4F A;  2O66 A;  5EWG A;  1WF0 A;  3J7Z 5;  2MZJ A;  2RF2 A;  3F56 A;  2G9O A;  3FVY A;  3M2R A;  2CQD A;  3HF5 A;  4OYM A;  1Q95 G;  4DU8 A;  4ED4 A;  2VU5 A;  4MIB A;  2DPI A;  2UU9 J;  3I4H X;  4QIG A;  2V69 A;  4DEZ A;  4CLT A;  1M5O C;  4NI2 A;  3U02 A;  3W60 A;  2PO4 A;  2EFQ A;  4KSE B;  2J6T A;  2MY7 A;  2FJV A;  1JLC B;  2YNF B;  3T1H J;  1RT7 B;  2Y8W A;  2L08 A;  2HRY A;  5D0E A;  3PJX A;  3JSY A;  2KDO A;  2DIU A;  5DG9 A;  2ZWO A;  3NRB A;  5D4P A;  1UEK A;  1T9X A;  4DQR A;  4I2Q A;  2R42 A;  4W4M A;  5HAN A;  3OHB A;  3KJV B;  1LV5 A;  1XNQ J;  2WVC A;  2YBV A;  3CIZ A;  1R31 A;  2R7O A;  3NBP B;  1D9A A;  2WON A;  3EIC A;  4X65 F;  1T11 A;  2CZ4 A;  3GCW P;  1P27 B;  4HI2 A;  3JQK A;  3BGU A;  4UF4 A;  3KK1 B;  3CC2 S;  1H38 A;  1HL6 A;  2B8Q A;  1VQ7 S;  4Y00 A;  1TL1 A;  4CO0 A;  3OXG A;  4ED0 A;  2GCF A;  2ZBI A;  2LQ5 A;  3E01 B;  2H1Y A;  2G4B A;  4C97 A;  2DGU A;  4IG3 A;  5E3C A;  2B4P A;  4NLT A;  3KK2 A;  2HFN A;  1YK9 A;  5CH7 B;  1IUJ A;  3DOL A;  2EBG A;  1EP4 B;  2J0Q D;  1HI0 P;  4FKY A;  5E0O A;  4C6A A;  4LF6 J;  3M2U B;  4JUZ A;  5CD4 A;  1UVL A;  3R1L A;  3QJJ A;  2YPZ A;  4PWW A;  2GX8 A;  3HJV A;  1R6Y A;  3NXZ A;  3DRS A;  4KBI A;  3UVJ B;  1DQ8 A;  3Q23 A;  2R9L A;  2OPP B;  3R5B A;  3ILJ A;  4IO1 A;  1ZZN A;  2C3P A;  4OYB A;  5FLX U;  1VRQ C;  4JI5 F;  3CJ2 A;  4ZPB A;  3DLG B;  1JLQ A;  1FER A;  1RAI B;  3W63 A;  5LJ5 Y;  4WPA A;  1RHR B;  1YZ6 A;  2BEF A;  2ZBP A;  4LUB A;  2YKM A;  2G1D A;  1YRU A;  1UJ5 A;  3HVA A;  3M32 B;  1P1T A;  3BPD A;  9RUB A;  1FNX H;  3OTO F;  3RZA A;  1L3K A;  4WZQ A;  3J7Y I;  3HO1 A;  1F0X A;  3MEK A;  4H4K A;  4DFP A;  1HNX F;  3VAH A;  4DWI A;  5IV3 A;  1R8B A;  2D69 A;  4K4U A;  4OLO A;  2IHR 1;  2NQP A;  2HFS A;  3JS9 A;  4NCG A;  4NXM F;  1AB8 A;  2N3O A;  2D41 A;  4ED1 A;  1FDB A;  2X51 A;  4DV3 J;  4BC9 A;  2OPQ B;  3IR6 B;  3ZO7 A;  4DX7 A;  1RYR A;  5HSP A;  4JV5 F;  1B7Y B;  1PBA A;  1Y10 A;  4OHZ A;  5KFE A;  2JFD A;  3ADA C;  3TQE A;  1QAY A;  4Q0B B;  5J2P B;  1IWG A;  2NUU G;  4RW9 A;  1DY3 A;  2ZHO A;  4F36 A;  3T9N A;  1WOR A;  3G2X A;  2VQE J;  1HNW F;  1SIZ A;  4WFN Q;  4J9S A;  1MU2 A;  5C24 A;  2BKO A;  4IOC Q;  2CPD A;  1BXN A;  4LR8 A;  1VBX A;  5KT3 A;  2Z57 B;  3HFK A;  1YJW S;  5K8P A;  1XER A;  4U7C A;  4G3I A;  4PG5 A;  2E7X A;  1KEK A;  4J9U E;  3DLB A;  4OX9 J;  4LRE A;  5KG3 A;  5LXY A;  2N3L A;  3RU0 A;  1E6Y B;  1N6Q A;  4KHP J;  3QFW A;  4X4P A;  2XHC A;  1PIE A;  3C15 A;  4CLS A;  1C4C A;  3HT3 A;  4A8Y A;  2ZH8 A;  4B3S F;  3L9Z A;  3QPI A;  3SXL A;  5DQH A;  1GT8 A;  1R43 A;  3H0P A;  3HHL C;  4TYA A;  3T1Y F;  5GMD A;  2QO3 A;  5CCL A;  1JMT A;  5MAO A;  1RB0 A;  2OMO A;  2QMW A;  4KFB A;  2NS1 B;  3LPY A;  5CZV A;  1OSD A;  3ITH B;  4KKO B;  1SJR A;  1QTN B;  4BWM A;  1OSC A;  3CJK A;  1SCJ B;  2KI2 A;  3IGV A;  3KWM A;  2IAJ B;  4URS A;  2J0S D;  3DLE A;  1HQE A;  3EUN A;  4JB8 B;  4UTG A;  4DR7 F;  2I0X A;  4JYA F;  4JV5 J;  2FY8 A;  2OKQ A;  4KIA A;  2E1R A;  1DHM A;  1WI6 A;  5DQG A;  3L3C A;  3R9L A;  1PCA A;  3BBC A;  3FKB A;  1RHU B;  3SQG B;  1IQZ A;  1TV6 A;  1TK0 A;  4LF4 F;  3TR5 A;  3UFC X;  3H20 A;  2J0W A;  3KJN B;  3AXK A;  1RAD B;  2E5I A;  4IOA Q;  2ADB A;  2V2Q A;  1YI2 S;  2IJR A;  1REG X;  4ZVP B;  5KFD A;  3PCO B;  3HHE A;  3MED A;  3KJF B;  4NXN J;  2VG6 B;  2W01 A;  4CO1 A;  1IR2 A;  1VK3 A;  4DBQ A;  3DGP A;  3M30 A;  2QMX A;  3FFI B;  4YB7 A;  1R7I A;  2UP1 A;  2K3I A;  2PDA A;  1VBK A;  3HSD A;  4RBU A;  4PQA A;  6FD1 A;  4RUA A;  3G8S A;  1AW0 A;  4F3O A;  1QJH A;  4YFU A;  2W2Q P;  5LL6 d;  2ATL A;  2DGV A;  3P49 B;  1C0T B;  1TVR A;  2QSF A;  4NI2 B;  1UL3 A;  1GH8 A;  3GIK A;  1IBK J;  5IS2 A;  1CQM A;  2HFO A;  3JTO A;  4G1Q A;  4HHJ A;  3CDW A;  3KKF A;  4ZVF A;  8RUC A;  2ZDO A;  4WYW A;  2AZ1 A;  5A0Y A;  1S4E A;  1S59 A;  5G0R A;  3WQP A;  1ZAV A;  5B0A A;  1O8B A;  4NLX A;  4ZK7 M;  2HBQ B;  2QN6 B;  4F04 B;  5M2U A;  4ECV A;  3LP1 A;  1QY7 A;  5HK4 A;  2P5V A;  1JLA A;  4JI3 J;  1HYS A;  4JI7 J;  1R8C A;  3HKZ D;  2CJX B;  3HHL D;  4YDX A;  4K0K F;  4Q43 A;  4FNI A;  1DAR A;  1HHQ A;  2HHV A;  1NK0 A;  3GMG A;  4CO2 A;  2BYC A;  4IRC A;  1AUS L;  3GR1 A;  2I38 A;  1AA1 B;  2HQC A;  1K1Q A;  4DV1 F;  5GAD U;  4FF2 A;  1QAJ A;  3D3B J;  5A6W A;  3SQG A;  1PAU B;  1HIY A;  4QW9 A;  4KGX B;  2XG8 A;  5CYM A;  5A6P A;  2W8K A;  4OX8 A;  3CPW R;  1N34 J;  2W8L A;  1GMU A;  3A4T A;  2LQJ A;  1JIH A;  4ALZ A;  2FJD B;  2QMU B;  4LBI A;  4OHV A;  4QR0 A;  1VJW A;  3LO3 A;  1RTD B;  2UXD F;  1RWK B;  3MXH P;  2KYZ A;  3QO9 A;  3VAF A;  3IWN C;  1T03 A;  5H9F K;  3BYP A;  3AXM A;  2FPH X;  4KGM A;  4LR7 A;  5GME A;  4I7F B;  3CED A;  2MQQ A;  4GO7 X;  3TOQ A;  2R2U A;  1NO8 A;  2MTL A;  1WSR A;  4I6A A;  3D1O A;  1T9V A;  1Q4R A;  1VLY A;  3NOC A;  4IG0 B;  2DGQ A;  2QT7 A;  4QBU A;  4DL5 A;  3JB9 k;  4JI4 J;  4NLG A;  1JLG B;  1KKH A;  3Q8U A;  3VZH A;  2HRT A;  2OPR B;  5RUB A;  4DUY F;  1Q79 A;  5L1I A;  4KPY A;  3LOU A;  2OD4 A;  1C4A A;  2EG1 A;  3IGN A;  3N28 A;  2HWI A;  4M95 A;  1N56 A;  1YJ7 A;  3G87 A;  3OTO J;  4DR5 F;  1Y0H A;  2FB0 A;  3C66 A;  2EFO A;  1SL2 A;  2BAC A;  2JEJ A;  1RT2 B;  4LRD A;  3AJ2 A;  3W62 A;  3ZTR A;  1G2E A;  4GVB A;  1FKP A;  3D1Q A;  1BE4 A;  3GWC A;  1TKX A;  4W92 B;  3GV5 B;  1JLG A;  1Q1K A;  1F5A A;  2OFG X;  3M8R A;  3TO8 A;  3MPD A;  1Y00 A;  2C3O A;  3CC4 S;  3H8Y A;  3K7R A;  2MZ1 A;  1PSD A;  1IXK A;  1XIQ A;  2DEJ A;  2Z2Y B;  4OJ1 A;  2ZJP Q;  2PFF B;  1IR0 A;  3HDS A;  3QAU A;  3Q0A A;  2JX2 A;  5BYR A;  5KG0 A;  4KRW A;  3D4J A;  3SCJ E;  3KDO A;  4CWB A;  1KLM A;  3ETM A;  3UDE A;  2VFV A;  3V4I B;  2ASJ A;  4F3Q A;  1S1W B;  4ANC A;  1X9S A;  4LF6 F;  1GXU A;  3FQK A;  3TZZ A;  1AFJ A;  1UEU A;  3TZW A;  2J7W A;  3ENA A;  2ALZ A;  1HR0 F;  2MHN A;  5HQM A;  1CUL B;  4F26 A;  2VIC A;  4HT7 A;  1FD8 A;  1Y4Z B;  4CLZ A;  1X0P A;  3RR7 A;  3SCL E;  3JYT B;  2L48 A;  2Y3Y A;  5F8I A;  4PRF A;  4Y65 A;  1EQ0 A;  2AJ0 A;  3I0R B;  4J9Q A;  1Q86 T;  1CJK B;  1FJG J;  2O3D A;  1Q8B A;  2CQG A;  5HQ8 A;  3LQV A;  3IM8 A;  2CJ9 A;  3KHR A;  5KOX A;  2HNY B;  5D4N A;  4LFB J;  3RAQ A;  1WG4 A;  2UVR A;  2HZA A;  1DBD A;  2VL1 A;  2PGC A;  1R6V A;  3L95 X;  5KFB A;  2CQ4 A;  1G4C A;  2CNK B;  2DNH A;  1R27 B;  1RE1 B;  3I9Z A;  2ZD1 B;  1AZS A;  4GKJ F;  1NK9 A;  2K7J A;  3OR1 A;  3ZZU A;  1EAR A;  3TEH B;  2HND B;  1M5H A;  1WG1 A;  1S57 A;  1VQS A;  2M8H A;  4OZN A;  1VFJ A;  4TNO A;  3UD3 P;  4RNF A;  2GW8 A;  4H54 A;  4X84 A;  2R2S A;  1SL1 A;  2KT3 A;  2NSB A;  3G8Q A;  3VGV A;  1MML A;  1S6O A;  2GQ2 A;  4Q7A A;  3MM5 B;  3NL0 A;  3R5J B;  2HGM A;  2UV8 G;  4DJB A;  4D3G A;  1YHQ S;  4RLE A;  1KR4 A;  2CPX A;  3QGP A;  2FHK A;  3IG1 A;  4R8U B;  4PPD A;  1XNR F;  1MN9 A;  4RW4 B;  4DR4 F;  3W65 A;  1F60 B;  2V2K A;  4LF1 A;  4TYB A;  1ZYQ A;  1S6U A;  1I94 J;  1B3T A;  1Q16 B;  1OYD A;  4GMK A;  4HI1 A;  2RHQ B;  5IZH A;  4KYZ A;  1Z4U A;  3BDP A;  1CJV A;  4O3P A;  3V5R A;  5HQL A;  4I67 A;  2RHS B;  3PIO Q;  2YWG A;  2C3M A;  3GG1 A;  2XHW A;  4C7Q A;  1IR1 A;  4ZOS A;  5B0B A;  3D6F B;  3VAG A;  3MD3 A;  2FZG B;  2MGZ B;  2ERR A;  1R0A B;  3TUZ C;  3PW5 A;  4DV4 J;  1HR0 J;  1SXL A;  2H65 B;  1SIW B;  2EW9 A;  2LDY A;  2CYY A;  1R8A A;  2QA4 S;  3B54 A;  1UAW A;  1FD2 A;  2BV3 A;  2DHX A;  2ZVI A;  1TKD A;  2HS0 A;  1NHV A;  4WP3 A;  3QZ7 A;  5I42 B;  3PRV A;  4PXD A;  3RB3 A;  1IVZ A;  4C98 A;  1SH2 A;  3KHL A;  3ZFV A;  4LSZ B;  4IH6 A;  2MGZ A;  2XZW A;  4MK9 A;  4LBP A;  1IKV A;  2WZ1 A;  4JV1 A;  1HBM B;  1OY6 A;  2M70 A;  2MHE A;  3QNW B;  2Q66 A;  1LQ9 A;  4JP8 A;  4C11 A;  3C2P A;  3DOM B;  4EU0 A;  1IBM J;  4QYZ J;  2Y1J A;  3W2W B;  2RUS A;  4O23 A;  1GEH A;  1WAC A;  3EM1 A;  1VIS A;  2DT9 A;  2FC9 A;  3HD2 A;  4CP5 A;  2DRA A;  3HHN B;  1TV6 B;  1TAU A;  4R8U A;  4DR5 J;  5AE3 A;  4MYT A;  2YPY A;  1XTZ A;  2QC3 A;  2E44 A;  2DIV A;  3DC2 A;  2QL7 B;  4P52 A;  5E7O B;  2J8A A;  2ZOM A;  3AOD A;  5HJY A;  3H40 A;  2XSF A;  4QPX A;  3W5Z A;  4LSL A;  4N8N A;  1FDD A;  1S77 D;  4KE5 A;  2MZS A;  1JK9 B;  2GGP B;  2B8P A;  3DOK A;  3TA0 A;  4DUY J;  4C8K A;  5D4L A;  1OQ3 A;  2EKY A;  1WKJ A;  1MN7 A;  2ROP A;  3RJM B;  4KKO A;  2WOM B;  3K2Y A;  4JI4 F;  4OJG A;  4NCA A;  2DY9 A;  3QRP A;  4DV6 J;  3PNI A;  3LF0 A;  5IC4 B;  3FK4 A;  4P71 A;  1QD1 A;  3IWL A;  2RIL A;  3GFH A;  1FE4 A;  2H4W B;  3TVK A;  1SJF A;  1X4E A;  1KN6 A;  1S0N A;  4L76 A;  2GJF A;  3CXC R;  1WKK A;  2J9E A;  2UUB J;  3D28 A;  1RT1 A;  2MXY A;  2JEF A;  2VF3 A;  4DCO B;  1V5V A;  1R8H A;  2UXD J;  1EKS A;  4WE1 A;  2XY7 A;  4JV2 A;  3I5A A;  4F67 A;  4F0M A;  2UXB J;  2KXN B;  4J7C A;  2MQO A;  3ZZP A;  3MM7 B;  4OZ5 A;  2HHX A;  4DPW A;  3PV8 A;  1VQP S;  2HK2 A;  2WVE A;  3H4B A;  3FEZ A;  2G2Y A;  5SZT A;  3PIP Q;  2A1B A;  1JX4 A;  3KOA A;  4CLY A;  4ZVG A;  1T9T A;  4EBC A;  2EXU A;  1NBE B;  1SC1 B;  1SQF A;  5BR8 F;  2F4V F;  4X4U A;  1UKU A;  1SVD A;  4LBH A;  3M7V A;  4BBY A;  3LTO A;  5J2Q A;  5H9E J;  3BM7 A;  1LWF B;  1U47 A;  1B7F A;  1YVF A;  3HHL A;  3PEH A;  4NL5 A;  1SPB P;  3W7B A;  4BC7 A;  4QIE A;  3K0J A;  1FKP B;  4K5S A;  4RPF A;  2XCP A;  1WF2 A;  1KVI A;  8AT1 B;  4XPC A;  4A8F A;  1MWQ A;  2VDI A;  4FF3 A;  3MMC B;  5ITH A;  3KHG A;  1BGX T;  5ETO A;  3KJQ B;  1V6H A;  3TA2 A;  1MLA A;  2QL5 B;  1MMD A;  4FBT A;  2ZKT A;  1Q78 A;  3A13 A;  3CDA A;  2XCA A;  4ECX A;  3N6M A;  3NCR A;  4HEA 9;  3HKW A;  2DXD A;  1CLF A;  3H5S A;  4X62 J;  5BR8 J;  2YNF A;  1KSP A;  2F4V J;  2VBZ A;  1ZA2 B;  5KFT A;  3OTD A;  3UR0 A;  1RLD A;  2JDJ A;  3DN9 A;  1HWK A;  2YNI A;  2QSW A;  3DOM A;  2CIM A;  2ZM6 F;  1T0T V;  1Y9O A;  2RNE A;  1WEX A;  2ZNZ A;  4ID8 A;  4IUF A;  3KJV A;  1FK9 A;  2E5L F;  3TJA A;  3PYG A;  2KYX A;  2KZZ A;  4LIW A;  3UN2 A;  3THP A;  2ZHA A;  4K8R A;  4CI0 B;  1KP6 A;  4DL4 A;  4LT6 A;  4RR5 A;  1X9W A;  1Y5N B;  1HA1 A;  4WTY A;  3CD0 A;  1HI8 A;  3NP5 A;  2UVW A;  2JL9 A;  1VQ8 S;  4LF4 J;  2E1P A;  1URR A;  5AE1 A;  5CAA A;  4KO0 B;  1HKA A;  2F65 A;  3ONQ A;  5KAK A;  3KXD A;  5KFN A;  2LA4 A;  2HGL A;  1XR7 A;  1RKI A;  1G7C B;  1HW9 A;  1UFL A;  2DNM A;  2I1R A;  2MKY A;  2Z30 B;  2HVE A;  3GZ7 A;  4XAK A;  3CC7 S;  1Q5Y A;  4DCJ B;  4K50 A;  2V6A A;  1IQT A;  2VV5 A;  4DL6 A;  4K4T A;  2Z58 B;  2BQU A;  3OR1 B;  4ZJO A;  2XLI A;  2HZC A;  4ILR A;  2AP6 A;  3NBP A;  4ECT A;  2RE1 A;  4NRT A;  5C42 B;  1FRH A;  2DNQ A;  4YUD A;  2E7V A;  2HRU A;  1VC0 A;  4OYI A;  1ZM2 A;  3QAT A;  4NAS A;  1ZM3 A;  3J7A 1;  1FJC A;  1CC7 A;  2HG4 A;  1NB2 A;  1XJW B;  1REV A;  4IH5 A;  1VBZ A;  3V81 A;  1HQE B;  2DXF A;  1X7V A;  4N5S A;  3V6K A;  3QLH B;  1Q53 A;  3M9O B;  2AYG A;  8ATC B;  2FUG 9;  2BKN A;  2ILY A;  2MY8 A;  2VFT A;  2HFZ A;  1H0H B;  2ZE2 A;  3AY0 A;  1RHK B;  4IFV B;  4M8L A;  5AXK A;  3R97 A;  2MKI A;  3SEO A;  5HVG A;  3Q8P B;  4KB7 A;  4O0I A;  2DHH A;  1VBY A;  1K44 A;  3IXQ A;  3N5B A;  1WHY A;  3M8W A;  4ZDN A;  5GAG U;  4DR6 F;  2ZH2 A;  3S01 A;  1YG0 A;  3A8J A;  1ZAX A;  2NLW A;  1WOO A;  3B4D A;  4MK8 A;  1MRO B;  5GMK a;  3M8Q B;  4Y6I A;  4AD6 A;  3L7U A;  4FS2 A;  1S76 D;  3RW6 A;  3ETO A;  3DU6 A;  4TKT A;  2AF6 A;  2GVD B;  2OHD A;  5J2P A;  4NXM J;  4IQX A;  1NJZ A;  2OJ3 A;  2F8M A;  3HFV A;  1S6P A;  3EZO A;  2BXJ A;  3ZNU A;  4C3K A;  1Q82 T;  4M94 A;  4UST A;  2JVO A;  1VQ5 S;  3NNA A;  1CJU B;  2IVF B;  2ZH4 A;  3SI8 A;  1KVK A;  3THV A;  2AKW B;  4KY3 A;  3AOA A;  3I55 S;  4GVB B;  2EBE A;  3WC2 A;  3BF4 A;  3IP0 A;  3NS6 A;  3KLG A;  3KLF B;  2HHH F;  1TL7 A;  3QZ8 A;  3GV7 B;  3DFE A;  1SC3 B;  2D1C A;  1Z1Z A;  3IBC B;  4JI8 F;  4Z37 A;  5GAH I;  5C25 B;  1E6Y A;  5DLG A;  5I3U B;  2E5J A;  3IAS 9;  3GYN A;  3IBW A;  4PXB A;  1V9O A;  4QQB A;  3J7A N;  3QRQ A;  3DLJ A;  2R3V A;  3ZZT A;  2GIQ A;  1KLM B;  3OFG A;  3HHD A;  1W2B R;  4ZVO B;  4JI5 J;  4F4W A;  2MYF A;  2PEB A;  3WZ0 A;  1NB7 A;  3OL7 A;  2DNK A;  4ZMM A;  2GHP A;  1S7H A;  2R7R A;  2WVB A;  4C0B A;  4TLQ A;  1JLQ B;  1OPZ A;  1W7W A;  2C2N A;  5KFS A;  3J7Y U;  5KFL A;  2X1B A;  4DSE A;  3FRZ A;  1VQK S;  5HRO B;  4AXJ A;  3HUL A;  3KLI A;  4PZV A;  3QSI A;  1NKE A;  3NS5 A;  2IRU A;  2M5Y A;  3WIU A;  5HMY A;  1AXQ A;  1RWP B;  1S7I A;  4UZC A;  3GJS B;  2KG1 A;  1JKH A;  5C2G A;  2C2D A;  2NPI A;  1M0S A;  1X4C A;  2IVM A;  3DYA B;  4AQY F;  3MEE A;  1DLO B;  1WEY A;  2LXU A;  3AQP A;  3I87 A;  3OFE A;  2AEJ A;  2OPS A;  2HK3 A;  3CMQ A;  3NAH A;  3QGI A;  2HBZ B;  4PCQ A;  4RNM A;  1H7W A;  1YBU A;  3MFH A;  2G2O A;  1VJQ A;  2OFH X;  4R0E A;  4X64 J;  2VA2 A;  1CPZ A;  3MPY A;  2RQC A;  1H3D A;  2QTW A;  2DK2 A;  1Q81 T;  2BE7 D;  2JWN A;  5L46 A;  2FQQ B;  1U2R A;  3MMB A;  5HVH A;  1SB6 A;  1FWP A;  1F3V A;  4M5I A;  3KLH B;  4B3M J;  3MTK A;  1ITP A;  3VR1 A;  3S6E A;  3I31 A;  5F41 A;  2V2V A;  2DR5 A;  1IN0 A;  5MLC V;  1LW0 A;  3ET6 B;  2FY1 A;  2MDA A;  2AT1 B;  5HAT A;  1LWE B;  1H72 C;  3D6T B;  2Y9H A;  2F1F A;  2D9O A;  3GE9 A;  4QWD A;  4K4W A;  3BDE A;  3ILO A;  3NOG A;  4NLQ A;  1T9W A;  4CO5 A;  1FTC A;  2YH0 A;  4P2M A;  5DGB A;  5G0R B;  4ICL A;  5DDP C;  5D4O A;  2D3Z A;  3TNV A;  2JHE A;  2C2Z B;  4FN5 A;  1X4G A;  4DU7 A;  4UOG A;  3PR4 A;  4F2R A;  4HHH A;  3MUR P;  2R7V A;  1HAR A;  4TY8 B;  3WC0 A;  1QDU B;  1JLA B;  1LOU A;  1HBM A;  1UVK A;  2WB4 A;  4OFZ A;  1XC9 A;  3DDK A;  2KXF A;  3GIL A;  2YX1 A;  4JI8 J;  1CVJ A;  2OIH A;  2R7U A;  1RWN B;  2Z56 B;  3AAW B;  4E2F B;  1MG7 A;  5K14 B;  4OIX A;  5B7W A;  4RZR A;  4QCL A;  2HHP A;  3RR8 A;  3UVJ A;  1F5C A;  1VQ6 S;  1XR6 A;  3FNN A;  4TU9 A;  2CQH A;  3TUJ C;  1BUX A;  2QA1 A;  4O44 A;  4OZ0 A;  3BGF A;  1N32 J;  1F3F A;  1PG5 B;  3R2D J;  4MKV A;  3FJ2 A;  4NX9 A;  4DPT A;  4R5P B;  1G3O A;  3EGN A;  3H42 A;  5J2M B;  1K0V A;  4DSL A;  4CH7 A;  1CJT B;  3K5M A;  4GO5 X;  2RD5 C;  4A46 A;  4YP3 A;  1UW9 A;  4RBV A;  5GAD I;  1OO0 B;  2WOM A;  2W9B B;  1U6F A;  2DH7 A;  3SDE A;  4K2J A;  4O4R A;  2XGP A;  3FBF A;  2BR0 A;  4V19 J;  4IFY A;  2AQ4 A;  4J9O A;  3ZNJ 1;  2BDP A;  2RT3 A;  5K20 B;  2CXE A;  1Y5L B;  3IC1 A;  1X9M A;  2DGT A;  4EYH B;  5D0H A;  3GQC A;  2VOD A;  2HHT A;  1HMV B;  5KFP A;  1PJ5 A;  2CNL B;  3MM9 A;  1WDD A;  4TLR A;  5BJR A;  4CIO A;  2Q1L A;  1F6T A;  2PII A;  1YRX A;  2CPH A;  4Y2C A;  3BPS P;  4A8K A;  3PDN A;  1VRT B;  2DXE A;  2IM3 A;  3CJK B;  1T05 A;  4FVC A;  1WHX A;  4DSF A;  3DI6 B;  3DRX A;  3OR2 A;  2B3T B;  2I5J B;  4OV6 A;  3BGL A;  4DF4 A;  1GX5 A;  2A0F B;  3W9H A;  3IRX A;  4IR9 A;  3T6J A;  2HBR B;  3PKM A;  4DN0 A;  2KU7 A;  3B82 A;  2LMI A;  1ZBT A;  4P2F A;  1IKY B;  2QA4 G;  3PM9 A;  4IYQ A;  3GII A;  3GIJ A;  1R8P A;  3MM8 A;  3QT8 A;  3CJR A;  2FLL A;  2IJF A;  5IXU A;  3RBD A;  2IBO A;  1N6Q B;  3CE8 A;  2KHD A;  2QIF A;  2EK6 A;  2Q79 A;  2XSJ B;  2BAB A;  4IDK B;  3UWT A;  9ATC B;  3A3P B;  1FES A;  4HLB A;  3GIM A;  4HHU A;  3LGN A;  1UET A;  2IA6 A;  1F1B B;  3QGG A;  1TP7 A;  3FQL A;  4A4J A;  2GML A;  3CD5 A;  3M1V A;  5KFK A;  1VYA A;  3V4I A;  1ICE B;  3O5T B;  1KNZ A;  4ZHR B;  3W9I A;  4JI6 F;  4LRA A;  1U45 A;  3UNG C;  1CUL A;  1FEH A;  5EGY A;  3CME S;  3OW2 R;  4HTJ A;  3C3L A;  1XBW A;  2EC2 A;  2CQI A;  4RBT A;  2R7S A;  4H4O A;  4NXN F;  4F0H A;  5KFG A;  4CM0 A;  3C6T A;  2OML A;  1LW0 B;  2LU1 A;  3ET6 A;  4DV2 F;  1S1T A;  4M5L A;  3CJ3 A;  2F3J A;  4ELT A;  3QRR A;  5IT9 Y;  2DBB A;  2K3K A;  4HVZ A;  3SSR A;  3KHH A;  2ASL A;  2CZ9 A;  5JVH Q;  1UVJ A;  4ZN3 A;  1S12 A;  4ECU A;  1HNI A;  2N7Y A;  2WSE C;  1JKH B;  1NND A;  1T9U A;  2GIR A;  2HQD A;  2VBX A;  4M5H A;  3W64 A;  2XMM A;  2OPR A;  3CGI A;  3GYX B;  5GAH U;  1N36 J;  2GJ2 A;  1QVF R;  4KHM A;  4ES1 A;  4J9N A;  1QE1 A;  4QPT A;  2A3J A;  1VHI A;  2OPS B;  4TN2 A;  3IBF B;  3HP6 A;  1DTQ B;  2Y0B B;  2LQ9 A;  1V5I B;  4MH8 A;  1U2C A;  4NLU A;  1RU1 A;  2BZ2 A;  2FVC A;  2K1R B;  2GNK A;  2B5J A;  2P9C A;  4USK A;  1SQE A;  5A8K A;  2G2Z A;  3T1Y J;  2C2R A;  1C0U A;  1LWX A;  3ISN D;  3LUY A;  4JI0 F;  1NKB A;  1PC5 A;  2JEI A;  4U8Y A;  5DM6 Q;  2H5E A;  3NEK A;  4FZV A;  1SC4 B;  1U09 A;  3D0G E;  1Y11 A;  1PKU A;  1T94 A;  4X4Q A;  1YJU A;  2GA7 A;  2Z0G A;  2IY5 B;  2YNH A;  3Q8V A;  1UCN A;  3D66 A;  4OMF G;  4I64 A;  4WP8 A;  5E5N A;  4Y2I A;  2VJV A;  4DV0 F;  4CZC A;  5A8R B;  5DJB A;  4ZIT A;  4UQG A;  1LNQ A;  3BKT A;  3TWZ A;  2KH9 A;  4MT1 A;  2YQ0 A;  3ZZZ A;  5KFI A;  3CMA S;  3CF5 Q;  1KOH A;  4I1T A;  4A8X A;  1EHW A;  4X4N A;  4V19 X;  3DXB A;  4LSN B;  2PA3 A;  4KGV B;  4HYK A;  2D3O 1;  2EI5 A;  3OL6 A;  2NZ4 A;  3ZTS A;  3BBB A;  4FF4 A;  1SQG A;  2EC0 A;  4MIW A;  3ELH A;  4NLY A;  3Q8Y A;  3UNY A;  4EWT A;  5DDQ C;  4L6V 3;  2VFU A;  1NH8 A;  2R7W A;  4ZP9 A;  2B56 A;  4B3O A;  4EO6 A;  3CCM S;  1FVS A;  1NUE A;  4XK8 C;  2ZC4 A;  2WBM A;  3I32 A;  1IBC B;  4EO8 A;  2ZH1 A;  2VQF F;  1Y3K A;  2HMI A;  1VQL S;  1KDN A;  2V9W A;  2LDI A;  3NGD A;  1HNX J;  2DPJ A;  1YWX A;  2FYX A;  2QGF B;  4JI1 J;  2K1R A;  1RTI B;  1NJI T;  4DQQ A;  4NRU A;  1P6T A;  3H5X A;  2V4J B;  2BJD A;  2NPF A;  2GQC A;  3AB4 B;  1J5E F;  3MEC A;  4ATN A;  2VFR A;  2AMC B;  3A1Y G;  3HMJ G;  2POK A;  1YX2 A;  2HHQ A;  1IKX B;  1MSW D;  1HNV B;  1VLO A;  4C2M A;  2W4P A;  2AV5 A;  3SMZ A;  2NCK L;  4WXW A;  1LFP A;  3BB5 A;  3TRG A;  4NEZ A;  4RUH A;  1N33 F;  1RAF B;  3BSA A;  1JB0 C;  3H2L A;  5CYJ A;  2DIT A;  2ZH7 A;  2D3O R;  1NK7 A;  1WHV A;  4H4M A;  1QSY A;  1Q8I A;  4B3T F;  2C3Y A;  3C14 A;  3M8P B;  4I2P B;  3ZXW A;  1RT7 A;  2F9J A;  4DHV A;  3H90 A;  4DL7 A;  2ASD A;  2VON A;  1L3T A;  1B0P A;  2DGX A;  3A8E A;  3W2W A;  2KN4 A;  7AT1 B;  5HMX A;  3PW7 A;  1JXE A;  3DHX A;  1IBL F;  1FFW B;  4WZM A;  1R3N A;  4O4G B;  3VAI A;  2XBP A;  5L9N A;  2EFP A;  3GCX P;  1J2V A;  2PA8 D;  4JI2 J;  2L9W A;  4B9U A;  1UEV A;  3JAM U;  1C1C B;  2IM2 A;  2VG7 B;  3VAK A;  1VC6 A;  5F8J A;  2F7V A;  2OH2 A;  2LQB A;  4EGL A;  3PHT A;  4N77 A;  3MR3 A;  2VD3 A;  4WBF A;  4BS2 A;  3PTW A;  2HW3 A;  3NG8 A;  5EWE A;  2SXL A;  4DZD A;  5T41 A;  1VMB A;  1JJ4 A;  2CWX A;  1XN9 A;  2AHO B;  2R4F A;  1EAY C;  4OZ1 A;  2MQL A;  4N8O A;  1VOM A;  3AA8 A;  2UUW A;  1RTJ B;  4NLV A;  2BQR A;  2JVR A;  1K73 T;  2IMW P;  3BQ1 A;  3C15 B;  3MPW A;  4DV6 F;  3KG4 A;  1GK8 A;  2XMW A;  3W1Y C;  5L1L A;  3VZI A;  2FLP A;  1TTH B;  2MZR A;  3FMB A;  5E2Q A;  4DLE A;  1YTY A;  3GLJ A;  3D6H B;  5IT0 A;  4EI2 A;  4PAB A;  2GFF A;  1ZM4 A;  3BBF A;  1RAB B;  2W2N P;  3LAM A;  1B4S A;  2VG5 A;  3BR8 A;  4D3H A;  3OUY B;  4CLL A;  2W2P P;  2KT5 A;  3EXC X;  4ZS6 A;  3NNH A;  1JNR B;  4DI6 A;  1GQE A;  2XGQ A;  3CCT A;  2A18 A;  4QOT A;  3CD6 S;  4C8L A;  4RJV A;  2EVZ A;  1ZZF A;  4ZLP A;  1FJG F;  2ROG A;  3BGR B;  4ZPD A;  1B0T A;  5IT9 U;  2B9W A;  5K8M A;  3T9Z A;  2BAN B;  2Z2Z A;  2VKZ G;  1WEL A;  3QYY A;  3CB4 A;  2FHM A;  2W9A A;  4JBC A;  4K4X A;  2IBK A;  1NSP A;  4XPE A;  2RAQ A;  4OI6 A;  3BKF A;  3NGR A;  1WC4 A;  3RBZ A;  4CO4 A;  1QAX A;  5FII A;  3C46 A;  2Z2L A;  2LA6 A;  2MKJ A;  1RT4 B;  4OLP A;  4ZPW R;  4RNO A;  1NK4 A;  3BR9 A;  4B3R J;  3HVR A;  2M4M A;  4ZLJ A;  4EYI B;  3MR5 A;  3MMC A;  5KFO A;  3TVY A;  2XUL A;  4KFB B;  3I0S A;  1ACM B;  1H6K X;  3J81 Y;  3MUT P;  4QWA A;  2HGN A;  4B9V A;  2IFX A;  4CLU A;  1WEZ A;  3OJS A;  4LFB F;  3OXL A;  2GC8 A;  2Y1L B;  4LQ9 A;  3J81 j;  1RI7 A;  2DY1 A;  3R5D A;  3CDU A;  3JYT A;  3GB0 A;  5EN1 A;  4DX5 A;  5EUH A;  1LFW A;  2IC3 A;  2HNZ B;  4HKQ A;  2C42 A;  2DH8 A;  5F8M A;  3V6J A;  3MCM A;  3N0V A;  2Q6C A;  4DF8 A;  3I0S B;  4DR4 J;  4IRD A;  4ZIW A;  1EX8 A;  3F0N A;  3K17 A;  3N9U C;  4RUC A;  4F4Y A;  3BYR A;  3V6D B;  1M1K T;  4QU7 A;  1LWF A;  2HWH A;  5B08 A;  1KQG B;  1BQN B;  2AYM A;  2CJQ A;  1NJY A;  3PO5 A;  1A9N B;  2WVD A;  1BD6 A;  3AJ1 A;  4K59 A;  3IN5 A;  4LF7 F;  1XK8 A;  2LU2 A;  2WW4 A;  3H2U B;  4WE1 B;  3IR7 B;  5F9N A;  4X4R A;  4DR3 J;  3RTV A;  4E0D A;  4RWW A;  5HMW A;  5KG7 A;  2AGP A;  1U7L A;  1X5S A;  2CNO B;  3HLU A;  3UDV A;  3LWL A;  1JJ2 R;  2XS5 A;  3OFH A;  2WSC C;  3HSG A;  2WCX A;  5H9E K;  4ECS A;  1SUQ A;  2XY6 A;  4Q45 A;  4DR3 F;  4PQU A;  1CG2 A;  2XLK A;  1RT2 A;  2HAI A;  2QZ8 A;  3DMJ A;  2OI2 A;  1MRO A;  1HWJ A;  4Q5V A;  2VG5 B;  1S1U B;  3QIP A;  2AW0 A;  2OSR A;  1D1U A;  5F8N A;  1AFI A;  1O5J A;  1BC6 A;  1RCO B;  5KFY A;  3HJF A;  2O1P A;  2BRK A;  1U6Z A;  3SV3 A;  1M90 T;  3GR0 A;  4HH0 A;  4OI2 A;  5M2R A;  3AHP A;  2P6T A;  4ZN1 A;  2M0G B;  4PYA A;  3Q2T C;  1RJJ A;  3UQS A;  2DJW A;  5LSO A;  1HHT P;  3M6X A;  3MFI A;  2WON B;  5F3T A;  1KBR A;  2EWH A;  5DG7 A;  2X7I A;  2HYI B;  1L5U A;  3N5F A;  3EGZ A;  4B3T J;  4JI3 F;  1HWU A;  2HIQ A;  1SJ4 P;  1HNI B;  5E33 A;  2FJE B;  4ED8 A;  1NSQ A;  4F02 A;  2HVI A;  3JQJ A;  2R7T A;  1ZM9 A;  3BSN A;  4B3R F;  3AH6 A;  2V94 A;  2WW8 A;  3FCV A;  3D7S B;  4OHW A;  4MAK A;  2W9C B;  1S72 S;  2UUC F;  1EZZ B;  3G8T A;  4CM2 A;  3GJR B;  1BQM A;  2ABY A;  4EUV A;  3IRX B;  1IKV B;  2EFG A;  1U8S A;  1ZA1 B;  4WFZ A;  5AT1 B;  3MMA A;  3TP2 A;  1YGY A;  4QWE A;  1TFW A;  2MKS A;  1J5E J;  3RYL A;  3GV8 B;  2RSQ A;  2F40 A;  3G82 B;  2OUG A;  4USI A;  2HQF A;  4EZ9 A;  3ITH A;  4LF9 F;  2ZE2 B;  1FFS B;  4IFV A;  4JI1 F;  4O3R A;  4DPO A;  2R8K A;  4DPY A;  1QAI A;  4MKY A;  2ZBQ A;  3QT7 A;  2I8E A;  4AT1 B;  1FXL A;  1RT6 A;  3PFO A;  1P9Q C;  2V34 A;  4TQR A;  4IH7 A;  2VQF J;  3MMA B;  1VIX A;  2NSC A;  2V8P A;  3LH2 S;  2J6U A;  5A0Y B;  2V4J A;  2QG9 B;  5B0F A;  1QLN A;  2QLW A;  3CJ8 A;  2J9D E;  4C4W A;  3H5Y A;  4O44 B;  2VKR A;  3PJW A;  1S1X A;  1FX2 A;  4NZ0 A;  2DNP A;  1ZET A;  1XMO J;  2PE8 A;  2B51 A;  1VRT A;  2IM1 A;  3AD9 C;  2NXC A;  3FEY B;  5KFF A;  2C2E A;  1Q5V A;  3OQ2 A;  2V8G A;  1SL0 A;  4DCP B;  4C0O C;  2PEH A;  3W2V A;  1U49 A;  2L9N A;  1F9F A;  3LAK A;  1NSA A;  2HPU A;  3V6H A;  3I56 S;  3VV2 B;  2VIH A;  2XMK A;  3T3F A;  4Y28 C;  4X2B A;  4DPU A;  2XTJ P;  4GRS A;  2FJW A;  4G1P A;  4F4Z A;  4IR1 A;  4DQP A;  3MEG A;  3IAM 9;  1BLU A;  3Q24 A;  4Y2A A;  1B99 A;  3CJQ A;  3M8P A;  2DNN A;  3US5 A;  5KG2 A;  3T1A A;  4LFC F;  3DNC A;  1NDP A;  1SJQ A;  2E5H A;  3W9J A;  1H2V Z;  1OQ6 A;  3QMQ A;  4UW2 A;  3IA0 A;  2ZOG A;  1U0H B;  2BW7 A;  1EQM A;  3WIV A;  3FEX B;  4JI0 J;  3HXM A;  2YKN B;  1VCT A;  4PKD B;  4M5M A;  1NCL A;  2V0N A;  4OZJ A;  3MDF A;  4S0M A;  4IO9 Q;  2OAU A;  4NLW A;  2ATC B;  3CDB A;  3MWB A;  3SSQ A;  3SV4 A;  3RRG A;  2LEC A;  3KUE A;  5HLF B;  1LWE A;  2JLE A;  2YY3 A;  3DXS X;  2W7O A;  2VQE F;  1JLF B;  2DR9 A;  2QFJ A;  4NCG B;  2YX7 A;  1YKW A;  2JZ5 A;  2YNG A;  2HS3 A;  1RKJ A;  2MZT A;  3ENW A;  2IIH A;  1RHQ B;  4B3O B;  2QRR A;  1PBU A;  3MR7 A;  1M1H A;  3E8O A;  3IO1 A;  3DRR A;  3DYA A;  3MAA B;  3N6N A;  4WFY A;  3KTQ A;  3P45 B;  3T5L A;  2XYP B;  1UA1 A;  3HHK A;  1IBK F;  1MWZ A;  1T9Y A;  2CAJ A;  1DUR A;  1RWO B;  3B6B A;  4F4A A;  4ER8 A;  1FKO B;  5HI7 A;  4Z2X A;  2P9G A;  2UUT A;  2AD9 A;  3G4S S;  4KQZ A;  5LMN F;  4UZB A;  4ZCL A;  3I0R A;  5DO2 A;  3WDO A;  4C48 A;  4ZJL A;  2ZUA A;  1TZ0 A;  2CFX A;  1HD0 A;  3CJS A;  2V63 A;  3MD1 A;  1TKX B;  1N48 A;  1YBA A;  2BM0 A;  4G6V B;  4ZCI A;  4ZLN A;  5FDL A;  4JI6 J;  1RTH A;  2WTF A;  3U1N A;  3UCZ P;  2BUN A;  1QVG R;  3TEG A;  4ZPT R;  1S6Q A;  3OTE A;  1M5P C;  3E2E A;  2HHU A;  2B4V A;  2PN6 A;  2HBY B;  4B17 A;  3BN4 A;  4W90 B;  1RK8 A;  4GKK J;  2CRL A;  2Z4P A;  3FBC A;  1CSJ A;  4H4K C;  4JYA J;  1HQU B;  3VGU A;  3KLG B;  1RBL A;  1NHK L;  3K58 A;  5A2Q Y;  3W5X A;  2YTC A;  3R7S B;  3CCZ A;  3M4X A;  4USM A;  1BQN A;  1K47 A;  3OD2 A;  3TAM B;  2C2K B;  7FD1 A;  2DR8 A;  5IQ6 A;  3NLC A;  5KT6 A;  2AYB A;  2BQ3 A;  4B9T A;  5KG4 A;  5L38 A;  1WWH A;  1XR5 A;  2DNZ A;  2KM8 C;  3D54 A;  3IR5 B;  4DV7 J;  2IRX A;  2JC1 A;  2KXH A;  2JNJ A;  4WK1 A;  4YR3 A;  3EX7 B;  1XWL A;  3Q89 A;  4J9L A;  4OYA A;  1VGY A;  2W4D A;  4FXV A;  2O01 C;  1DTQ A;  4KHP F;  2AEF A;  4G65 A;  4NLP A;  4FXD A;  2G1H A;  4TY9 A;  1NDK A;  5AXM A;  3K59 A;  2HVD A;  3GON A;  1REV B;  3TZY A;  5G4D A;  2MKK A;  2DH9 A;  3PG9 A;  1KON A;  4H4O B;  4OX6 A;  4RW8 A;  2D7S A;  1XQI A;  2QV6 A;  1YJ9 S;  2FVQ A;  1P9Y A;  2R8G A;  5CD4 H;  2YQ3 A;  2RKI A;  4NMX A;  5ETV A;  3OVA A;  4CLW A;  2RRB A;  2V5H G;  3I82 A;  2GAG C;  1KQK A;  3V4M A;  2K06 A;  4B08 A;  1TL1 B;  4O4G A;  2ZH9 A;  2OEL A;  1RAO A;  3C6U A;  4DV3 F;  2C28 A;  2MKH A;  1VQ4 S;  5BYQ A;  1M5K C;  2QLJ B;  3GPA A;  1W25 A;  3MTJ A;  1D8Y A;  2GVD A;  1FRX A;  3FUY A;  3GSD A;  4MMO A;  1WDT A;  3KK3 A;  2AZ3 A;  2CQ2 A;  1NDL A;  1FX4 A;  3K8V A;  3D6M B;  1LK7 A;  4O3Q A;  4X66 J;  1HD1 A;  1EKR A;  2A6M A;  3KNA A;  1NPP A;  1RSC A;  3FCW A;  2A2C A;  3D67 A;  2F9D A;  3KLV A;  4DV5 F;  5I3Q A;  1N4L A;  4W98 A;  3CCS S;  2Z2M A;  3CSK A;  3GG0 A;  4CNY A;  3TAQ A;  5D3G B;  3M8S A;  3MMJ A;  4XO0 A;  3D0H E;  1SKW A;  3TW0 A;  3WBZ A;  3HT0 A;  4ELU A;  1NHU A;  3GIR A;  1Y5I B;  1LW2 A;  2DEI A;  3K8W A;  1H98 A;  1TAQ A;  3GJQ B;  4U95 A;  2MMY A;  3W66 A;  3NGT A;  1RBA A;  4ID5 A;  2LFV A;  4QZV B;  1IKX A;  3HSJ A;  3OR2 B;  3B4M A;  4NML A;  2P2C B;  3TJ9 A;  2FLO A;  4UOH A;  3A8I A;  4AE5 A;  4NZ7 A;  4OJH A;  1SI9 A;  3P8B B;  4KO0 A;  4CDI A;  1KHV A;  3C6U B;  3OPK A;  4CRJ A;  4LF5 F;  3OBI A;  2BJ3 A;  2CQ0 A;  2D74 B;  1RWV B;  5L8R C;  2C2O B;  4L3K A;  2HND A;  4XDC A;  3VVU A;  5FDL B;  4URQ U;  4CH1 A;  4PUO A;  2BMB A;  3C8Y A;  3DLK A;  5ETM A;  2RRA A;  2EKN A;  4X65 J;  1BQX A;  2DR6 A;  1S9F A;  5KFU A;  3Q2S C;  3FDS A;  4KGZ B;  4QJV A;  1S6Q B;  4EMD A;  4ECW A;  4Q8E A;  4UY8 T;  3PYF A;  4AYB D;  2JSX A;  2KRB A;  2RQ4 A;  3CCR S;  4DG1 A;  1UVN A;  1FA0 A;  3NGK A;  1TMM A;  1N33 J;  1HQ2 A;  1RXO B;  4YEA A;  4KH1 B;  3RGI A;  4F0K A;  3MUM P;  4DQS A;  1UJ6 A;  2FD2 A;  2RVJ A;  4RO0 A;  3BSO A;  1EIY B;  3BRE A;  2B4O A;  4ZPC A;  5ETQ A;  1FWK A;  3KUH A;  2DO4 A;  2FZK B;  2P9E A;  2MLX A;  1PJ7 A;  3OHA A;  2UU9 F;  1J27 A;  1V3Z A;  2DHA A;  4ZPV R;  2VA3 A;  1VHF A;  4QIF A;  1C0U B;  1Q0N A;  4C3M A;  2HUR A;  4ES3 A;  1YBT A;  3BH6 B;  1I51 B;  3PHE A;  4F7V A;  2NXU A;  2FVR A;  2R8I A;  5L1K A;  3TZX A;  1SBR A;  3POT A;  1KFD A;  1UZD A;  4DV5 J;  3D0I E;  4EZ6 A;  1RTH B;  3QFH A;  1Q8L A;  4DR1 J;  1RHM B;  2UVU A;  2YNG B;  5A8R A;  4DPX A;  5IFM A;  3ZC4 A;  3W3S A;  5LSL A;  3PRB A;  4K2X A;  5HMZ A;  3OL9 A;  1FCA A;  3QO9 B;  1VS3 A;  3LWM A;  4EBD A;  4C8Z A;  5DG8 A;  1PYT A;  3QWU A;  4LSN A;  3EDR B;  5U47 A;  3ZZY A;  4URG A;  3DOL B;  2I6W A;  3J80 Y;  1VQM S;  3MEG B;  5E3A A;  2MJU A;  3M9M B;  4R0J A;  3R2C J;  1IM6 A;  3LP0 B;  1HNZ F;  1SV5 A;  2RQM A;  3DRS B;  5ETN A;  4C11 B;  1UWB B;  2BBE A;  2C2M B;  1GAO A;  4OYP A;  2PT0 A;  1FXR A;  2BJ8 A;  4RW8 B;  5EWF A;  3F73 A;  2X3D A;  2RB7 A;  3J80 U;  4FYX B;  4J9M A;  3RB4 A;  3CJ5 A;  1RWU A;  3AA9 A;  3W5Y A;  3RBX A;  4EK2 A;  1X5O A;  5KFA A;  3CCU S;  4XIU A; 
#chains in the Genus database with same CATH homology
 4LFA J;  4LF6 J;  1I94 J;  2E5L J;  2VQF J;  4PWW A;  4RJV A;  3T1Y J;  4LF4 J;  4KYZ A;  4DUZ J;  3D3B J;  5IT9 U;  5FLX U;  5IWA J;  1IBL J;  4LFB J;  1XMO J;  1N34 J;  4DV2 J;  2MQ8 A;  4DV4 J;  1HR0 J;  4JI8 J;  4AQY J;  4GKJ J;  5LM7 E;  4LF7 J;  4B3R J;  4X66 J;  4DR6 J;  4YHH J;  5LMN J;  1N32 J;  3R2D J;  4LF8 J;  5AJ3 J;  2MTL A;  4JI4 J;  4DV3 J;  1IBM J;  4JI0 J;  4LF5 J;  4DV1 J;  4LFC J;  5LMU J;  4DR5 J;  4DR4 J;  4K0K J;  1HNX J;  2VQE J;  4YY3 J;  4JI1 J;  3OTO J;  2HHH J;  4DUY J;  2ZM6 J;  4DR3 J;  4B3S J;  4OX9 J;  4NXM J;  4DV6 J;  4KHP J;  4X65 J;  3D3C J;  2KL8 A;  2UUB J;  4NEZ A;  4KY3 A;  3J81 U;  2UXD J;  1N33 J;  3IMQ J;  1XMQ J;  2UXB J;  2KVQ E;  4JI6 J;  4LF9 J;  4JV5 J;  3J7A N;  4HHU A;  4JI5 J;  4DR7 J;  4GKK J;  1FJG J;  4JI2 J;  2UU9 J;  4JYA J;  3JAM U;  4DV5 J;  4B3T J;  3T1H J;  4DR1 J;  4NEY A;  4NXN J;  2UXC J;  1XNQ J;  4DV7 J;  2MEW A;  4DV0 J;  1HNZ J;  2UUA J;  1IBK J;  4X64 J;  3R2C J;  3W1Y C;  4X62 J;  5BR8 J;  2F4V J;  1J5E J;  2UUC J;  4V1A k;  5A2Q U;  4B3M J;  3J80 U;  4DR2 J;  1N36 J;  1XNR J;  4JI3 J;  1HNW J;  4JI7 J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...