1HR0L

Crystal structure of initiation factor if1 bound to the 30s ribosomal subunit
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
124
structure length
124
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Crystal structure of an initiation factor bound to the 30S ribosomal subunit.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ribosome
total genus 16
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2000-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1hr0L00
4DV5Q 3CCLA 4PZ7A 2KHIA 3RLOA 4DV0Q 4LF4L 4LF9L 4A3LG 4R4IA 4TVAB 5C3EG 2ES2A 1D7QA 1QUQA 1TWAH 1Y1VH 2I5HA 1EOVA 5LMNQ 2VL6A 3K7AH 4JG2A 3HOWG 4OWXB 3CPFA 4LUVA 2RHQB 4IPGA 3KDFA 3K8AA 4JI1L 3T1YL 1NE3A 1N36Q 4JI6Q 3H0GG 1Q8KA 1I3QH 4O2DA 3UDFA 4BY7H 3J7A5 4KHPL 4NXMQ 1L0WA 1U0LA 5M5YH 4R4TA 1L1OA 2JE6I 3W1GA 4X62Q 1NJIC 3CAMA 1X9NA 2ZTEA 1HR0Q 2Y0SG 4DV4Q 2Y0SE 4LF7L 3U4VA 1VS0A 5IP7G 3KFUA 1L1OB 4B3TL 1UE7A 3HKSA 1XPRA 1IBML 2XTIA 5GADC 3PUXA 2NVXH 4LF6Q 3I4NH 4C3HH 3J81j 4UY8C 3E0EA 4K0KL 1OXTA 4X6AH 3HKZE 1X3GA 2ZM6L 1K8AC 3HOYG 3NELA 5H1SE 4KI0A 4A3KG 2YV5A 1CKMA 2E2HH 3PO2H 3RZDH 2I5LX 1C9OA 4UP9A 1R9TH 1WFQA 1M1KC 3GTLH 4IPCA 1Q7YC 2WP8J 3GTJH 3F2CA 3U50C 2K14A 3CMAA 3RR5A 2R93G 1YZ6A 4IJHA 1N34L 1IBKL 4A3DH 1XMQL 1CKNB 1UE5A 5IYDG 2D62A 5LMUL 3HFZB 4DV7Q 5E7NA 4JOIA 3Q8DA 4IOAA 4POFA 1GVPA 4DUYQ 2OTJA 3S17H 1VQFA 4LFCL 2UU9Q 3S14H 1IXRA 3F1ZA 5AJ3L 4DV6L 4C2MH 3NENA 2B63G 2N78A 1XPUA 4QGUA 3JAMi 1XMOL 3RLNA 1KL9A 3T1HL 5DLQE 3CP0A 2IX1A 1H95A 3FP9A 2JA6G 1PVOA 2E5LL 3FKIH 4AIMA 2VW9A 4DV5L 2E2IH 3JC66 4DV0L 1S3OA 5C0XJ 1JJGA 2QEXA 1X56A 1PH7A 1JB7A 1YITA 2HIXA 2AMCB 3HOXG 4MNOA 2VUMH 5LMNL 3PF4A 1NTGA 4FDBA 1HJPA 4JI1Q 4JI2Q 3UDGA 1C7YA 2YU9H 2K52A 3CD6A 4X66Q 4JI7Q 4A3BH 2A1AA 1UE1A 1N36L 4JI6L 2EIFA 1E1TA 2BA1A 4L5QA 2LSSA 1BBWA 1X54A 5IT9c 4NXML 4H02A 3ULJA 3CF5A 1E3PA 2JEBI 2K4KA 4QIWE 1EIFA 4A3FH 2MO0A 1CUKA 1HR0L 1VQDA 5HGQA 2YYZA 4DV4L 2H5XA 4A3EG 2ZJQA 2NZHA 5BR8Q 1PH4A 5IYCH 3U58A 1IBMQ 1I5FA 2KBNA 4BBSH 1AE3A 2DUDA 4XIGS 1IZ6A 4LF6L 3B6YA 3I4NG 2ZM6Q 4BXXH 2R92G 4JBMA 3CXCA 1N9WA 5M5WH 2PNHA 1TXYA 3AFQA 2BH8A 4AYBE 5IYBH 3PO2G 4DK6C 1OXXK 1VQIA 3S15H 4A3MH 3CC7A 4PMWA 3I55A 1AE2A 2OTLA 1WCMG 4GOPC 1J5EQ 4A76A 4GLAC 4DR6Q 2Q2TA 4B3RQ 4GKKQ 2B3GA 4A3DG 2UXBQ 1EQQA 3S1RH 5FLMH 1QVFA 2VNUD 1KQSA 3PUZA 4DV7L 4X65Q 3OW2A 1VQ4A 2JJQA 1ASYA 1K83H 1PYSB 4LWCA 3PIPA 2FXQA 1PH3A 5ELNA 4P74A 4R4CA 1O7IA 1UWVA 3J80i 2KHJA 2HHHQ 4A93H 3MEFA 3GTPH 2XGTA 2UU9L 3UE1A 4HJ8A 4GN5A 3T1HQ 2GVBA 5LMNW 2JK8A 2E5LQ 5C4JH 3DLLA 2CFMA 4X64Q 1P8LA 4R4QA 5M3MH 3PF5A 4A3GH 3FKIG 4UPAA 2E2JH 1E1OA 1X65A 2OWOA 4JCVE 5J3BA 5C4XG 4JV5Q 3RN2A 4BA2I 1YHAA 3KJPA 1VQJA 1KRSA 3BJUA 2LXJA 4JI2L 4KHZA 5GAHC 1QUQB 4QL5A 4X66L 4DPGA 4JI7L 3SGIA 4A3IG 4A3BG 1BBUA 4BY1H 2Z6KC 4BA1I 1V43A 3EBEA 3TRZA 2UXDQ 3KDFB 2HQLA 2F3IA 4DUZQ 4DV1L 1OXVA 4ME3A 4B3MQ 2IY5B 1UEBA 4QJFA 1PYBA 2CCZA 2IHFA 3BU2A 5C44G 1PH6A 4OO1G 5BR8L 5IYCG 4HIKA 5JJLA 1U5KA 1HNZQ 4B3SQ 3RZOH 2OQ0A 4BBRH 3HKZG 4JI0L 3PSIA 1IYJB 1Z9FA 3UDXA 4PZ6A 1W2BA 1VQEA 1KHIA 2K5HA 3AEVA 1W3SA 2HIVA 2F52A 3PGZA 4IOCA 5JEAG 1DGSA 3CCEA 1CSPA 4DR4Q 4GKJL 5IYBG 1L1OC 2N8NA 4DV3Q 1VQ9A 1YIJA 1HNXQ 4AH6A 5M3FH 3CCSA 1J5EL 4JBJA 2KENA 5JJIA 4NXNL 1VQCA 4OO1I 4DR6L 3RN5A 4B3RL 4GKKL 3S2DH 3LGJA 2UXBL 4HJ7A 3HOUH 2AWOA 3D31A 2JA5H 2ZTDA 5FLMG 1UE6A 4L5SA 1Q81C 4X65L 3NBHB 4DR2Q 1RL2A 4P71A 4GNXA 2OCEA 3H3VI 4YY3Q 2B29A 1BKBA 1IBLQ 1QVGA 1VQGA 2HHHL 2ZJPA 4A93G 1OXSC 2OQKA 2EXDA 1X55A 3KF6A 4DAYB 4LFBL 2D0OA 1CSQA 1HZ9A 4DAMA 4GNXB 4HJ5A 1IL2A 1EIYB 3HOVH 2JA8H 4X64L 2I5MX 3KF6B 2K75A 3PO3H 3CC4A 1Q1BA 3FHWA 1Y1VG 3GDEA 1E24A 1YHBA 3WWVA 2VZAA 4JV5L 3KLWA 3PCOB 3PUVA 4YWLA 4JOIC 2UUAQ 1NY4A 2VQEQ 3GTQH 4BY7G 3CCVA 4BY1G 1SFOH 2ASBA 1VQLA 1PH2A 4DV1Q 1I6HH 3HOZH 2UXDL 1E22A 4IJLA 3GTGH 4DUZL 3F2DA 4A3LH 5C3EH 3S16H 4B3ML 4MTNA 2IT1A 1SMXA 3G6EA 4P75A 4DV2Q 3J81i 1AH9A 4YCVA 3ER0A 1VQPA 3HOWH 3AQQA 2PQAA 3KYHC 1Q46A 1SROA 2YTXA 3KJOA 4GN3B 1V1QA 4IFDG 2WFWA 3H0GH 3CC2A 3CQZH 4JI0Q 1YJNA 1K3RA 1HNZL 4B3SL 3K81C 2PQAB 1I94Q 2A19A 4BBRG 1JMCA 4NPSA 1EFWA 4DR5L 2PMZE 3VDYA 4R4OA 4AYBG 2KCTA 4GKJQ 3RLFA 1D8LA 1K9MC 2EQSA 4IPHA 4DR4L 1PH1A 5M5XH 2BA0A 3L0OA 1HZCA 4JI8Q 5IP7H 4DV3L 2UXCL 1MIUA 2NZOA 3STBC 1HNXL 2PI2E 4OWTB 1VQKA 3TS0A 4NXNQ 1HNWQ 2MFIA 4POGA 3I4OA 4A3JH 2GN5A 2A8VA 1E7ZA 2R7ZH 4IFDI 3ERSX 1B70B 3HOUG 2JA5G 3HOYH 5IY0A 4LUZA 3JAMc 4WJ4A 4A3KH 4DR2L 3W5OA 1GM5A 4TQUS 1VQOA 1YNXA 2JA7H 3S1QH 4YY3L 1IBLL 1PA6A 4IO9A 4JYAL 1PV4A 4LFBQ 3G4SA 2N49A 2RCNA 2C35B 4Y7NH 5IWAQ 3CCJA 4EQ5A 4LF8Q 2GVAA 1VQBA 5IYDH 3HOVG 2JA9A 1VQ6A 1KIXA 3PV0A 1NMFA 2UUBL 1HZAA 4A75A 1PFSA 1EQRA 4WJ3M 4C3IH 2QA4A 2F4VL 1EYGA 1QZGA 3CPWA 2Q2HA 4HJAA 2VUMG 5FJ8H 4Y52H 1A0IA 1Q12A 3TREA 1HR0W 2V1CC 2Z6KA 3K0XA 1A63A 2QGQA 1S40A 2UUAL 1WOCA 2ZJRA 1TWGH 3EIVA 1FJGQ 3CCQA 1MJEA 3G71A 3NEMA 2VQEL 1VQNA 5IP9H 1YBYA 4A3CH 2JA6H 4JI4Q 1Z47A 3AFPA 4RMFA 3L2PA 3GTOH 3ICEA 3TS2A 3HOZG 2AHOB 1SRUA 3GD7A 4YWKA 4A3FG 2LXKA 1Q82C 1VCIA 1PH8A 1Y14B 1NBWA 1X3EA 3HOXH 4DV2L 1VQHA 3CCMA 3M4OH 2Q2UA 1QVCA 1HZBA 4P73A 5ELOA 3CW2C 3S24A 4YHHL 2BH2A 1WI5A 3TEHB 1V9PA 3EN2A 3S1NH 4BBSG 4JI5L 2JQOA 1Y1WH 4KLKA 1XNRL 1CKOA 4BXXG 4OX9Q 2ID0A 2IX0A 3OYYA 4DR5Q 1N33Q 3IRBA 1I94L 1PHJA 2DGYA 3TQYA 2JEAI 5GAGC 1KXLA 3GO5A 4A4IA 1PH9A 2UUCQ 1B7YB 1VQMA 2MNAA 1KRTA 2ALYB 4A3EH 1PH5A 2UXCQ 4HIMA 5K36G 1G6PA 4A3MG 1JE5A 4JI8L 1Q86C 3AYHB 1J6QA 4LF5Q 1HNWL 1P16A 4UP7A 3ULLA 3U4ZA 4LFAQ 3UDIA 5C0XG 3W1BA 2ZTCA 4OWWB 1GKHA 1I50H 1OTCA 1JT8A 3A5UA 2CWAA 2K5VA 3J80c 4A3JG 4GLVB 4IPDA 4DR1Q 2NVTH 2VY3A 2R92H 1X6OA 2R7ZG 1SE8A 4XTCS 4HIOA 1YJWA 2WAQG 2WAQE 2Z0SA 4QY7A 4LUOA 2VQFL 3CCRA 4JYAQ 2WB1G 2WB1E 1XJVA 4DR7Q 2JA7G 1CKNA 1XPOA 3A74A 2MO1A 1M90C 1TWCH 3E9IA 5HY6A 3ULPA 1WCMH 1KAWA 1BVSA 3OTOQ 3H15A 3A5ZB 5IWAL 2VS1A 3I4MH 3D0FA 5C0XI 1XNQL 1EWIA 1SN8A 4EX5A 4LF8L 2UUBQ 1G51A 1TWFH 5M3MG 4A3GG 5GROA 2RF4A 2N3SA 3BZCA 1LYLA 3KOJA 2F4VQ 1N32Q 1B8AA 1WJJA 4AQYQ 4O0AA 5GAEC 1FVIA 4JI3L 1JJCB 3PUYA 5FJ8G 2R6GA 1VQ7A 4DR3Q 3STBD 2CWPA 4GNXC 5JJKA 5EAYA 4DNIA 1KD1C 1ASZA 1FJGL 4NB3A 5JEAJ 2HT1A 5IP9G 1Q1EA 3M9BA 1QZHA 4A3CG 4JI4L 4UP8A 4LF4Q 2YTYA 4RG1A 4LF9Q 2K5NA 3E9HA 4J15A 5FLXc 3DM3A 2NVYH 4ALPA 4GLXA 3I2ZA 4HIDA 5C4XH 3J81c 1YVCA 3G48A 2ATWA 3M4PA 1FL0A 5GQOA 2AKWB 3PUWA 4YCUA 4YHHQ 1NMGA 4APVA 4DK3C 4JI5Q 3J7ZC 2NN6G 3RNUA 3T1YQ 3UE0A 1XNRQ 3MXNB 4A3IH 2D0PA 4OXPA 4HJ9A 2K50A 1Y1WG 4KHPQ 3KF8B 2YTVA 2E8GA 1G291 4OX9L 1N33L 1HH2P 1K0RA 1TWHH 1WYDA 3M7NA 4OONA 4GOPA 1N8RC 4X62L 1S72A 4LF7Q 2UUCL 4C3JH 3GTKH 3K80C 4L5RC 1A8VA 4MZ9A 1GO3E 4YCWA 1X3FA 4YWMA 4DKAC 2L15A 1SR3A 5C44H 2R7FA 4R1JA 2KCMA 2IHEA 2PI2A 5M3FG 2Q2IA 1L2FA 4B3TQ 3I7FA 2R7DA 3CCUA 4GOPB 4JBKA 4LF5L 1VQ5A 4LFAL 3CMEA 4GS3A 2NN6I 4JBWA 1KC8C 1A62A 4K0KQ 4GN4B 2CKZB 1LTLA 4DR1L 4LW1A 2VQFQ 1EUJA 4PG3A 3H3VH 4QQBX 3M85A 1OXUA 1XTDA 3F8TA 4DR7L 1K73C 1RIPA 1K8GA 1LUZA 4L5TA 1XNQQ 2R93H 3OTOL 3A0JA 3M3YH 1N34Q 2I0QA 1IBKQ 1XMQQ 1MKHA 2MQHA 3ZJYC 3I56A 3I4MG 4P72A 3K7UC 2CQOA 4PZ8A 5LMUQ 2JA8G 1GD7A 1MJCA 1YI2A 2AWNA 1YJ9A 1VQ8A 2RHSB 5IE8A 3PO3G 1YEZA 1FGUA 1N32L 4AQYL 4JI3Q 3PIOA 4IFDJ 4JC0A 4LFCQ 4DUYL 3S2HH 4LNQA 5AJ3Q 1VQAA 4DV6Q 2B63H 3GTMH 3S1MH 4DR3L 3M4QA 1JJ2A 1XMOQ 2NVQH 1YHQA 1C0AA 1SLJA 3BZKA 1T9HA 3L7ZC 3F2BA 1LM0A
chains in the Genus database with same CATH superfamily
1T5XD 4K6LA 4PZ7A 3R93A 2KHIA 3RLOA 2RDFA 2JSOA 4LF9L 1STAA 2I07B 2K04A 5EKLA 2I5HA 5LMNQ 3K7AH 2SEBD 3DUZA 2AUJD 1I6HB 2Q8IB 3J7A5 3J7AV 4NXMQ 4KHPL 3TP8A 4G7ZC 1PRTC 2JE6I 1F2LA 3W1GA 4X62Q 3S9WA 1NJIC 3MTSA 3CAMA 2ZTEA 2Y0SG 1VS0A 5IP7G 4QF4A 2PW7A 2KQ3A 5D14A 3P7JA 5GADC 3PUXA 2NVXH 3I4NH 3J81j 4UY8C 2A68D 2F0IA 4K0KL 4OIJA 4X6AH 1K8AC 4X3KA 3HGBA 3PO2H 4L8JA 1FNUA 4UP9A 1GUGA 3H09A 1W6KA 1Q7YC 1KNEA 3EROA 3RR5A 3CMAA 4H13C 4A3DH 1CKNB 2D62A 3MAQA 2O4XA 3HFZB 3KBXA 2IWHA 4Y7NB 4R8IA 4DUYQ 5M3MB 1STHA 5J1ZA 1IXRA 4C2MH 3SK4A 4QGUA 4FF3A 1MHWC 5DEHA 1H95A 2E5LL 3DWPA 2VW9A 4DV5L 2D9UA 4DAVA 1STNA 4DV0L 1JR0D 2I46A 3VA7A 1PH7A 2XNAC 3PF4A 3NK9A 1EYAA 1HJPA 4JW0A 4X66Q 3NUCA 5CR3A 1UE1A 2BA1A 2CW0D 3FMCA 2DJFC 1X54A 1JWSD 5IT9c 4CDDC 4RGMA 2D5DA 2MO0A 1HR0L 1VQDA 1KAAA 4DV4L 5CGKA 3DEOA 4OO1H 3KLSX 5IYCH 1IBMQ 1I5FA 4BBSH 3UI2A 1BBXC 4XIGS 1RTOA 3I4NG 3NQIA 4JBMA 2PNHA 3AFQA 1U4PA 4C56C 4AYBE 2L11A 3PO2G 2SDFA 1VQIA 3S15H 4A3MH 1AE2A 4IUTA 1IW7D 2XRSD 5C0XH 2L0CA 4DR6Q 4RGOS 3I8ZA 2B3GA 4QCLA 4A3DG 5FLMH 5BN3A 1TWCB 4DV7L 4X65Q 1HTPA 1UWVA 2K1BA 1HXYD 4K14A 1WTXA 1BCPC 4L63B 3PO3B 2B2UC 4GN5A 2GVBA 5C4JH 4QB4A 3DLLA 4A3GH 2E75C 5FK9C 3OSOA 4HCEA 2E2JH 1X65A 3BVMA 1SFOB 3J7AF 1X32A 1K8MA 1D5MC 1PDQA 3DWAA 1ZEQX 3BVGA 4L6TB 5GAHC 5C3EB 1SNPA 3S16B 2RCFA 2CQAA 2NVYB 4BY1H 1X3QA 2CVRA 2F0GA 1RF2D 1V43A 5EKIA 3QB3A 4M1UB 4C1NK 3M4YA 4DV1L 1BXTA 1ENAA 4CDFC 2A6EC 4C3JG 5IGGA 2IY5B 2NBFA 3C2PA 5JPMC 2KHSA 4OO1G 3GV3A 5IYCG 4B3SQ 1HTLD 4J1MA 4JI0L 3HKZG 1RDPD 3PSIA 3UDXA 1KHIA 1W3SA 2B8FA 4IOCA 4A3JB 1DGSA 2R7ZB 1CSPA 4GKJL 2H1EA 4DV3Q 3HOYB 1PTOF 1H9RA 3CCSA 1J5EL 3J7YW 2KENA 4A3KB 5JJIA 4NXNL 1VQCA 4X3UA 4B3RL 3VYUA 4ID6A 3S2DH 4YIJA 2IPKD 2B2WA 2WV6D 5FLMG 1UE6A 4L5SA 2R93B 4DR2Q 1EIGA 1CHPD 2PW5A 2J0TD 4P71A 1EZ6A 1BUVT 1IBLQ 1SSOA 1DXMA 4IUUA 1JE4A 1X55A 1RJTA 3Q23A 4DN4M 4X64L 3MEHA 2I5MX 4DNTB 2WACA 5C4ZA 4B08A 2DN8A 1XYIA 2F03A 5KIXA 5IGEA 3GTOB 3PUVA 5KEEA 1U4MA 4FF4A 1D5ZC 2VQEQ 1Y8PB 3C1EA 4BY1G 1O7YA 3M4OB 1I6HH 2A68C 3TP7A 3F2DA 4A3LH 4B3ML 1YNJD 1SMXA 2EPBA 1I3QB 3J81i 3HOWH 2PQAA 3BDCA 1SROA 3SK5A 3KJOA 4GN3B 5JVH3 4IFDG 1NCVA 2WFWA 3H0GH 5LL6X 1F77A 1EYDA 1ENCA 4KHVA 2PQAB 1JMCA 4NPSA 4DR5L 1JWMD 2PMZE 5CV5A 4FYDA 1ET6A 4DK0A 1D8LA 5I4DA 4DR4L 2BA0A 4ME5A 4JI8Q 1MIUA 1E2VA 2O2LD 3TS0A 2KCCA 2GN5A 2RBMA 3FPUB 1WTWA 5IODA 1SNQA 3W5OA 1ZKOA 4KKTA 1GM5A 1YNXA 3S1QH 4YY3L 1PA6A 2JN4A 4JYAL 2L55A 2RCNA 2SOBA 4Y7NH 4CJ0B 5IWAQ 1AZQA 2CW0C 3PV0A 1IYUA 4ZYSA 2EYMA 4A75A 4NKLA 4WJ3M 2Q8RE 2NWGA 3HZXA 4HJAA 1MD2D 4Y52H 3OMCA 2V1CC 2Z6KA 3EIVA 1FJGQ 1MJEA 3NEMA 1SDFA 1YBYA 2B2VC 4JI4Q 2LFNA 3AFPA 2PCFB 3L2PA 2NTTA 4A3BB 4OGQC 1Y14B 1X3EA 3HOXH 1QVCA 5JPNC 3CW2C 1EY7A 2Y0SB 4YHHL 3BDOA 3EN2A 1S5BD 1XNRL 3VR4A 2N88A 4OX9Q 1STBA 1U9RA 4CDCC 5KYLA 2JEAI 3TQYA 1F9PA 5GAGC 2KEDA 3A54A 5CV4A 2ALYB 4PNYA 4A3EH 1PH5A 2UXCQ 5K36G 1G6PA 3SXHA 1Q86C 2EY6A 4OWWB 4XYOA 3W1BA 5FKAC 1I50H 3A5UA 3CU7A 2F0UA 2NVTH 3OMGA 1X6OA 1YJWA 2Z0SA 2VB2X 1IKLA 1XJVA 5E4XA 4DR7Q 1NUCA 1TWCH 5HY6A 3ULPA 4V190 1WCMH 1SMYD 1BVSA 2B2TC 1R4PB 4K2KA 1SN8A 1SYCA 2UUBQ 2H4OA 4ZLTF 5M3MG 4CKEA 5GROA 1VMPA 2N3SA 1B8AA 4O0AA 2B2WC 5D65A 2NVQB 1FVIA 4JI3L 2R6GA 4DR3Q 3STBD 5JJKA 1KD1C 3SEBA 1A2TA 1B3AA 2HT1A 3NTHA 3K7AB 1DJRD 4XQJA 1QZHA 4UP8A 2YTYA 2DY8A 1D5XC 1H9MA 2NVYH 4DF7A 3V96A 5C4XH 3TZUA 2ATWA 1Y8NB 1FL0A 3K0YA 3OWEB 2A5HA 5GQOA 1IHZA 4DXGA 4KK7A 4JI5Q 1UEAB 2NN6G 5J39A 4A3IH 5EKKA 3KF8B 1N33L 1K0RA 4M8AA 3OOCA 4OONA 1LTTD 4X62L 1N8RC 4F88A 1AZPA 4LF7Q 2NVXB 4L5RC 1K0SA 1A8VA 4YWMA 4BBRB 2F0PA 2KCMA 2IHEA 5C4HA 2EZVA 2R7DA 4LFAL 5E3FA 5KNBA 4KJNA 4HR7B 1KC8C 1O80A 1A62A 2A69D 4KN4C 5HURA 1I4PA 5CV7A 2BDOA 4TKOB 1OXUA 2HDMA 3F8TA 2MPMA 1F9RA 1K73C 3HOUB 1SE3A 1K8GA 4L5TA 2R93H 4WFN3 4P72A 3K7UC 4PZ8A 5LMUQ 4JK1C 1NAPA 2PZTA 4C2MB 1YJ9A 2RHSB 2VB3X 3PO3G 1YEZA 1O78A 3SR1A 4G4KA 3HOVB 1YNJC 4DUYL 1AW7A 4LNQA 3GTMH 4CGYB 1AEXA 1JJ2A 3MXGA 1YHQA 4FXKC 3BZKA 1T9HA 3L7ZC 3CCLA 1H9KA 4IURA 4R4IA 4TVAB 5C3EG 1D7QA 3CRLC 1QUQA 4KD4A 1GHJA 2XRQD 1Q8IA 4JG2A 4RHSA 4OEMB 3CPFA 2RHQB 2NTSA 3GTGB 4X3TA 1N36Q 4JI6Q 4BY7H 1I3QH 4O2DA 3UDFA 1CTMA 2HDLA 2FJ2A 1U0LA 2IW3A 4F7XA 3T4AC 4BBSB 3MZ5A 3KFUA 4B3TL 3HKSA 1XPRA 4N8X1 1IBML 4FO2A 4PMCA 5FLXE 3D4WA 2K01A 2PYKA 4A3MB 4IUPA 1OXTA 4RKLA 3HKZE 3HOYG 1KDCA 4A3KG 2E2HH 1DOLA 4WORA 3FPPA 1WFQA 4IPCA 3GTJH 1SXTA 3F2CA 3H3VC 2R93G 1YZ6A 4G7OC 1IBKL 1XMQL 5IYDG 5ELDA 2GA4B 2ENBA 4JOIA 4POFA 5C4JB 4JPBW 1FYCA 3S17H 1FD7D 4LK1C 4A3GB 1PRTF 2QDBA 4DV6L 3A8IE 2E2JB 1PZKD 1XMOL 1HPCA 1KL9A 4KMUC 3CP0A 3FP9A 1PVOA 2KOLA 2E2IH 3OIQA 1EY8A 2SNSA 1JJGA 2QEXA 1JB7A 2VUMH 2XWJB 4I65A 1NTGA 4FDBA 4JI2Q 4JI1Q 3UDGA 3CD6A 2K52A 4F8MA 4JI7Q 4A3BH 2LY7A 3J81L 2K28A 3QWNA 4NMZA 1SEBD 1E3PA 2JEBI 4QIWE 1Y69U 4A3FH 3I4LA 2H5XA 3DWQA 2NZHA 5BR8Q 1PH4A 5I6WA 1SMYC 1HFGA 1GUNA 2F1MA 3C46A 1EL0A 2DUDA 4LF6L 3B6YA 1H9JA 2F0DA 1V1PB 1MBYA 1HQMC 1ONLA 1SE4A 3S2DB 2BH8A 5D3IB 1CZGA 2J4XA 5IYBH 2EJMA 1TS2A 3CC7A 4PMWA 1BO0A 4IQZA 4ZK9B 1II3A 2UXBQ 1SYBA 2LKVA 4RHRA 3IKJA 1VQ4A 2JJQA 2FXQA 1PH3A 1W6JA 4P74A 4R4CA 3J80E 3GTPH 2UU9L 3UE1A 3T1HQ 1HUMA 2JK8A 1GOZA 2WKCA 3Q6SA 3PF5A 3QO2A 4XYQA 2B8GA 5ELCA 1HA6A 4JCVE 4JV5Q 2KVMA 1VQJA 3F2UA 3MFGA 2RSOA 2LXJA 3TP5A 1PLFA 2RKSA 2V4DA 4DPGA 1S4ZA 5LL6S 3SGIA 4A3BG 5T1GA 4BA1I 3RUZA 3HOWB 3CHBD 2B2YA 2A69C 1U4RA 3H0GB 2BOSA 2QKIC 1A15A 3I72A 2IHFA 1QJOA 3QOLA 1PH6A 1KTKA 2RDGA 5CV6A 5JJLA 1U5KA 1BCPF 4BBRH 3L3OC 1Z9FA 2ICEC 2EE1A 2ICIA 5IT9L 1KDAA 3U9OA 3AEVA 3NXWA 5JEAG 4DGZA 5DAUA 1RTNA 3T51B 3SE0A 1C4QA 2BE5D 5IYBG 3Q0AA 2DJGC 2D2CC 2N8NA 1HNXQ 4AH6A 5M3FH 4JBJA 3X3MA 3SK8A 3RN5A 3S1QB 4GKKL 1ZYRD 3W3AA 1XWEA 3HOUH 2AWOA 4RCOA 3MXPA 2B29A 1BKBA 1VQGA 2BCOA 3NE5B 2HHHL 2EXDA 4UHVA 1ESRA 1LT4D 2D0OA 1CSQA 4DAMA 3H91A 1IL2A 3HOVH 2JA8H 3S2HB 1T5EA 3Q24A 4O42A 1E24A 1YHBA 2K5QA 3AMUA 1QG7A 4YWLA 5IGBA 5CORA 4JOIC 5ELFA 1WD0A 4DXFA 3CCVA 3HOXB 2DNCA 3GQBA 1VDZA 3G6JB 1PH2A 2QEJC 2UXDL 3GTGH 3FEWX 4DUZL 3LX0A 2Z4IA 4MTNA 3MXNA 2EY2A 4MN3A 3R3OA 4YCVA 3AQQA 3QJYA 3KYHC 1Q46A 3H94A 1UAPA 2EYHA 3BG3A 3N52A 4A3EB 1HNZL 1EFWA 1I94Q 2A19A 4BBRG 4I7AA 3VA5A 1FNVA 1I50B 2KCTA 1I6VC 3NHHA 1K9MC 1LTRD 4IPHA 2F0LA 5M5XH 2NVTB 1CZWA 1DCZA 3L0OA 1HA5A 2UXCL 2NZOA 1QCBD 2PI2E 1TY0A 1X3PA 4ODGA 4POGA 3I4OA 4FVMA 3MWYW 1E7ZA 1F2ZA 3ERSX 1JOOA 1WCMB 3T56B 4K2LA 3HOUG 2FHTA 3JAMc 5EPJA 1NR4A 1KLGD 3GP7A 1BQQT 2N49A 3VR2A 5CC4A 1TS5A 2GVAA 1JOQA 3HOVG 2JA9A 1KIXA 2F3VA 2UUBL 3S14B 1HZAA 1EQRA 4C3IH 3KK7A 2QA4A 1EYGA 1TVXA 3TN2A 4KY5A 5EBDA 1A0IA 1HR0W 4KY7A 3K0XA 1A63A 5DNFA 1S40A 2UUAL 1PFNA 2ZJRA 1TWGH 3CCQA 5TSSA 5C4XB 1K3BC 2E76C 3RD4A 2JA6H 1HRJA 1Z47A 3TBIB 2AHOB 4ZUJA 4ZCKA 4YWKA 4A3IB 1A3TA 1VCIA 2SNMA 2F0QA 1VQHA 2WIIB 4DV2L 2A74C 2Q2UA 4P73A 1KDBA 2BH2A 3TEHB 1V9PA 4BBSG 4JI5L 2JQOA 1JWUD 4KLKA 3NSWA 1S5DD 1Q3LA 2ID0A 2IX0A 4KTAA 3BDLA 4A4IA 4MTKA 2MNAA 3SHLA 1M4VA 1JC7A 1Z7TA 1EIHA 4KD3A 4A3MG 2P5ZX 1EWCA 1JE5A 3D4RA 1HNWL 1P16A 2EJFC 4UP7A 3U4ZA 4DU9A 5C0XG 2L5TA 2ZTCA 3J80c 2O5JC 4IALA 3ND9A 4DR1Q 2F0WA 2R92H 1EY5A 4HIOA 2WAQG 4QY7A 4KY6A 4LUOA 4DAPA 5FO9B 2WB1E 2MO1A 3EQLC 3E9IA 5FO7B 1QNKA 1WTOA 1STGA 3A5ZB 2VS1A 2X6GA 4LF8L 3VYTA 3TZDA 4A3GG 1DZ1A 3GTMB 1PXUA 1DD2A 1LYLA 3KOJA 5EBCA 2F4VQ 1N32Q 3BS1A 2OXPA 3LWUA 4AQYQ 2O5IC 3VYRA 1VQ7A 1F2YA 1SJED 1XXGA 3M7GA 1ASZA 1AFPA 4CJ2C 4PV1C 1O7LA 1Q1EA 1AP0A 3M9BA 1EY6A 4RG1A 4LF9Q 1CQVA 3I2ZA 4P2CB 4ABNA 4HIDA 5LHY1 4BY7B 4B9XA 2BE5C 1NR2A 3TSSA 4DK3C 3RNUA 3UE0A 1J8IA 1DONA 2D0PA 4KHPQ 2K50A 1VF5C 1ZYRC 5JVG3 1C48A 1HH2P 1TWHH 2DY7A 1S72A 2UUCL 1YNND 3TP6A 2R7FA 4HMJA 5C44H 2CH4A 4LF5L 2E2HB 1BOSA 4V0BA 1EFID 4JBWA 1KNAA 4PMBA 4K0KQ 3GTJB 3ZYYX 2FINB 4LW1A 1LTID 2L9HA 5G3LD 2VQFQ 4PG3A 5F2DA 1M8AA 2QILA 3HEJA 2JA5B 2F3WA 1XNQQ 1A3VA 3OTOL 3A0JA 3M3YH 3C1FA 2PZUA 2MQHA 3ZJYC 3S17B 4OELB 1F9SA 1GD7A 3IAYA 4CHTB 5IE8A 1PZJD 1QOHA 4H0LC 4IFDJ 4JC0A 3S2HH 3NWSA 2E2IB 1VQAA 4B9WA 3M4QA 4NP5A 2VUMB 1CK1A 1ET9A 4DV5Q 5C3XA 4DV0Q 4LF4L 4A3LG 2M9VA 1Y1VH 1EOVA 4CDEC 2KCNA 2VL6A 2RA4A 3HOWG 4OWXB 1IW7C 3VYSA 4LUVA 3HOZB 3IL8A 3KDFA 3K8AA 4JI1L 3T13A 4A3FB 5BN5A 3T1YL 3H0GG 1Q8KA 1G2SA 3KBGA 2F0MA 4R4TA 2EYJA 1JOKA 1HR0Q 4DV4Q 2Y0SE 4IN3A 4U68A 3CQZB 3U4VA 1Q90A 3K6OA 3K58A 3I73A 1RCVD 3IFTA 1UE7A 3HP3A 1ML0D 3K59A 1LT6D 2EJGC 4C3HH 5L37A 2TSSA 3NELA 5H1SE 2WKDA 3K57A 3RZDH 1C9OA 5CBEE 2WP8J 3U50C 4IJHA 1N34L 3NBHA 4XQNA 2JA7B 1JICA 3GTPB 4DV7Q 2M2LA 1I4HA 4DAYA 3Q8DA 3K5NA 1GVPA 2OTJA 4K5WA 2EYOA 3NP8A 1WD1A 1VQFA 4LFCL 3S14H 5AJ3L 3NENA 2N78A 5G3LF 3JAMi 3T1HL 5DLQE 1FNWA 3R8BA 2IX1A 3AB9A 2JXMB 4FXDA 3JC66 3A7AB 4QUCA 1CT1D 4DFAA 1ILQA 2AMCB 3HOXG 1HCZA 3MXUA 5LMNL 3DEPA 4H44C 2X69A 4O1NA 1I4GA 2K33A 2A1AA 2XIWA 1E1TA 4L5QA 5EQ0A 4NXML 3ULJA 3CF5A 4HMIA 1V8QA 2NYZD 2K4KA 3BVZA 3S1NB 1LLRD 1EY4A 4A3EG 2ZJQA 3VR5A 1EOTA 2AQ1B 1O7ZA 4TRDA 5ELEA 3P20A 4XXEA 1F9QA 3FRPB 1AE3A 2KA7A 3NPPA 5I2YA 4BXXH 2ZM6Q 5M3FB 1LTAD 2VXWA 1N9WA 3VR6A 1RKNA 1TXYA 4DK6C 2RQXA 3I55A 3MHBA 2OTLA 1WCMG 1J5EQ 4K5VA 1SYGA 4GLAC 2LS01 2Q2TA 1PFMA 4B3RQ 1EQQA 3S1RH 3KLRA 4CJ1B 4I7ZC 3OW2A 2AQ3B 1ASYA 1K83H 3URYA 5ELNA 2JA8B 4A93H 3J80i 2KHJA 3MEFA 2XGTA 5FO8B 4HJ8A 2NB0A 5LMNW 1KABA 1STEA 4X64Q 4UPAA 1C8CA 1U4LA 2OWOA 5C4XG 5J3BA 3WOFA 3NBIA 3RN2A 1YHAA 3KJPA 1SYEA 2PZWA 2G5DA 1GUOA 1YNNC 4KHZA 1FR3A 1QUQB 4X66L 4A3IG 1BBUA 2Z6KC 4DA2A 1ICFB 3PIO3 1S5CD 2HQLA 3E3XA 4ME3A 4B3MQ 1QILA 1UEBA 5J22A 2CCZA 1E2ZA 3LWEA 5IGDA 2QCPX 3D6WA 1B2TA 1F2MA 1L0YB 1WTRA 1FGBD 1EU3A 1XX8A 5M5XB 2F0TA 4RFBA 5C5LA 1IYJB 3R2TA 4PZ6A 4HSVA 2K5HA 3RMHA 2F52A 3PGZA 4ZQ3A 3MVVA 3CCEA 4DR4Q 2RDHA 1VQ9A 2WAQB 2F0KA 1YIJA 4WRDA 5IT9E 4OO1I 1SNDA 4DR6L 1CA5A 2EOTA 2F0VA 4K8JA 4HJ7A 4HCSA 2JA5H 4X65L 1RL2A 1CI3M 2OCEA 4YY3Q 2XN9C 1QVGA 4IZ8A 4A93G 2ZJPA 2OQKA 4J8QA 4C3IB 1LTGD 3H6MA 4HJ5A 4J6HA 3E6ZX 1B44D 5I9PA 1ICWA 2K75A 1TWGB 2B63B 3S1MB 3FHWA 2R3ZA 1I4XA 3WWVA 2VZAA 2JA6B 1NSNS 2F0JA 2IJ0A 1BDOA 3EA6A 1J9OA 3GTQH 4BY7G 3P75A 3NTIA 2ASBA 1VQLA 4Q0FA 1SE2A 3HOZH 1E22A 4IJLA 4EVOA 3G6EA 1AH9A 1VQPA 1BNZA 2YTXA 4R9WA 3CQZH 1B9MA 1EEID 1K3RA 2XSCA 3FDTA 1YJNA 4B3SL 5JAVA 5FOBB 3HRZC 1G6ZA 4R4OA 1HFNA 3RLFA 1STYA 2EQSA 4BWGB 2F0NA 2R92B 5IP7H 3MFYA 4DV3L 3STBC 4OWTB 2MFIA 4IFDI 3GTLB 3A55A 2JA5G 4N8FA 5A2QL 5IY0A 1D1KA 4LUZA 4DR2L 1RODA 2B2UA 4TQUS 2J7ZA 1VQOA 2JA7H 1IBLL 4IO9A 4LFBQ 1IYVA 3G4SA 2C35B 2G9DA 1VQBA 4K6DA 3OHXC 4H7BA 4HSPA 1L0XB 1EEFD 1PFSA 5IOCA 2C9OA 2F4VL 2Q2HA 2EYFA 3FVQA 2VUMG 5FJ8H 3KUPA 3QIAA 1G8ZD 1Q12A 3FKIB 3TREA 3AU7A 2QGQA 1A3UA 4K8IA 1WOCA 4RCNA 2VQEL 3PMFA 2KUMA 3NWTA 2Z9HA 3PIP3 4RMFA 3ICEA 3TS2A 3HOZG 1DYQA 2YU9B 1R4QB 4A3FG 2LXKA 4U673 1Q82C 1NBWA 3TDQA 1HZBA 3D6CA 1TWHB 3S1NH 2E74C 2MUYA 5C44B 3OYYA 2KJXA 1N33Q 3IRBA 2DGYA 3E5SA 1KXLA 1VQMA 4FF2A 1EZ8A 2EVBA 1EQTA 5FLXL 4HIMA 4JI8L 4FP5D 3ULLA 4HN7A 4LFAQ 5DM63 5M5WB 1GKHA 1OTCA 2K5VA 1CFMA 4IPDA 1GXDC 4XTCS 1OO9B 3M3YB 1SJHD 4ILWA 2VQFL 4KV6A 2JA7G 1CKNA 2AUKA 1XPOA 3H15A 1EU4A 5IWAL 3D0FA 1XNQL 1EWIA 1B50A 4UAIA 1TWFH 5I6YA 2RF4A 2IX3A 2NUCA 2X6LA 3BZCA 2DNEA 3EFXD 3JAML 3D3RA 5CMDA 1JJCB 3PUYA 1Y8OB 5FJ8G 2R61A 2L1BA 1FJGL 1Y1VB 2EDGA 5JEAJ 2A6HD 3SK6A 4JI4L 2OF1A 2K7VA 2K5NA 3E9HA 1UNSA 4J15A 3DM3A 5FLXc 5C3WA 3M4PA 1WVLA 2AQ2B 3PQIA 3KLSA 4ZRZA 4APVA 3MA2B 2K5WA 4DK1A 3MXNB 3ITPA 4HJ9A 1EY0A 2EYLA 2K05A 3V05A 4OX9L 1PTOD 4GOPA 4C3JH 1I4RA 4C3HB 1MGSA 1VF7A 1GO3E 4MZ9A 4YCWA 3RZOB 4B3TQ 2PI2A 5M3FG 4JBKA 4PQXA 4GOPB 4AYBB 3RZDB 1VQ5A 3CMEA 4GS3A 2NN6I 3NTKA 1TS4A 4GN4B 1G2TA 2EY1A 4QQBX 3D4DA 1K8OA 3U9SA 4DR7L 2EYPA 2XVSA 2Z1CA 1IBKQ 1XMQQ 1MKHA 3I56A 2JA8G 1HQRD 3J80L 3VR3A 1FGUA 1DOMA 1PTOB 1B1ZA 3PIOA 3O13A 1IKMA 3X3NA 1WTVA 4DV6Q 4ZKBB 4FNFA 2B63H 2B2VA 3OPOA 4DR3L 3S1MH 5M9OA 1HUNA 1XMOQ 5I2XA 1HHVA 2F0EA 1MI2A 3I90A 5A35A 2ES2A 3K5OA 1TWAH 4QUFA 5CV8A 5BN4A 5KGUA 4IPGA 1QB5D 2BDNA 1NE3A 1L0WA 4R8NA 5M5YH 1L1OA 1AN8A 1PMRA 4OIKA 1X9NA 4LF7L 4Q5VA 2B2YC 3I70A 3DXJC 4FXGC 1L1OB 1LT3D 1RHPA 2XTIA 4IFDH 4LF6Q 1GHKA 1S5FD 3E0EA 1ESFA 2M00A 3GV6A 1D1IA 1X3GA 2ZM6L 4KI0A 2YV5A 1CKMA 2L12A 2RSNA 5EJWA 3K5MA 2I5LX 3S1RB 1R9TH 1M1KC 2B2TA 3GTLH 4IUVA 2HUGA 1K83B 2K14A 1BR9A 3N6RA 2IL8A 3SVMA 4A93B 2WB1B 1UE5A 2LMCB 1V1OA 1QNUA 5LMUL 1CA6A 2JP1A 5JOBA 3P1HA 5E7NA 2Q8TA 4C3IG 3BYTB 4IOAA 4LMQD 4NDXA 2F0FA 1B4OA 2Z8LA 3A56A 3TMEA 1PZID 2UU9Q 4ZUIA 1EQVA 3F1ZA 2B63G 1TU2B 4F87A 1XPUA 3RLNA 1WTHA 4HEDA 2JA6G 3FKIH 1SAPA 2MGSA 4AIMA 1A2UA 5C6AA 2OEOA 1S3OA 3D8GA 5C0XJ 5KYIA 1X56A 1YITA 2HIXA 5EGTA 4MNOA 4EQPA 1C7YA 2YU9H 4BS9A 4KN7C 1N36L 4JI6L 2EIFA 3QG1A 2PNRC 3I91A 3HG9A 2LSSA 1BBWA 4E6IA 2K32A 1MSGA 4H02A 1I4QA 1SNCA 1EIFA 5EPLA 1CUKA 5HGQA 2YYZA 1Y1WB 1CM9A 4RGTA 4TSSA 2PMZB 3U58A 2XWBB 2KBNA 5ELBA 3BZDB 1IZ6A 5CYUA 2R92G 3I3CA 3CXCA 1H9SA 5M5WH 4XT1B 5D3DA 1OXXK 5K36H 4EGVA 4GOPC 1H9SB 3A8KE 4KKSA 4RA8A 4A76A 4EQNA 3HS0C 1LV9A 4GKKQ 1B3QA 2A6HC 1D6EC 1QVFA 2VNUD 1KQSA 3PUZA 4HTHA 2B39A 1PYSB 1TS3A 4LWCA 3PIPA 3I4MB 2FMCA 1O7IA 2HHHQ 1JORA 5KRUA 3DM1A 5ISRA 1LO5D 2KEEA 1JQYD 2E5LQ 2CFMA 1EYCA 1P8LA 4R4QA 5M3MH 4HAEA 3FKIG 5NUCA 3T16A 1PTOC 3GTQB 1E1OA 1WTQA 1IL8A 4BA2I 1DOKA 1KRSA 3BJUA 4JI2L 3WOEA 1D2BA 3CKIB 4JI7L 4QL5A 4JVZA 4K5XA 4C1NI 3NQTA 1WTPA 2FMMA 3EBEA 5IIFA 1K28A 3TRZA 1TQOA 2UXDQ 3KDFB 3DMUA 2F3IA 3CRKC 4DUZQ 1OXVA 2Z4HA 1LACA 3W2DA 1ILPA 4QJFA 1PYWD 1B53A 1PYBA 2MJ8A 3BU2A 3ND8A 5C44G 1VMCA 1G91A 5I9OA 5BR8L 2NN6H 4HIKA 4XDXA 1HNZQ 3RZOH 3GTKB 2OQ0A 3G7LA 3OWFA 1W2BA 1VQEA 2E2DC 2HIVA 2K5DA 3Q22A 4IUNA 2F0HA 1L1OC 2MHVA 3LGJA 2UXBL 2ZXOA 3D31A 2PQEA 2ZTDA 5T1IA 1Q81C 3EJIA 3NBHB 4GNXA 3H3VI 2ZXPA 2FFKB 1OXSC 3KF6A 1CQFA 4DAYB 4LFBL 2HCIA 1PTOH 3QR8A 1HZ9A 4GNXB 1EIYB 3BYYB 2F0OA 2K03A 1LT5D 3KF6B 3PO3H 2ZXRA 1Q1BA 4KKUA 2JYOA 3CC4A 1Y1VG 3GDEA 3R2IA 4JV5L 3KLWA 3PCOB 4RGNA 2UUAQ 1NY4A 5HGTA 1SFOH 1RD9D 4DV1Q 1TT2A 4XQQA 5C3EH 3S16H 2IT1A 4RAUC 4P75A 4DV2Q 3ER0A 4N9TA 3J81E 3KF8A 1V1QA 1SBBB 5E4WC 3WDNA 4JI0Q 3CC2A 1GJXA 4C3HG 1JCKB 3K81C 3EVQA 2PO4A 3A7LA 2CHBD 4WJWA 3VDYA 4AYBG 4GKJQ 2Z6BA 1A6XA 1PH1A 5KNDA 4OHJA 3I4NB 1HZCA 4NXNQ 1VQKA 1HNWQ 1HNXL 2NZ1D 3PO2B 1GUTA 4A3JH 2A8VA 4KJOA 1LTBD 2R7ZH 5KNCA 1PRTD 2MP1A 3ONAB 1B70B 3HOYH 1EY9A 4WJ4A 4A3KH 1PFBA 4A3DB 1SNMA 1TWFB 4RKBA 3ERQA 1ZXTA 1PV4A 4LAAA 5A2QE 3C3LA 3CCJA 4EQ5A 4LF8Q 3LNNA 5IYDH 5AFWA 1VQ6A 1NMFA 2OT2A 2G9HD 1QZGA 3CPWA 1KLUD 3QOJA 1TY2A 4QMGA 1UUPA 1GUWA 3G71A 1VQNA 1ENFA 5IP9H 4A3CH 4MHEA 3GTOH 4GZYC 1PRTB 5CBAE 1SRUA 3GD7A 4EQOA 5E1FA 1PH8A 2RVLA 1NNXA 2CH4W 3IFDA 3CCMA 1BF4A 3M4OH 1DM0B 5ELOA 2HCCA 3S24A 1WI5A 5DM73 4LJZC 4C3JB 1E0BA 1Y1WH 1CKOA 2EXZA 4BXXG 3L9AX 4DR5Q 1I94L 1PHJA 4CKBA 3A8JE 3GO5A 2KECA 4OL7A 1PH9A 1B7YB 2UUCQ 4FF1A 2ZT9C 4N9PA 1KRTA 3HKZB 5K5PA 3AYHB 1J6QA 1JB3A 4LF5Q 3UDIA 1TKWB 2HQEA 1JT8A 2CWAA 4A3JG 4GLVB 4IUQA 2R7ZG 1SYFA 2VY3A 3S15B 1SE8A 3K5LA 1SYDA 2WAQE 4ZKCB 4RH6A 3CCRA 4JYAQ 2WB1G 3A74A 1M90C 1KAWA 3OTOQ 1TIID 3I4MH 5C0XI 4DNRB 4EX5A 4ULLA 1G51A 1MSHA 2N55A 4XT3B 5JJZA 1WJJA 3SDZA 5GAEC 1E2WA 2CWPA 4GNXC 1GUSA 5EAYA 1TWAB 4MIUA 4DNIA 4NB3A 5IP9G 3JAME 4A3CG 5EPKA 2QF7A 4LF4Q 2F4IA 3MC0B 4ALPA 4GLXA 2PPBC 4BY1B 1YVCA 3G48A 1BCPD 5M5YB 2AKWB 3PUWA 4NW2A 4YCUA 1CHQD 1NMGA 4YHHQ 4QIWB 2F0SA 3J7ZC 3T1YQ 4G7HC 1XNRQ 2L4NA 1S5ED 4OXPA 1Y1WG 3OIPA 1Z6HA 2YTVA 1LABA 2E8GA 2K6AA 1G291 3OW7A 4S3SA 1WYDA 3M7NA 3V2TA 2A73B 3GTKH 3K80C 3T53B 1X3FA 4DKAC 2L15A 1XTCD 1SR3A 4CBVA 2HD3A 4R1JA 2Q2IA 1L2FA 3I7FA 3CCUA 1V1PA 5IGCA 2TMPA 4ZAIA 2EY5A 1R9TB 2QDLA 2CKZB 1LTLA 4DR1L 5CV9A 2A6ED 1EUJA 3H3VH 1LTSD 2C5CA 5JEAH 3E0JA 3M85A 1XTDA 2WINB 1RIPA 1BCPB 1SNOA 1LUZA 1N34Q 4CKCA 2I0QA 1EWHA 4UDUC 4X3SA 3I4MG 4G57A 2CQOA 1QWYA 3DHQA 1MJCA 1YI2A 2AWNA 1VQ8A 1N32L 2QW7A 4AQYL 4JI3Q 1TR5A 4LFCQ 5C5MA 5IGFA 5AJ3Q 5COYA 1QE6A 4RWSC 1C0AA 1SLJA 3J81c 4Z9CB 1B9NA 2NVQH 3F2BA 1LM0A
chains in the Genus database with same CATH topology
4DV5Q 3CCLA 4PZ7A 2KHIA 3RLOA 4DV0Q 4LF4L 4LF9L 4A3LG 4R4IA 4TVAB 5C3EG 2ES2A 1D7QA 1QUQA 1TWAH 1Y1VH 2I5HA 1EOVA 5LMNQ 2VL6A 3K7AH 4JG2A 3HOWG 4OWXB 3CPFA 4LUVA 2RHQB 4IPGA 3KDFA 3K8AA 4JI1L 3T1YL 1NE3A 1N36Q 4JI6Q 3H0GG 1Q8KA 1I3QH 4O2DA 3UDFA 4BY7H 3J7A5 4KHPL 4NXMQ 1L0WA 1U0LA 5M5YH 4R4TA 1L1OA 2JE6I 3W1GA 4X62Q 1NJIC 3CAMA 1X9NA 2ZTEA 1HR0Q 2Y0SG 4DV4Q 2Y0SE 4LF7L 3U4VA 1VS0A 5IP7G 3KFUA 1L1OB 4B3TL 1UE7A 3HKSA 1XPRA 1IBML 2XTIA 5GADC 3PUXA 2NVXH 4LF6Q 3I4NH 4C3HH 3J81j 4UY8C 3E0EA 4K0KL 1OXTA 4X6AH 3HKZE 1X3GA 2ZM6L 1K8AC 3HOYG 3NELA 5H1SE 4KI0A 4A3KG 2YV5A 1CKMA 2E2HH 3PO2H 3RZDH 2I5LX 1C9OA 4UP9A 1R9TH 1WFQA 1M1KC 3GTLH 4IPCA 1Q7YC 2WP8J 3GTJH 3F2CA 3U50C 2K14A 3CMAA 3RR5A 2R93G 1YZ6A 4IJHA 1N34L 1IBKL 4A3DH 1XMQL 1CKNB 1UE5A 5IYDG 2D62A 5LMUL 3HFZB 4DV7Q 5E7NA 4JOIA 3Q8DA 4IOAA 4POFA 1GVPA 4DUYQ 2OTJA 3S17H 1VQFA 4LFCL 2UU9Q 3S14H 1IXRA 3F1ZA 5AJ3L 4DV6L 4C2MH 3NENA 2B63G 2N78A 1XPUA 4QGUA 3JAMi 1XMOL 3RLNA 1KL9A 3T1HL 5DLQE 3CP0A 2IX1A 1H95A 3FP9A 2JA6G 1PVOA 2E5LL 3FKIH 4AIMA 2VW9A 4DV5L 2E2IH 3JC66 4DV0L 1S3OA 5C0XJ 1JJGA 2QEXA 1X56A 1PH7A 1JB7A 1YITA 2HIXA 2AMCB 3HOXG 4MNOA 2VUMH 5LMNL 3PF4A 1NTGA 4FDBA 1HJPA 4JI1Q 4JI2Q 3UDGA 1C7YA 2YU9H 2K52A 3CD6A 4X66Q 4JI7Q 4A3BH 2A1AA 1UE1A 1N36L 4JI6L 2EIFA 1E1TA 2BA1A 4L5QA 2LSSA 1BBWA 1X54A 5IT9c 4NXML 4H02A 3ULJA 3CF5A 1E3PA 2JEBI 2K4KA 4QIWE 1EIFA 4A3FH 2MO0A 1CUKA 1HR0L 1VQDA 5HGQA 2YYZA 4DV4L 2H5XA 4A3EG 2ZJQA 2NZHA 5BR8Q 1PH4A 5IYCH 3U58A 1IBMQ 1I5FA 2KBNA 4BBSH 1AE3A 2DUDA 4XIGS 1IZ6A 4LF6L 3B6YA 3I4NG 2ZM6Q 4BXXH 2R92G 4JBMA 3CXCA 1N9WA 5M5WH 2PNHA 1TXYA 3AFQA 2BH8A 4AYBE 5IYBH 3PO2G 4DK6C 1OXXK 1VQIA 3S15H 4A3MH 3CC7A 4PMWA 3I55A 1AE2A 2OTLA 1WCMG 4GOPC 1J5EQ 4A76A 4GLAC 4DR6Q 2Q2TA 4B3RQ 4GKKQ 2B3GA 4A3DG 2UXBQ 1EQQA 3S1RH 5FLMH 1QVFA 2VNUD 1KQSA 3PUZA 4DV7L 4X65Q 3OW2A 1VQ4A 2JJQA 1ASYA 1K83H 1PYSB 4LWCA 3PIPA 2FXQA 1PH3A 5ELNA 4P74A 4R4CA 1O7IA 1UWVA 3J80i 2KHJA 2HHHQ 4A93H 3MEFA 3GTPH 2XGTA 2UU9L 3UE1A 4HJ8A 4GN5A 3T1HQ 2GVBA 5LMNW 2JK8A 2E5LQ 5C4JH 3DLLA 2CFMA 4X64Q 1P8LA 4R4QA 5M3MH 3PF5A 4A3GH 3FKIG 4UPAA 2E2JH 1E1OA 1X65A 2OWOA 4JCVE 5J3BA 5C4XG 4JV5Q 3RN2A 4BA2I 1YHAA 3KJPA 1VQJA 1KRSA 3BJUA 2LXJA 4JI2L 4KHZA 5GAHC 1QUQB 4QL5A 4X66L 4DPGA 4JI7L 3SGIA 4A3IG 4A3BG 1BBUA 4BY1H 2Z6KC 4BA1I 1V43A 3EBEA 3TRZA 2UXDQ 3KDFB 2HQLA 2F3IA 4DUZQ 4DV1L 1OXVA 4ME3A 4B3MQ 2IY5B 1UEBA 4QJFA 1PYBA 2CCZA 2IHFA 3BU2A 5C44G 1PH6A 4OO1G 5BR8L 5IYCG 4HIKA 5JJLA 1U5KA 1HNZQ 4B3SQ 3RZOH 2OQ0A 4BBRH 3HKZG 4JI0L 3PSIA 1IYJB 1Z9FA 3UDXA 4PZ6A 1W2BA 1VQEA 1KHIA 2K5HA 3AEVA 1W3SA 2HIVA 2F52A 3PGZA 4IOCA 5JEAG 1DGSA 3CCEA 1CSPA 4DR4Q 4GKJL 5IYBG 1L1OC 2N8NA 4DV3Q 1VQ9A 1YIJA 1HNXQ 4AH6A 5M3FH 3CCSA 1J5EL 4JBJA 2KENA 5JJIA 4NXNL 1VQCA 4OO1I 4DR6L 3RN5A 4B3RL 4GKKL 3S2DH 3LGJA 2UXBL 4HJ7A 3HOUH 2AWOA 3D31A 2JA5H 2ZTDA 5FLMG 1UE6A 4L5SA 1Q81C 4X65L 3NBHB 4DR2Q 1RL2A 4P71A 4GNXA 2OCEA 3H3VI 4YY3Q 2B29A 1BKBA 1IBLQ 1QVGA 1VQGA 2HHHL 2ZJPA 4A93G 1OXSC 2OQKA 2EXDA 1X55A 3KF6A 4DAYB 4LFBL 2D0OA 1CSQA 1HZ9A 4DAMA 4GNXB 4HJ5A 1IL2A 1EIYB 3HOVH 2JA8H 4X64L 2I5MX 3KF6B 2K75A 3PO3H 3CC4A 1Q1BA 3FHWA 1Y1VG 3GDEA 1E24A 1YHBA 3WWVA 2VZAA 4JV5L 3KLWA 3PCOB 3PUVA 4YWLA 4JOIC 2UUAQ 1NY4A 2VQEQ 3GTQH 4BY7G 3CCVA 4BY1G 1SFOH 2ASBA 1VQLA 1PH2A 4DV1Q 1I6HH 3HOZH 2UXDL 1E22A 4IJLA 3GTGH 4DUZL 3F2DA 4A3LH 5C3EH 3S16H 4B3ML 4MTNA 2IT1A 1SMXA 3G6EA 4P75A 4DV2Q 3J81i 1AH9A 4YCVA 3ER0A 1VQPA 3HOWH 3AQQA 2PQAA 3KYHC 1Q46A 1SROA 2YTXA 3KJOA 4GN3B 1V1QA 4IFDG 2WFWA 3H0GH 3CC2A 3CQZH 4JI0Q 1YJNA 1K3RA 1HNZL 4B3SL 3K81C 2PQAB 1I94Q 2A19A 4BBRG 1JMCA 4NPSA 1EFWA 4DR5L 2PMZE 3VDYA 4R4OA 4AYBG 2KCTA 4GKJQ 3RLFA 1D8LA 1K9MC 2EQSA 4IPHA 4DR4L 1PH1A 5M5XH 2BA0A 3L0OA 1HZCA 4JI8Q 5IP7H 4DV3L 2UXCL 1MIUA 2NZOA 3STBC 1HNXL 2PI2E 4OWTB 1VQKA 3TS0A 4NXNQ 1HNWQ 2MFIA 4POGA 3I4OA 4A3JH 2GN5A 2A8VA 1E7ZA 2R7ZH 4IFDI 3ERSX 1B70B 3HOUG 2JA5G 3HOYH 5IY0A 4LUZA 3JAMc 4WJ4A 4A3KH 4DR2L 3W5OA 1GM5A 4TQUS 1VQOA 1YNXA 2JA7H 3S1QH 4YY3L 1IBLL 1PA6A 4IO9A 4JYAL 1PV4A 4LFBQ 3G4SA 2N49A 2RCNA 2C35B 4Y7NH 5IWAQ 3CCJA 4EQ5A 4LF8Q 2GVAA 1VQBA 5IYDH 3HOVG 2JA9A 1VQ6A 1KIXA 3PV0A 1NMFA 2UUBL 1HZAA 4A75A 1PFSA 1EQRA 4WJ3M 4C3IH 2QA4A 2F4VL 1EYGA 1QZGA 3CPWA 2Q2HA 4HJAA 2VUMG 5FJ8H 4Y52H 1A0IA 1Q12A 3TREA 1HR0W 2V1CC 2Z6KA 3K0XA 1A63A 2QGQA 1S40A 2UUAL 1WOCA 2ZJRA 1TWGH 3EIVA 1FJGQ 3CCQA 1MJEA 3G71A 3NEMA 2VQEL 1VQNA 5IP9H 1YBYA 4A3CH 2JA6H 4JI4Q 1Z47A 3AFPA 4RMFA 3L2PA 3GTOH 3ICEA 3TS2A 3HOZG 2AHOB 1SRUA 3GD7A 4YWKA 4A3FG 2LXKA 1Q82C 1VCIA 1PH8A 1Y14B 1NBWA 1X3EA 3HOXH 4DV2L 1VQHA 3CCMA 3M4OH 2Q2UA 1QVCA 1HZBA 4P73A 5ELOA 3CW2C 3S24A 4YHHL 2BH2A 1WI5A 3TEHB 1V9PA 3EN2A 3S1NH 4BBSG 4JI5L 2JQOA 1Y1WH 4KLKA 1XNRL 1CKOA 4BXXG 4OX9Q 2ID0A 2IX0A 3OYYA 4DR5Q 1N33Q 3IRBA 1I94L 1PHJA 2DGYA 3TQYA 2JEAI 5GAGC 1KXLA 3GO5A 4A4IA 1PH9A 2UUCQ 1B7YB 1VQMA 2MNAA 1KRTA 2ALYB 4A3EH 1PH5A 2UXCQ 4HIMA 5K36G 1G6PA 4A3MG 1JE5A 4JI8L 1Q86C 3AYHB 1J6QA 4LF5Q 1HNWL 1P16A 4UP7A 3ULLA 3U4ZA 4LFAQ 3UDIA 5C0XG 3W1BA 2ZTCA 4OWWB 1GKHA 1I50H 1OTCA 1JT8A 3A5UA 2CWAA 2K5VA 3J80c 4A3JG 4GLVB 4IPDA 4DR1Q 2NVTH 2VY3A 2R92H 1X6OA 2R7ZG 1SE8A 4XTCS 4HIOA 1YJWA 2WAQG 2WAQE 2Z0SA 4QY7A 4LUOA 2VQFL 3CCRA 4JYAQ 2WB1G 2WB1E 1XJVA 4DR7Q 2JA7G 1CKNA 1XPOA 3A74A 2MO1A 1M90C 1TWCH 3E9IA 5HY6A 3ULPA 1WCMH 1KAWA 1BVSA 3OTOQ 3H15A 3A5ZB 5IWAL 2VS1A 3I4MH 3D0FA 5C0XI 1XNQL 1EWIA 1SN8A 4EX5A 4LF8L 2UUBQ 1G51A 1TWFH 5M3MG 4A3GG 5GROA 2RF4A 2N3SA 3BZCA 1LYLA 3KOJA 2F4VQ 1N32Q 1B8AA 1WJJA 4AQYQ 4O0AA 5GAEC 1FVIA 4JI3L 1JJCB 3PUYA 5FJ8G 2R6GA 1VQ7A 4DR3Q 3STBD 2CWPA 4GNXC 5JJKA 5EAYA 4DNIA 1KD1C 1ASZA 1FJGL 4NB3A 5JEAJ 2HT1A 5IP9G 1Q1EA 3M9BA 1QZHA 4A3CG 4JI4L 4UP8A 4LF4Q 2YTYA 4RG1A 4LF9Q 2K5NA 3E9HA 4J15A 5FLXc 3DM3A 2NVYH 4ALPA 4GLXA 3I2ZA 4HIDA 5C4XH 3J81c 1YVCA 3G48A 2ATWA 3M4PA 1FL0A 5GQOA 2AKWB 3PUWA 4YCUA 4YHHQ 1NMGA 4APVA 4DK3C 4JI5Q 3J7ZC 2NN6G 3RNUA 3T1YQ 3UE0A 1XNRQ 3MXNB 4A3IH 2D0PA 4OXPA 4HJ9A 2K50A 1Y1WG 4KHPQ 3KF8B 2YTVA 2E8GA 1G291 4OX9L 1N33L 1HH2P 1K0RA 1TWHH 1WYDA 3M7NA 4OONA 4GOPA 1N8RC 4X62L 1S72A 4LF7Q 2UUCL 4C3JH 3GTKH 3K80C 4L5RC 1A8VA 4MZ9A 1GO3E 4YCWA 1X3FA 4YWMA 4DKAC 2L15A 1SR3A 5C44H 2R7FA 4R1JA 2KCMA 2IHEA 2PI2A 5M3FG 2Q2IA 1L2FA 4B3TQ 3I7FA 2R7DA 3CCUA 4GOPB 4JBKA 4LF5L 1VQ5A 4LFAL 3CMEA 4GS3A 2NN6I 4JBWA 1KC8C 1A62A 4K0KQ 4GN4B 2CKZB 1LTLA 4DR1L 4LW1A 2VQFQ 1EUJA 4PG3A 3H3VH 4QQBX 3M85A 1OXUA 1XTDA 3F8TA 4DR7L 1K73C 1RIPA 1K8GA 1LUZA 4L5TA 1XNQQ 2R93H 3OTOL 3A0JA 3M3YH 1N34Q 2I0QA 1IBKQ 1XMQQ 1MKHA 2MQHA 3ZJYC 3I56A 3I4MG 4P72A 3K7UC 2CQOA 4PZ8A 5LMUQ 2JA8G 1GD7A 1MJCA 1YI2A 2AWNA 1YJ9A 1VQ8A 2RHSB 5IE8A 3PO3G 1YEZA 1FGUA 1N32L 4AQYL 4JI3Q 3PIOA 4IFDJ 4JC0A 4LFCQ 4DUYL 3S2HH 4LNQA 5AJ3Q 1VQAA 4DV6Q 2B63H 3GTMH 3S1MH 4DR3L 3M4QA 1JJ2A 1XMOQ 2NVQH 1YHQA 1C0AA 1SLJA 3BZKA 1T9HA 3L7ZC 3F2BA 1LM0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV5 Q;  3CCL A;  4PZ7 A;  2KHI A;  3RLO A;  4DV0 Q;  4LF4 L;  4LF9 L;  4A3L G;  4R4I A;  4TVA B;  5C3E G;  2ES2 A;  1D7Q A;  1QUQ A;  1TWA H;  1Y1V H;  2I5H A;  1EOV A;  5LMN Q;  2VL6 A;  3K7A H;  4JG2 A;  3HOW G;  4OWX B;  3CPF A;  4LUV A;  2RHQ B;  4IPG A;  3KDF A;  3K8A A;  4JI1 L;  3T1Y L;  1NE3 A;  1N36 Q;  4JI6 Q;  3H0G G;  1Q8K A;  1I3Q H;  4O2D A;  3UDF A;  4BY7 H;  3J7A 5;  4KHP L;  4NXM Q;  1L0W A;  1U0L A;  5M5Y H;  4R4T A;  1L1O A;  2JE6 I;  3W1G A;  4X62 Q;  1NJI C;  3CAM A;  1X9N A;  2ZTE A;  1HR0 Q;  2Y0S G;  4DV4 Q;  2Y0S E;  4LF7 L;  3U4V A;  1VS0 A;  5IP7 G;  3KFU A;  1L1O B;  4B3T L;  1UE7 A;  3HKS A;  1XPR A;  1IBM L;  2XTI A;  5GAD C;  3PUX A;  2NVX H;  4LF6 Q;  3I4N H;  4C3H H;  3J81 j;  4UY8 C;  3E0E A;  4K0K L;  1OXT A;  4X6A H;  3HKZ E;  1X3G A;  2ZM6 L;  1K8A C;  3HOY G;  3NEL A;  5H1S E;  4KI0 A;  4A3K G;  2YV5 A;  1CKM A;  2E2H H;  3PO2 H;  3RZD H;  2I5L X;  1C9O A;  4UP9 A;  1R9T H;  1WFQ A;  1M1K C;  3GTL H;  4IPC A;  1Q7Y C;  2WP8 J;  3GTJ H;  3F2C A;  3U50 C;  2K14 A;  3CMA A;  3RR5 A;  2R93 G;  1YZ6 A;  4IJH A;  1N34 L;  1IBK L;  4A3D H;  1XMQ L;  1CKN B;  1UE5 A;  5IYD G;  2D62 A;  5LMU L;  3HFZ B;  4DV7 Q;  5E7N A;  4JOI A;  3Q8D A;  4IOA A;  4POF A;  1GVP A;  4DUY Q;  2OTJ A;  3S17 H;  1VQF A;  4LFC L;  2UU9 Q;  3S14 H;  1IXR A;  3F1Z A;  5AJ3 L;  4DV6 L;  4C2M H;  3NEN A;  2B63 G;  2N78 A;  1XPU A;  4QGU A;  3JAM i;  1XMO L;  3RLN A;  1KL9 A;  3T1H L;  5DLQ E;  3CP0 A;  2IX1 A;  1H95 A;  3FP9 A;  2JA6 G;  1PVO A;  2E5L L;  3FKI H;  4AIM A;  2VW9 A;  4DV5 L;  2E2I H;  3JC6 6;  4DV0 L;  1S3O A;  5C0X J;  1JJG A;  2QEX A;  1X56 A;  1PH7 A;  1JB7 A;  1YIT A;  2HIX A;  2AMC B;  3HOX G;  4MNO A;  2VUM H;  5LMN L;  3PF4 A;  1NTG A;  4FDB A;  1HJP A;  4JI1 Q;  4JI2 Q;  3UDG A;  1C7Y A;  2YU9 H;  2K52 A;  3CD6 A;  4X66 Q;  4JI7 Q;  4A3B H;  2A1A A;  1UE1 A;  1N36 L;  4JI6 L;  2EIF A;  1E1T A;  2BA1 A;  4L5Q A;  2LSS A;  1BBW A;  1X54 A;  5IT9 c;  4NXM L;  4H02 A;  3ULJ A;  3CF5 A;  1E3P A;  2JEB I;  2K4K A;  4QIW E;  1EIF A;  4A3F H;  2MO0 A;  1CUK A;  1HR0 L;  1VQD A;  5HGQ A;  2YYZ A;  4DV4 L;  2H5X A;  4A3E G;  2ZJQ A;  2NZH A;  5BR8 Q;  1PH4 A;  5IYC H;  3U58 A;  1IBM Q;  1I5F A;  2KBN A;  4BBS H;  1AE3 A;  2DUD A;  4XIG S;  1IZ6 A;  4LF6 L;  3B6Y A;  3I4N G;  2ZM6 Q;  4BXX H;  2R92 G;  4JBM A;  3CXC A;  1N9W A;  5M5W H;  2PNH A;  1TXY A;  3AFQ A;  2BH8 A;  4AYB E;  5IYB H;  3PO2 G;  4DK6 C;  1OXX K;  1VQI A;  3S15 H;  4A3M H;  3CC7 A;  4PMW A;  3I55 A;  1AE2 A;  2OTL A;  1WCM G;  4GOP C;  1J5E Q;  4A76 A;  4GLA C;  4DR6 Q;  2Q2T A;  4B3R Q;  4GKK Q;  2B3G A;  4A3D G;  2UXB Q;  1EQQ A;  3S1R H;  5FLM H;  1QVF A;  2VNU D;  1KQS A;  3PUZ A;  4DV7 L;  4X65 Q;  3OW2 A;  1VQ4 A;  2JJQ A;  1ASY A;  1K83 H;  1PYS B;  4LWC A;  3PIP A;  2FXQ A;  1PH3 A;  5ELN A;  4P74 A;  4R4C A;  1O7I A;  1UWV A;  3J80 i;  2KHJ A;  2HHH Q;  4A93 H;  3MEF A;  3GTP H;  2XGT A;  2UU9 L;  3UE1 A;  4HJ8 A;  4GN5 A;  3T1H Q;  2GVB A;  5LMN W;  2JK8 A;  2E5L Q;  5C4J H;  3DLL A;  2CFM A;  4X64 Q;  1P8L A;  4R4Q A;  5M3M H;  3PF5 A;  4A3G H;  3FKI G;  4UPA A;  2E2J H;  1E1O A;  1X65 A;  2OWO A;  4JCV E;  5J3B A;  5C4X G;  4JV5 Q;  3RN2 A;  4BA2 I;  1YHA A;  3KJP A;  1VQJ A;  1KRS A;  3BJU A;  2LXJ A;  4JI2 L;  4KHZ A;  5GAH C;  1QUQ B;  4QL5 A;  4X66 L;  4DPG A;  4JI7 L;  3SGI A;  4A3I G;  4A3B G;  1BBU A;  4BY1 H;  2Z6K C;  4BA1 I;  1V43 A;  3EBE A;  3TRZ A;  2UXD Q;  3KDF B;  2HQL A;  2F3I A;  4DUZ Q;  4DV1 L;  1OXV A;  4ME3 A;  4B3M Q;  2IY5 B;  1UEB A;  4QJF A;  1PYB A;  2CCZ A;  2IHF A;  3BU2 A;  5C44 G;  1PH6 A;  4OO1 G;  5BR8 L;  5IYC G;  4HIK A;  5JJL A;  1U5K A;  1HNZ Q;  4B3S Q;  3RZO H;  2OQ0 A;  4BBR H;  3HKZ G;  4JI0 L;  3PSI A;  1IYJ B;  1Z9F A;  3UDX A;  4PZ6 A;  1W2B A;  1VQE A;  1KHI A;  2K5H A;  3AEV A;  1W3S A;  2HIV A;  2F52 A;  3PGZ A;  4IOC A;  5JEA G;  1DGS A;  3CCE A;  1CSP A;  4DR4 Q;  4GKJ L;  5IYB G;  1L1O C;  2N8N A;  4DV3 Q;  1VQ9 A;  1YIJ A;  1HNX Q;  4AH6 A;  5M3F H;  3CCS A;  1J5E L;  4JBJ A;  2KEN A;  5JJI A;  4NXN L;  1VQC A;  4OO1 I;  4DR6 L;  3RN5 A;  4B3R L;  4GKK L;  3S2D H;  3LGJ A;  2UXB L;  4HJ7 A;  3HOU H;  2AWO A;  3D31 A;  2JA5 H;  2ZTD A;  5FLM G;  1UE6 A;  4L5S A;  1Q81 C;  4X65 L;  3NBH B;  4DR2 Q;  1RL2 A;  4P71 A;  4GNX A;  2OCE A;  3H3V I;  4YY3 Q;  2B29 A;  1BKB A;  1IBL Q;  1QVG A;  1VQG A;  2HHH L;  2ZJP A;  4A93 G;  1OXS C;  2OQK A;  2EXD A;  1X55 A;  3KF6 A;  4DAY B;  4LFB L;  2D0O A;  1CSQ A;  1HZ9 A;  4DAM A;  4GNX B;  4HJ5 A;  1IL2 A;  1EIY B;  3HOV H;  2JA8 H;  4X64 L;  2I5M X;  3KF6 B;  2K75 A;  3PO3 H;  3CC4 A;  1Q1B A;  3FHW A;  1Y1V G;  3GDE A;  1E24 A;  1YHB A;  3WWV A;  2VZA A;  4JV5 L;  3KLW A;  3PCO B;  3PUV A;  4YWL A;  4JOI C;  2UUA Q;  1NY4 A;  2VQE Q;  3GTQ H;  4BY7 G;  3CCV A;  4BY1 G;  1SFO H;  2ASB A;  1VQL A;  1PH2 A;  4DV1 Q;  1I6H H;  3HOZ H;  2UXD L;  1E22 A;  4IJL A;  3GTG H;  4DUZ L;  3F2D A;  4A3L H;  5C3E H;  3S16 H;  4B3M L;  4MTN A;  2IT1 A;  1SMX A;  3G6E A;  4P75 A;  4DV2 Q;  3J81 i;  1AH9 A;  4YCV A;  3ER0 A;  1VQP A;  3HOW H;  3AQQ A;  2PQA A;  3KYH C;  1Q46 A;  1SRO A;  2YTX A;  3KJO A;  4GN3 B;  1V1Q A;  4IFD G;  2WFW A;  3H0G H;  3CC2 A;  3CQZ H;  4JI0 Q;  1YJN A;  1K3R A;  1HNZ L;  4B3S L;  3K81 C;  2PQA B;  1I94 Q;  2A19 A;  4BBR G;  1JMC A;  4NPS A;  1EFW A;  4DR5 L;  2PMZ E;  3VDY A;  4R4O A;  4AYB G;  2KCT A;  4GKJ Q;  3RLF A;  1D8L A;  1K9M C;  2EQS A;  4IPH A;  4DR4 L;  1PH1 A;  5M5X H;  2BA0 A;  3L0O A;  1HZC A;  4JI8 Q;  5IP7 H;  4DV3 L;  2UXC L;  1MIU A;  2NZO A;  3STB C;  1HNX L;  2PI2 E;  4OWT B;  1VQK A;  3TS0 A;  4NXN Q;  1HNW Q;  2MFI A;  4POG A;  3I4O A;  4A3J H;  2GN5 A;  2A8V A;  1E7Z A;  2R7Z H;  4IFD I;  3ERS X;  1B70 B;  3HOU G;  2JA5 G;  3HOY H;  5IY0 A;  4LUZ A;  3JAM c;  4WJ4 A;  4A3K H;  4DR2 L;  3W5O A;  1GM5 A;  4TQU S;  1VQO A;  1YNX A;  2JA7 H;  3S1Q H;  4YY3 L;  1IBL L;  1PA6 A;  4IO9 A;  4JYA L;  1PV4 A;  4LFB Q;  3G4S A;  2N49 A;  2RCN A;  2C35 B;  4Y7N H;  5IWA Q;  3CCJ A;  4EQ5 A;  4LF8 Q;  2GVA A;  1VQB A;  5IYD H;  3HOV G;  2JA9 A;  1VQ6 A;  1KIX A;  3PV0 A;  1NMF A;  2UUB L;  1HZA A;  4A75 A;  1PFS A;  1EQR A;  4WJ3 M;  4C3I H;  2QA4 A;  2F4V L;  1EYG A;  1QZG A;  3CPW A;  2Q2H A;  4HJA A;  2VUM G;  5FJ8 H;  4Y52 H;  1A0I A;  1Q12 A;  3TRE A;  1HR0 W;  2V1C C;  2Z6K A;  3K0X A;  1A63 A;  2QGQ A;  1S40 A;  2UUA L;  1WOC A;  2ZJR A;  1TWG H;  3EIV A;  1FJG Q;  3CCQ A;  1MJE A;  3G71 A;  3NEM A;  2VQE L;  1VQN A;  5IP9 H;  1YBY A;  4A3C H;  2JA6 H;  4JI4 Q;  1Z47 A;  3AFP A;  4RMF A;  3L2P A;  3GTO H;  3ICE A;  3TS2 A;  3HOZ G;  2AHO B;  1SRU A;  3GD7 A;  4YWK A;  4A3F G;  2LXK A;  1Q82 C;  1VCI A;  1PH8 A;  1Y14 B;  1NBW A;  1X3E A;  3HOX H;  4DV2 L;  1VQH A;  3CCM A;  3M4O H;  2Q2U A;  1QVC A;  1HZB A;  4P73 A;  5ELO A;  3CW2 C;  3S24 A;  4YHH L;  2BH2 A;  1WI5 A;  3TEH B;  1V9P A;  3EN2 A;  3S1N H;  4BBS G;  4JI5 L;  2JQO A;  1Y1W H;  4KLK A;  1XNR L;  1CKO A;  4BXX G;  4OX9 Q;  2ID0 A;  2IX0 A;  3OYY A;  4DR5 Q;  1N33 Q;  3IRB A;  1I94 L;  1PHJ A;  2DGY A;  3TQY A;  2JEA I;  5GAG C;  1KXL A;  3GO5 A;  4A4I A;  1PH9 A;  2UUC Q;  1B7Y B;  1VQM A;  2MNA A;  1KRT A;  2ALY B;  4A3E H;  1PH5 A;  2UXC Q;  4HIM A;  5K36 G;  1G6P A;  4A3M G;  1JE5 A;  4JI8 L;  1Q86 C;  3AYH B;  1J6Q A;  4LF5 Q;  1HNW L;  1P16 A;  4UP7 A;  3ULL A;  3U4Z A;  4LFA Q;  3UDI A;  5C0X G;  3W1B A;  2ZTC A;  4OWW B;  1GKH A;  1I50 H;  1OTC A;  1JT8 A;  3A5U A;  2CWA A;  2K5V A;  3J80 c;  4A3J G;  4GLV B;  4IPD A;  4DR1 Q;  2NVT H;  2VY3 A;  2R92 H;  1X6O A;  2R7Z G;  1SE8 A;  4XTC S;  4HIO A;  1YJW A;  2WAQ G;  2WAQ E;  2Z0S A;  4QY7 A;  4LUO A;  2VQF L;  3CCR A;  4JYA Q;  2WB1 G;  2WB1 E;  1XJV A;  4DR7 Q;  2JA7 G;  1CKN A;  1XPO A;  3A74 A;  2MO1 A;  1M90 C;  1TWC H;  3E9I A;  5HY6 A;  3ULP A;  1WCM H;  1KAW A;  1BVS A;  3OTO Q;  3H15 A;  3A5Z B;  5IWA L;  2VS1 A;  3I4M H;  3D0F A;  5C0X I;  1XNQ L;  1EWI A;  1SN8 A;  4EX5 A;  4LF8 L;  2UUB Q;  1G51 A;  1TWF H;  5M3M G;  4A3G G;  5GRO A;  2RF4 A;  2N3S A;  3BZC A;  1LYL A;  3KOJ A;  2F4V Q;  1N32 Q;  1B8A A;  1WJJ A;  4AQY Q;  4O0A A;  5GAE C;  1FVI A;  4JI3 L;  1JJC B;  3PUY A;  5FJ8 G;  2R6G A;  1VQ7 A;  4DR3 Q;  3STB D;  2CWP A;  4GNX C;  5JJK A;  5EAY A;  4DNI A;  1KD1 C;  1ASZ A;  1FJG L;  4NB3 A;  5JEA J;  2HT1 A;  5IP9 G;  1Q1E A;  3M9B A;  1QZH A;  4A3C G;  4JI4 L;  4UP8 A;  4LF4 Q;  2YTY A;  4RG1 A;  4LF9 Q;  2K5N A;  3E9H A;  4J15 A;  5FLX c;  3DM3 A;  2NVY H;  4ALP A;  4GLX A;  3I2Z A;  4HID A;  5C4X H;  3J81 c;  1YVC A;  3G48 A;  2ATW A;  3M4P A;  1FL0 A;  5GQO A;  2AKW B;  3PUW A;  4YCU A;  4YHH Q;  1NMG A;  4APV A;  4DK3 C;  4JI5 Q;  3J7Z C;  2NN6 G;  3RNU A;  3T1Y Q;  3UE0 A;  1XNR Q;  3MXN B;  4A3I H;  2D0P A;  4OXP A;  4HJ9 A;  2K50 A;  1Y1W G;  4KHP Q;  3KF8 B;  2YTV A;  2E8G A;  1G29 1;  4OX9 L;  1N33 L;  1HH2 P;  1K0R A;  1TWH H;  1WYD A;  3M7N A;  4OON A;  4GOP A;  1N8R C;  4X62 L;  1S72 A;  4LF7 Q;  2UUC L;  4C3J H;  3GTK H;  3K80 C;  4L5R C;  1A8V A;  4MZ9 A;  1GO3 E;  4YCW A;  1X3F A;  4YWM A;  4DKA C;  2L15 A;  1SR3 A;  5C44 H;  2R7F A;  4R1J A;  2KCM A;  2IHE A;  2PI2 A;  5M3F G;  2Q2I A;  1L2F A;  4B3T Q;  3I7F A;  2R7D A;  3CCU A;  4GOP B;  4JBK A;  4LF5 L;  1VQ5 A;  4LFA L;  3CME A;  4GS3 A;  2NN6 I;  4JBW A;  1KC8 C;  1A62 A;  4K0K Q;  4GN4 B;  2CKZ B;  1LTL A;  4DR1 L;  4LW1 A;  2VQF Q;  1EUJ A;  4PG3 A;  3H3V H;  4QQB X;  3M85 A;  1OXU A;  1XTD A;  3F8T A;  4DR7 L;  1K73 C;  1RIP A;  1K8G A;  1LUZ A;  4L5T A;  1XNQ Q;  2R93 H;  3OTO L;  3A0J A;  3M3Y H;  1N34 Q;  2I0Q A;  1IBK Q;  1XMQ Q;  1MKH A;  2MQH A;  3ZJY C;  3I56 A;  3I4M G;  4P72 A;  3K7U C;  2CQO A;  4PZ8 A;  5LMU Q;  2JA8 G;  1GD7 A;  1MJC A;  1YI2 A;  2AWN A;  1YJ9 A;  1VQ8 A;  2RHS B;  5IE8 A;  3PO3 G;  1YEZ A;  1FGU A;  1N32 L;  4AQY L;  4JI3 Q;  3PIO A;  4IFD J;  4JC0 A;  4LFC Q;  4DUY L;  3S2H H;  4LNQ A;  5AJ3 Q;  1VQA A;  4DV6 Q;  2B63 H;  3GTM H;  3S1M H;  4DR3 L;  3M4Q A;  1JJ2 A;  1XMO Q;  2NVQ H;  1YHQ A;  1C0A A;  1SLJ A;  3BZK A;  1T9H A;  3L7Z C;  3F2B A;  1LM0 A; 
#chains in the Genus database with same CATH topology
 1T5X D;  4K6L A;  4PZ7 A;  3R93 A;  2KHI A;  3RLO A;  2RDF A;  2JSO A;  4LF9 L;  1STA A;  2I07 B;  2K04 A;  5EKL A;  2I5H A;  5LMN Q;  3K7A H;  2SEB D;  3DUZ A;  2AUJ D;  1I6H B;  2Q8I B;  3J7A 5;  3J7A V;  4NXM Q;  4KHP L;  3TP8 A;  4G7Z C;  1PRT C;  2JE6 I;  1F2L A;  3W1G A;  4X62 Q;  3S9W A;  1NJI C;  3MTS A;  3CAM A;  2ZTE A;  2Y0S G;  1VS0 A;  5IP7 G;  4QF4 A;  2PW7 A;  2KQ3 A;  5D14 A;  3P7J A;  5GAD C;  3PUX A;  2NVX H;  3I4N H;  3J81 j;  4UY8 C;  2A68 D;  2F0I A;  4K0K L;  4OIJ A;  4X6A H;  1K8A C;  4X3K A;  3HGB A;  3PO2 H;  4L8J A;  1FNU A;  4UP9 A;  1GUG A;  3H09 A;  1W6K A;  1Q7Y C;  1KNE A;  3ERO A;  3RR5 A;  3CMA A;  4H13 C;  4A3D H;  1CKN B;  2D62 A;  3MAQ A;  2O4X A;  3HFZ B;  3KBX A;  2IWH A;  4Y7N B;  4R8I A;  4DUY Q;  5M3M B;  1STH A;  5J1Z A;  1IXR A;  4C2M H;  3SK4 A;  4QGU A;  4FF3 A;  1MHW C;  5DEH A;  1H95 A;  2E5L L;  3DWP A;  2VW9 A;  4DV5 L;  2D9U A;  4DAV A;  1STN A;  4DV0 L;  1JR0 D;  2I46 A;  3VA7 A;  1PH7 A;  2XNA C;  3PF4 A;  3NK9 A;  1EYA A;  1HJP A;  4JW0 A;  4X66 Q;  3NUC A;  5CR3 A;  1UE1 A;  2BA1 A;  2CW0 D;  3FMC A;  2DJF C;  1X54 A;  1JWS D;  5IT9 c;  4CDD C;  4RGM A;  2D5D A;  2MO0 A;  1HR0 L;  1VQD A;  1KAA A;  4DV4 L;  5CGK A;  3DEO A;  4OO1 H;  3KLS X;  5IYC H;  1IBM Q;  1I5F A;  4BBS H;  3UI2 A;  1BBX C;  4XIG S;  1RTO A;  3I4N G;  3NQI A;  4JBM A;  2PNH A;  3AFQ A;  1U4P A;  4C56 C;  4AYB E;  2L11 A;  3PO2 G;  2SDF A;  1VQI A;  3S15 H;  4A3M H;  1AE2 A;  4IUT A;  1IW7 D;  2XRS D;  5C0X H;  2L0C A;  4DR6 Q;  4RGO S;  3I8Z A;  2B3G A;  4QCL A;  4A3D G;  5FLM H;  5BN3 A;  1TWC B;  4DV7 L;  4X65 Q;  1HTP A;  1UWV A;  2K1B A;  1HXY D;  4K14 A;  1WTX A;  1BCP C;  4L63 B;  3PO3 B;  2B2U C;  4GN5 A;  2GVB A;  5C4J H;  4QB4 A;  3DLL A;  4A3G H;  2E75 C;  5FK9 C;  3OSO A;  4HCE A;  2E2J H;  1X65 A;  3BVM A;  1SFO B;  3J7A F;  1X32 A;  1K8M A;  1D5M C;  1PDQ A;  3DWA A;  1ZEQ X;  3BVG A;  4L6T B;  5GAH C;  5C3E B;  1SNP A;  3S16 B;  2RCF A;  2CQA A;  2NVY B;  4BY1 H;  1X3Q A;  2CVR A;  2F0G A;  1RF2 D;  1V43 A;  5EKI A;  3QB3 A;  4M1U B;  4C1N K;  3M4Y A;  4DV1 L;  1BXT A;  1ENA A;  4CDF C;  2A6E C;  4C3J G;  5IGG A;  2IY5 B;  2NBF A;  3C2P A;  5JPM C;  2KHS A;  4OO1 G;  3GV3 A;  5IYC G;  4B3S Q;  1HTL D;  4J1M A;  4JI0 L;  3HKZ G;  1RDP D;  3PSI A;  3UDX A;  1KHI A;  1W3S A;  2B8F A;  4IOC A;  4A3J B;  1DGS A;  2R7Z B;  1CSP A;  4GKJ L;  2H1E A;  4DV3 Q;  3HOY B;  1PTO F;  1H9R A;  3CCS A;  1J5E L;  3J7Y W;  2KEN A;  4A3K B;  5JJI A;  4NXN L;  1VQC A;  4X3U A;  4B3R L;  3VYU A;  4ID6 A;  3S2D H;  4YIJ A;  2IPK D;  2B2W A;  2WV6 D;  5FLM G;  1UE6 A;  4L5S A;  2R93 B;  4DR2 Q;  1EIG A;  1CHP D;  2PW5 A;  2J0T D;  4P71 A;  1EZ6 A;  1BUV T;  1IBL Q;  1SSO A;  1DXM A;  4IUU A;  1JE4 A;  1X55 A;  1RJT A;  3Q23 A;  4DN4 M;  4X64 L;  3MEH A;  2I5M X;  4DNT B;  2WAC A;  5C4Z A;  4B08 A;  2DN8 A;  1XYI A;  2F03 A;  5KIX A;  5IGE A;  3GTO B;  3PUV A;  5KEE A;  1U4M A;  4FF4 A;  1D5Z C;  2VQE Q;  1Y8P B;  3C1E A;  4BY1 G;  1O7Y A;  3M4O B;  1I6H H;  2A68 C;  3TP7 A;  3F2D A;  4A3L H;  4B3M L;  1YNJ D;  1SMX A;  2EPB A;  1I3Q B;  3J81 i;  3HOW H;  2PQA A;  3BDC A;  1SRO A;  3SK5 A;  3KJO A;  4GN3 B;  5JVH 3;  4IFD G;  1NCV A;  2WFW A;  3H0G H;  5LL6 X;  1F77 A;  1EYD A;  1ENC A;  4KHV A;  2PQA B;  1JMC A;  4NPS A;  4DR5 L;  1JWM D;  2PMZ E;  5CV5 A;  4FYD A;  1ET6 A;  4DK0 A;  1D8L A;  5I4D A;  4DR4 L;  2BA0 A;  4ME5 A;  4JI8 Q;  1MIU A;  1E2V A;  2O2L D;  3TS0 A;  2KCC A;  2GN5 A;  2RBM A;  3FPU B;  1WTW A;  5IOD A;  1SNQ A;  3W5O A;  1ZKO A;  4KKT A;  1GM5 A;  1YNX A;  3S1Q H;  4YY3 L;  1PA6 A;  2JN4 A;  4JYA L;  2L55 A;  2RCN A;  2SOB A;  4Y7N H;  4CJ0 B;  5IWA Q;  1AZQ A;  2CW0 C;  3PV0 A;  1IYU A;  4ZYS A;  2EYM A;  4A75 A;  4NKL A;  4WJ3 M;  2Q8R E;  2NWG A;  3HZX A;  4HJA A;  1MD2 D;  4Y52 H;  3OMC A;  2V1C C;  2Z6K A;  3EIV A;  1FJG Q;  1MJE A;  3NEM A;  1SDF A;  1YBY A;  2B2V C;  4JI4 Q;  2LFN A;  3AFP A;  2PCF B;  3L2P A;  2NTT A;  4A3B B;  4OGQ C;  1Y14 B;  1X3E A;  3HOX H;  1QVC A;  5JPN C;  3CW2 C;  1EY7 A;  2Y0S B;  4YHH L;  3BDO A;  3EN2 A;  1S5B D;  1XNR L;  3VR4 A;  2N88 A;  4OX9 Q;  1STB A;  1U9R A;  4CDC C;  5KYL A;  2JEA I;  3TQY A;  1F9P A;  5GAG C;  2KED A;  3A54 A;  5CV4 A;  2ALY B;  4PNY A;  4A3E H;  1PH5 A;  2UXC Q;  5K36 G;  1G6P A;  3SXH A;  1Q86 C;  2EY6 A;  4OWW B;  4XYO A;  3W1B A;  5FKA C;  1I50 H;  3A5U A;  3CU7 A;  2F0U A;  2NVT H;  3OMG A;  1X6O A;  1YJW A;  2Z0S A;  2VB2 X;  1IKL A;  1XJV A;  5E4X A;  4DR7 Q;  1NUC A;  1TWC H;  5HY6 A;  3ULP A;  4V19 0;  1WCM H;  1SMY D;  1BVS A;  2B2T C;  1R4P B;  4K2K A;  1SN8 A;  1SYC A;  2UUB Q;  2H4O A;  4ZLT F;  5M3M G;  4CKE A;  5GRO A;  1VMP A;  2N3S A;  1B8A A;  4O0A A;  2B2W C;  5D65 A;  2NVQ B;  1FVI A;  4JI3 L;  2R6G A;  4DR3 Q;  3STB D;  5JJK A;  1KD1 C;  3SEB A;  1A2T A;  1B3A A;  2HT1 A;  3NTH A;  3K7A B;  1DJR D;  4XQJ A;  1QZH A;  4UP8 A;  2YTY A;  2DY8 A;  1D5X C;  1H9M A;  2NVY H;  4DF7 A;  3V96 A;  5C4X H;  3TZU A;  2ATW A;  1Y8N B;  1FL0 A;  3K0Y A;  3OWE B;  2A5H A;  5GQO A;  1IHZ A;  4DXG A;  4KK7 A;  4JI5 Q;  1UEA B;  2NN6 G;  5J39 A;  4A3I H;  5EKK A;  3KF8 B;  1N33 L;  1K0R A;  4M8A A;  3OOC A;  4OON A;  1LTT D;  4X62 L;  1N8R C;  4F88 A;  1AZP A;  4LF7 Q;  2NVX B;  4L5R C;  1K0S A;  1A8V A;  4YWM A;  4BBR B;  2F0P A;  2KCM A;  2IHE A;  5C4H A;  2EZV A;  2R7D A;  4LFA L;  5E3F A;  5KNB A;  4KJN A;  4HR7 B;  1KC8 C;  1O80 A;  1A62 A;  2A69 D;  4KN4 C;  5HUR A;  1I4P A;  5CV7 A;  2BDO A;  4TKO B;  1OXU A;  2HDM A;  3F8T A;  2MPM A;  1F9R A;  1K73 C;  3HOU B;  1SE3 A;  1K8G A;  4L5T A;  2R93 H;  4WFN 3;  4P72 A;  3K7U C;  4PZ8 A;  5LMU Q;  4JK1 C;  1NAP A;  2PZT A;  4C2M B;  1YJ9 A;  2RHS B;  2VB3 X;  3PO3 G;  1YEZ A;  1O78 A;  3SR1 A;  4G4K A;  3HOV B;  1YNJ C;  4DUY L;  1AW7 A;  4LNQ A;  3GTM H;  4CGY B;  1AEX A;  1JJ2 A;  3MXG A;  1YHQ A;  4FXK C;  3BZK A;  1T9H A;  3L7Z C;  3CCL A;  1H9K A;  4IUR A;  4R4I A;  4TVA B;  5C3E G;  1D7Q A;  3CRL C;  1QUQ A;  4KD4 A;  1GHJ A;  2XRQ D;  1Q8I A;  4JG2 A;  4RHS A;  4OEM B;  3CPF A;  2RHQ B;  2NTS A;  3GTG B;  4X3T A;  1N36 Q;  4JI6 Q;  4BY7 H;  1I3Q H;  4O2D A;  3UDF A;  1CTM A;  2HDL A;  2FJ2 A;  1U0L A;  2IW3 A;  4F7X A;  3T4A C;  4BBS B;  3MZ5 A;  3KFU A;  4B3T L;  3HKS A;  1XPR A;  4N8X 1;  1IBM L;  4FO2 A;  4PMC A;  5FLX E;  3D4W A;  2K01 A;  2PYK A;  4A3M B;  4IUP A;  1OXT A;  4RKL A;  3HKZ E;  3HOY G;  1KDC A;  4A3K G;  2E2H H;  1DOL A;  4WOR A;  3FPP A;  1WFQ A;  4IPC A;  3GTJ H;  1SXT A;  3F2C A;  3H3V C;  2R93 G;  1YZ6 A;  4G7O C;  1IBK L;  1XMQ L;  5IYD G;  5ELD A;  2GA4 B;  2ENB A;  4JOI A;  4POF A;  5C4J B;  4JPB W;  1FYC A;  3S17 H;  1FD7 D;  4LK1 C;  4A3G B;  1PRT F;  2QDB A;  4DV6 L;  3A8I E;  2E2J B;  1PZK D;  1XMO L;  1HPC A;  1KL9 A;  4KMU C;  3CP0 A;  3FP9 A;  1PVO A;  2KOL A;  2E2I H;  3OIQ A;  1EY8 A;  2SNS A;  1JJG A;  2QEX A;  1JB7 A;  2VUM H;  2XWJ B;  4I65 A;  1NTG A;  4FDB A;  4JI2 Q;  4JI1 Q;  3UDG A;  3CD6 A;  2K52 A;  4F8M A;  4JI7 Q;  4A3B H;  2LY7 A;  3J81 L;  2K28 A;  3QWN A;  4NMZ A;  1SEB D;  1E3P A;  2JEB I;  4QIW E;  1Y69 U;  4A3F H;  3I4L A;  2H5X A;  3DWQ A;  2NZH A;  5BR8 Q;  1PH4 A;  5I6W A;  1SMY C;  1HFG A;  1GUN A;  2F1M A;  3C46 A;  1EL0 A;  2DUD A;  4LF6 L;  3B6Y A;  1H9J A;  2F0D A;  1V1P B;  1MBY A;  1HQM C;  1ONL A;  1SE4 A;  3S2D B;  2BH8 A;  5D3I B;  1CZG A;  2J4X A;  5IYB H;  2EJM A;  1TS2 A;  3CC7 A;  4PMW A;  1BO0 A;  4IQZ A;  4ZK9 B;  1II3 A;  2UXB Q;  1SYB A;  2LKV A;  4RHR A;  3IKJ A;  1VQ4 A;  2JJQ A;  2FXQ A;  1PH3 A;  1W6J A;  4P74 A;  4R4C A;  3J80 E;  3GTP H;  2UU9 L;  3UE1 A;  3T1H Q;  1HUM A;  2JK8 A;  1GOZ A;  2WKC A;  3Q6S A;  3PF5 A;  3QO2 A;  4XYQ A;  2B8G A;  5ELC A;  1HA6 A;  4JCV E;  4JV5 Q;  2KVM A;  1VQJ A;  3F2U A;  3MFG A;  2RSO A;  2LXJ A;  3TP5 A;  1PLF A;  2RKS A;  2V4D A;  4DPG A;  1S4Z A;  5LL6 S;  3SGI A;  4A3B G;  5T1G A;  4BA1 I;  3RUZ A;  3HOW B;  3CHB D;  2B2Y A;  2A69 C;  1U4R A;  3H0G B;  2BOS A;  2QKI C;  1A15 A;  3I72 A;  2IHF A;  1QJO A;  3QOL A;  1PH6 A;  1KTK A;  2RDG A;  5CV6 A;  5JJL A;  1U5K A;  1BCP F;  4BBR H;  3L3O C;  1Z9F A;  2ICE C;  2EE1 A;  2ICI A;  5IT9 L;  1KDA A;  3U9O A;  3AEV A;  3NXW A;  5JEA G;  4DGZ A;  5DAU A;  1RTN A;  3T51 B;  3SE0 A;  1C4Q A;  2BE5 D;  5IYB G;  3Q0A A;  2DJG C;  2D2C C;  2N8N A;  1HNX Q;  4AH6 A;  5M3F H;  4JBJ A;  3X3M A;  3SK8 A;  3RN5 A;  3S1Q B;  4GKK L;  1ZYR D;  3W3A A;  1XWE A;  3HOU H;  2AWO A;  4RCO A;  3MXP A;  2B29 A;  1BKB A;  1VQG A;  2BCO A;  3NE5 B;  2HHH L;  2EXD A;  4UHV A;  1ESR A;  1LT4 D;  2D0O A;  1CSQ A;  4DAM A;  3H91 A;  1IL2 A;  3HOV H;  2JA8 H;  3S2H B;  1T5E A;  3Q24 A;  4O42 A;  1E24 A;  1YHB A;  2K5Q A;  3AMU A;  1QG7 A;  4YWL A;  5IGB A;  5COR A;  4JOI C;  5ELF A;  1WD0 A;  4DXF A;  3CCV A;  3HOX B;  2DNC A;  3GQB A;  1VDZ A;  3G6J B;  1PH2 A;  2QEJ C;  2UXD L;  3GTG H;  3FEW X;  4DUZ L;  3LX0 A;  2Z4I A;  4MTN A;  3MXN A;  2EY2 A;  4MN3 A;  3R3O A;  4YCV A;  3AQQ A;  3QJY A;  3KYH C;  1Q46 A;  3H94 A;  1UAP A;  2EYH A;  3BG3 A;  3N52 A;  4A3E B;  1HNZ L;  1EFW A;  1I94 Q;  2A19 A;  4BBR G;  4I7A A;  3VA5 A;  1FNV A;  1I50 B;  2KCT A;  1I6V C;  3NHH A;  1K9M C;  1LTR D;  4IPH A;  2F0L A;  5M5X H;  2NVT B;  1CZW A;  1DCZ A;  3L0O A;  1HA5 A;  2UXC L;  2NZO A;  1QCB D;  2PI2 E;  1TY0 A;  1X3P A;  4ODG A;  4POG A;  3I4O A;  4FVM A;  3MWY W;  1E7Z A;  1F2Z A;  3ERS X;  1JOO A;  1WCM B;  3T56 B;  4K2L A;  3HOU G;  2FHT A;  3JAM c;  5EPJ A;  1NR4 A;  1KLG D;  3GP7 A;  1BQQ T;  2N49 A;  3VR2 A;  5CC4 A;  1TS5 A;  2GVA A;  1JOQ A;  3HOV G;  2JA9 A;  1KIX A;  2F3V A;  2UUB L;  3S14 B;  1HZA A;  1EQR A;  4C3I H;  3KK7 A;  2QA4 A;  1EYG A;  1TVX A;  3TN2 A;  4KY5 A;  5EBD A;  1A0I A;  1HR0 W;  4KY7 A;  3K0X A;  1A63 A;  5DNF A;  1S40 A;  2UUA L;  1PFN A;  2ZJR A;  1TWG H;  3CCQ A;  5TSS A;  5C4X B;  1K3B C;  2E76 C;  3RD4 A;  2JA6 H;  1HRJ A;  1Z47 A;  3TBI B;  2AHO B;  4ZUJ A;  4ZCK A;  4YWK A;  4A3I B;  1A3T A;  1VCI A;  2SNM A;  2F0Q A;  1VQH A;  2WII B;  4DV2 L;  2A74 C;  2Q2U A;  4P73 A;  1KDB A;  2BH2 A;  3TEH B;  1V9P A;  4BBS G;  4JI5 L;  2JQO A;  1JWU D;  4KLK A;  3NSW A;  1S5D D;  1Q3L A;  2ID0 A;  2IX0 A;  4KTA A;  3BDL A;  4A4I A;  4MTK A;  2MNA A;  3SHL A;  1M4V A;  1JC7 A;  1Z7T A;  1EIH A;  4KD3 A;  4A3M G;  2P5Z X;  1EWC A;  1JE5 A;  3D4R A;  1HNW L;  1P16 A;  2EJF C;  4UP7 A;  3U4Z A;  4DU9 A;  5C0X G;  2L5T A;  2ZTC A;  3J80 c;  2O5J C;  4IAL A;  3ND9 A;  4DR1 Q;  2F0W A;  2R92 H;  1EY5 A;  4HIO A;  2WAQ G;  4QY7 A;  4KY6 A;  4LUO A;  4DAP A;  5FO9 B;  2WB1 E;  2MO1 A;  3EQL C;  3E9I A;  5FO7 B;  1QNK A;  1WTO A;  1STG A;  3A5Z B;  2VS1 A;  2X6G A;  4LF8 L;  3VYT A;  3TZD A;  4A3G G;  1DZ1 A;  3GTM B;  1PXU A;  1DD2 A;  1LYL A;  3KOJ A;  5EBC A;  2F4V Q;  1N32 Q;  3BS1 A;  2OXP A;  3LWU A;  4AQY Q;  2O5I C;  3VYR A;  1VQ7 A;  1F2Y A;  1SJE D;  1XXG A;  3M7G A;  1ASZ A;  1AFP A;  4CJ2 C;  4PV1 C;  1O7L A;  1Q1E A;  1AP0 A;  3M9B A;  1EY6 A;  4RG1 A;  4LF9 Q;  1CQV A;  3I2Z A;  4P2C B;  4ABN A;  4HID A;  5LHY 1;  4BY7 B;  4B9X A;  2BE5 C;  1NR2 A;  3TSS A;  4DK3 C;  3RNU A;  3UE0 A;  1J8I A;  1DON A;  2D0P A;  4KHP Q;  2K50 A;  1VF5 C;  1ZYR C;  5JVG 3;  1C48 A;  1HH2 P;  1TWH H;  2DY7 A;  1S72 A;  2UUC L;  1YNN D;  3TP6 A;  2R7F A;  4HMJ A;  5C44 H;  2CH4 A;  4LF5 L;  2E2H B;  1BOS A;  4V0B A;  1EFI D;  4JBW A;  1KNA A;  4PMB A;  4K0K Q;  3GTJ B;  3ZYY X;  2FIN B;  4LW1 A;  1LTI D;  2L9H A;  5G3L D;  2VQF Q;  4PG3 A;  5F2D A;  1M8A A;  2QIL A;  3HEJ A;  2JA5 B;  2F3W A;  1XNQ Q;  1A3V A;  3OTO L;  3A0J A;  3M3Y H;  3C1F A;  2PZU A;  2MQH A;  3ZJY C;  3S17 B;  4OEL B;  1F9S A;  1GD7 A;  3IAY A;  4CHT B;  5IE8 A;  1PZJ D;  1QOH A;  4H0L C;  4IFD J;  4JC0 A;  3S2H H;  3NWS A;  2E2I B;  1VQA A;  4B9W A;  3M4Q A;  4NP5 A;  2VUM B;  1CK1 A;  1ET9 A;  4DV5 Q;  5C3X A;  4DV0 Q;  4LF4 L;  4A3L G;  2M9V A;  1Y1V H;  1EOV A;  4CDE C;  2KCN A;  2VL6 A;  2RA4 A;  3HOW G;  4OWX B;  1IW7 C;  3VYS A;  4LUV A;  3HOZ B;  3IL8 A;  3KDF A;  3K8A A;  4JI1 L;  3T13 A;  4A3F B;  5BN5 A;  3T1Y L;  3H0G G;  1Q8K A;  1G2S A;  3KBG A;  2F0M A;  4R4T A;  2EYJ A;  1JOK A;  1HR0 Q;  4DV4 Q;  2Y0S E;  4IN3 A;  4U68 A;  3CQZ B;  3U4V A;  1Q90 A;  3K6O A;  3K58 A;  3I73 A;  1RCV D;  3IFT A;  1UE7 A;  3HP3 A;  1ML0 D;  3K59 A;  1LT6 D;  2EJG C;  4C3H H;  5L37 A;  2TSS A;  3NEL A;  5H1S E;  2WKD A;  3K57 A;  3RZD H;  1C9O A;  5CBE E;  2WP8 J;  3U50 C;  4IJH A;  1N34 L;  3NBH A;  4XQN A;  2JA7 B;  1JIC A;  3GTP B;  4DV7 Q;  2M2L A;  1I4H A;  4DAY A;  3Q8D A;  3K5N A;  1GVP A;  2OTJ A;  4K5W A;  2EYO A;  3NP8 A;  1WD1 A;  1VQF A;  4LFC L;  3S14 H;  5AJ3 L;  3NEN A;  2N78 A;  5G3L F;  3JAM i;  3T1H L;  5DLQ E;  1FNW A;  3R8B A;  2IX1 A;  3AB9 A;  2JXM B;  4FXD A;  3JC6 6;  3A7A B;  4QUC A;  1CT1 D;  4DFA A;  1ILQ A;  2AMC B;  3HOX G;  1HCZ A;  3MXU A;  5LMN L;  3DEP A;  4H44 C;  2X69 A;  4O1N A;  1I4G A;  2K33 A;  2A1A A;  2XIW A;  1E1T A;  4L5Q A;  5EQ0 A;  4NXM L;  3ULJ A;  3CF5 A;  4HMI A;  1V8Q A;  2NYZ D;  2K4K A;  3BVZ A;  3S1N B;  1LLR D;  1EY4 A;  4A3E G;  2ZJQ A;  3VR5 A;  1EOT A;  2AQ1 B;  1O7Z A;  4TRD A;  5ELE A;  3P20 A;  4XXE A;  1F9Q A;  3FRP B;  1AE3 A;  2KA7 A;  3NPP A;  5I2Y A;  4BXX H;  2ZM6 Q;  5M3F B;  1LTA D;  2VXW A;  1N9W A;  3VR6 A;  1RKN A;  1TXY A;  4DK6 C;  2RQX A;  3I55 A;  3MHB A;  2OTL A;  1WCM G;  1J5E Q;  4K5V A;  1SYG A;  4GLA C;  2LS0 1;  2Q2T A;  1PFM A;  4B3R Q;  1EQQ A;  3S1R H;  3KLR A;  4CJ1 B;  4I7Z C;  3OW2 A;  2AQ3 B;  1ASY A;  1K83 H;  3URY A;  5ELN A;  2JA8 B;  4A93 H;  3J80 i;  2KHJ A;  3MEF A;  2XGT A;  5FO8 B;  4HJ8 A;  2NB0 A;  5LMN W;  1KAB A;  1STE A;  4X64 Q;  4UPA A;  1C8C A;  1U4L A;  2OWO A;  5C4X G;  5J3B A;  3WOF A;  3NBI A;  3RN2 A;  1YHA A;  3KJP A;  1SYE A;  2PZW A;  2G5D A;  1GUO A;  1YNN C;  4KHZ A;  1FR3 A;  1QUQ B;  4X66 L;  4A3I G;  1BBU A;  2Z6K C;  4DA2 A;  1ICF B;  3PIO 3;  1S5C D;  2HQL A;  3E3X A;  4ME3 A;  4B3M Q;  1QIL A;  1UEB A;  5J22 A;  2CCZ A;  1E2Z A;  3LWE A;  5IGD A;  2QCP X;  3D6W A;  1B2T A;  1F2M A;  1L0Y B;  1WTR A;  1FGB D;  1EU3 A;  1XX8 A;  5M5X B;  2F0T A;  4RFB A;  5C5L A;  1IYJ B;  3R2T A;  4PZ6 A;  4HSV A;  2K5H A;  3RMH A;  2F52 A;  3PGZ A;  4ZQ3 A;  3MVV A;  3CCE A;  4DR4 Q;  2RDH A;  1VQ9 A;  2WAQ B;  2F0K A;  1YIJ A;  4WRD A;  5IT9 E;  4OO1 I;  1SND A;  4DR6 L;  1CA5 A;  2EOT A;  2F0V A;  4K8J A;  4HJ7 A;  4HCS A;  2JA5 H;  4X65 L;  1RL2 A;  1CI3 M;  2OCE A;  4YY3 Q;  2XN9 C;  1QVG A;  4IZ8 A;  4A93 G;  2ZJP A;  2OQK A;  4J8Q A;  4C3I B;  1LTG D;  3H6M A;  4HJ5 A;  4J6H A;  3E6Z X;  1B44 D;  5I9P A;  1ICW A;  2K75 A;  1TWG B;  2B63 B;  3S1M B;  3FHW A;  2R3Z A;  1I4X A;  3WWV A;  2VZA A;  2JA6 B;  1NSN S;  2F0J A;  2IJ0 A;  1BDO A;  3EA6 A;  1J9O A;  3GTQ H;  4BY7 G;  3P75 A;  3NTI A;  2ASB A;  1VQL A;  4Q0F A;  1SE2 A;  3HOZ H;  1E22 A;  4IJL A;  4EVO A;  3G6E A;  1AH9 A;  1VQP A;  1BNZ A;  2YTX A;  4R9W A;  3CQZ H;  1B9M A;  1EEI D;  1K3R A;  2XSC A;  3FDT A;  1YJN A;  4B3S L;  5JAV A;  5FOB B;  3HRZ C;  1G6Z A;  4R4O A;  1HFN A;  3RLF A;  1STY A;  2EQS A;  4BWG B;  2F0N A;  2R92 B;  5IP7 H;  3MFY A;  4DV3 L;  3STB C;  4OWT B;  2MFI A;  4IFD I;  3GTL B;  3A55 A;  2JA5 G;  4N8F A;  5A2Q L;  5IY0 A;  1D1K A;  4LUZ A;  4DR2 L;  1ROD A;  2B2U A;  4TQU S;  2J7Z A;  1VQO A;  2JA7 H;  1IBL L;  4IO9 A;  4LFB Q;  1IYV A;  3G4S A;  2C35 B;  2G9D A;  1VQB A;  4K6D A;  3OHX C;  4H7B A;  4HSP A;  1L0X B;  1EEF D;  1PFS A;  5IOC A;  2C9O A;  2F4V L;  2Q2H A;  2EYF A;  3FVQ A;  2VUM G;  5FJ8 H;  3KUP A;  3QIA A;  1G8Z D;  1Q12 A;  3FKI B;  3TRE A;  3AU7 A;  2QGQ A;  1A3U A;  4K8I A;  1WOC A;  4RCN A;  2VQE L;  3PMF A;  2KUM A;  3NWT A;  2Z9H A;  3PIP 3;  4RMF A;  3ICE A;  3TS2 A;  3HOZ G;  1DYQ A;  2YU9 B;  1R4Q B;  4A3F G;  2LXK A;  4U67 3;  1Q82 C;  1NBW A;  3TDQ A;  1HZB A;  3D6C A;  1TWH B;  3S1N H;  2E74 C;  2MUY A;  5C44 B;  3OYY A;  2KJX A;  1N33 Q;  3IRB A;  2DGY A;  3E5S A;  1KXL A;  1VQM A;  4FF2 A;  1EZ8 A;  2EVB A;  1EQT A;  5FLX L;  4HIM A;  4JI8 L;  4FP5 D;  3ULL A;  4HN7 A;  4LFA Q;  5DM6 3;  5M5W B;  1GKH A;  1OTC A;  2K5V A;  1CFM A;  4IPD A;  1GXD C;  4XTC S;  1OO9 B;  3M3Y B;  1SJH D;  4ILW A;  2VQF L;  4KV6 A;  2JA7 G;  1CKN A;  2AUK A;  1XPO A;  3H15 A;  1EU4 A;  5IWA L;  3D0F A;  1XNQ L;  1EWI A;  1B50 A;  4UAI A;  1TWF H;  5I6Y A;  2RF4 A;  2IX3 A;  2NUC A;  2X6L A;  3BZC A;  2DNE A;  3EFX D;  3JAM L;  3D3R A;  5CMD A;  1JJC B;  3PUY A;  1Y8O B;  5FJ8 G;  2R61 A;  2L1B A;  1FJG L;  1Y1V B;  2EDG A;  5JEA J;  2A6H D;  3SK6 A;  4JI4 L;  2OF1 A;  2K7V A;  2K5N A;  3E9H A;  1UNS A;  4J15 A;  3DM3 A;  5FLX c;  5C3W A;  3M4P A;  1WVL A;  2AQ2 B;  3PQI A;  3KLS A;  4ZRZ A;  4APV A;  3MA2 B;  2K5W A;  4DK1 A;  3MXN B;  3ITP A;  4HJ9 A;  1EY0 A;  2EYL A;  2K05 A;  3V05 A;  4OX9 L;  1PTO D;  4GOP A;  4C3J H;  1I4R A;  4C3H B;  1MGS A;  1VF7 A;  1GO3 E;  4MZ9 A;  4YCW A;  3RZO B;  4B3T Q;  2PI2 A;  5M3F G;  4JBK A;  4PQX A;  4GOP B;  4AYB B;  3RZD B;  1VQ5 A;  3CME A;  4GS3 A;  2NN6 I;  3NTK A;  1TS4 A;  4GN4 B;  1G2T A;  2EY1 A;  4QQB X;  3D4D A;  1K8O A;  3U9S A;  4DR7 L;  2EYP A;  2XVS A;  2Z1C A;  1IBK Q;  1XMQ Q;  1MKH A;  3I56 A;  2JA8 G;  1HQR D;  3J80 L;  3VR3 A;  1FGU A;  1DOM A;  1PTO B;  1B1Z A;  3PIO A;  3O13 A;  1IKM A;  3X3N A;  1WTV A;  4DV6 Q;  4ZKB B;  4FNF A;  2B63 H;  2B2V A;  3OPO A;  4DR3 L;  3S1M H;  5M9O A;  1HUN A;  1XMO Q;  5I2X A;  1HHV A;  2F0E A;  1MI2 A;  3I90 A;  5A35 A;  2ES2 A;  3K5O A;  1TWA H;  4QUF A;  5CV8 A;  5BN4 A;  5KGU A;  4IPG A;  1QB5 D;  2BDN A;  1NE3 A;  1L0W A;  4R8N A;  5M5Y H;  1L1O A;  1AN8 A;  1PMR A;  4OIK A;  1X9N A;  4LF7 L;  4Q5V A;  2B2Y C;  3I70 A;  3DXJ C;  4FXG C;  1L1O B;  1LT3 D;  1RHP A;  2XTI A;  4IFD H;  4LF6 Q;  1GHK A;  1S5F D;  3E0E A;  1ESF A;  2M00 A;  3GV6 A;  1D1I A;  1X3G A;  2ZM6 L;  4KI0 A;  2YV5 A;  1CKM A;  2L12 A;  2RSN A;  5EJW A;  3K5M A;  2I5L X;  3S1R B;  1R9T H;  1M1K C;  2B2T A;  3GTL H;  4IUV A;  2HUG A;  1K83 B;  2K14 A;  1BR9 A;  3N6R A;  2IL8 A;  3SVM A;  4A93 B;  2WB1 B;  1UE5 A;  2LMC B;  1V1O A;  1QNU A;  5LMU L;  1CA6 A;  2JP1 A;  5JOB A;  3P1H A;  5E7N A;  2Q8T A;  4C3I G;  3BYT B;  4IOA A;  4LMQ D;  4NDX A;  2F0F A;  1B4O A;  2Z8L A;  3A56 A;  3TME A;  1PZI D;  2UU9 Q;  4ZUI A;  1EQV A;  3F1Z A;  2B63 G;  1TU2 B;  4F87 A;  1XPU A;  3RLN A;  1WTH A;  4HED A;  2JA6 G;  3FKI H;  1SAP A;  2MGS A;  4AIM A;  1A2U A;  5C6A A;  2OEO A;  1S3O A;  3D8G A;  5C0X J;  5KYI A;  1X56 A;  1YIT A;  2HIX A;  5EGT A;  4MNO A;  4EQP A;  1C7Y A;  2YU9 H;  4BS9 A;  4KN7 C;  1N36 L;  4JI6 L;  2EIF A;  3QG1 A;  2PNR C;  3I91 A;  3HG9 A;  2LSS A;  1BBW A;  4E6I A;  2K32 A;  1MSG A;  4H02 A;  1I4Q A;  1SNC A;  1EIF A;  5EPL A;  1CUK A;  5HGQ A;  2YYZ A;  1Y1W B;  1CM9 A;  4RGT A;  4TSS A;  2PMZ B;  3U58 A;  2XWB B;  2KBN A;  5ELB A;  3BZD B;  1IZ6 A;  5CYU A;  2R92 G;  3I3C A;  3CXC A;  1H9S A;  5M5W H;  4XT1 B;  5D3D A;  1OXX K;  5K36 H;  4EGV A;  4GOP C;  1H9S B;  3A8K E;  4KKS A;  4RA8 A;  4A76 A;  4EQN A;  3HS0 C;  1LV9 A;  4GKK Q;  1B3Q A;  2A6H C;  1D6E C;  1QVF A;  2VNU D;  1KQS A;  3PUZ A;  4HTH A;  2B39 A;  1PYS B;  1TS3 A;  4LWC A;  3PIP A;  3I4M B;  2FMC A;  1O7I A;  2HHH Q;  1JOR A;  5KRU A;  3DM1 A;  5ISR A;  1LO5 D;  2KEE A;  1JQY D;  2E5L Q;  2CFM A;  1EYC A;  1P8L A;  4R4Q A;  5M3M H;  4HAE A;  3FKI G;  5NUC A;  3T16 A;  1PTO C;  3GTQ B;  1E1O A;  1WTQ A;  1IL8 A;  4BA2 I;  1DOK A;  1KRS A;  3BJU A;  4JI2 L;  3WOE A;  1D2B A;  3CKI B;  4JI7 L;  4QL5 A;  4JVZ A;  4K5X A;  4C1N I;  3NQT A;  1WTP A;  2FMM A;  3EBE A;  5IIF A;  1K28 A;  3TRZ A;  1TQO A;  2UXD Q;  3KDF B;  3DMU A;  2F3I A;  3CRK C;  4DUZ Q;  1OXV A;  2Z4H A;  1LAC A;  3W2D A;  1ILP A;  4QJF A;  1PYW D;  1B53 A;  1PYB A;  2MJ8 A;  3BU2 A;  3ND8 A;  5C44 G;  1VMC A;  1G91 A;  5I9O A;  5BR8 L;  2NN6 H;  4HIK A;  4XDX A;  1HNZ Q;  3RZO H;  3GTK B;  2OQ0 A;  3G7L A;  3OWF A;  1W2B A;  1VQE A;  2E2D C;  2HIV A;  2K5D A;  3Q22 A;  4IUN A;  2F0H A;  1L1O C;  2MHV A;  3LGJ A;  2UXB L;  2ZXO A;  3D31 A;  2PQE A;  2ZTD A;  5T1I A;  1Q81 C;  3EJI A;  3NBH B;  4GNX A;  3H3V I;  2ZXP A;  2FFK B;  1OXS C;  3KF6 A;  1CQF A;  4DAY B;  4LFB L;  2HCI A;  1PTO H;  3QR8 A;  1HZ9 A;  4GNX B;  1EIY B;  3BYY B;  2F0O A;  2K03 A;  1LT5 D;  3KF6 B;  3PO3 H;  2ZXR A;  1Q1B A;  4KKU A;  2JYO A;  3CC4 A;  1Y1V G;  3GDE A;  3R2I A;  4JV5 L;  3KLW A;  3PCO B;  4RGN A;  2UUA Q;  1NY4 A;  5HGT A;  1SFO H;  1RD9 D;  4DV1 Q;  1TT2 A;  4XQQ A;  5C3E H;  3S16 H;  2IT1 A;  4RAU C;  4P75 A;  4DV2 Q;  3ER0 A;  4N9T A;  3J81 E;  3KF8 A;  1V1Q A;  1SBB B;  5E4W C;  3WDN A;  4JI0 Q;  3CC2 A;  1GJX A;  4C3H G;  1JCK B;  3K81 C;  3EVQ A;  2PO4 A;  3A7L A;  2CHB D;  4WJW A;  3VDY A;  4AYB G;  4GKJ Q;  2Z6B A;  1A6X A;  1PH1 A;  5KND A;  4OHJ A;  3I4N B;  1HZC A;  4NXN Q;  1VQK A;  1HNW Q;  1HNX L;  2NZ1 D;  3PO2 B;  1GUT A;  4A3J H;  2A8V A;  4KJO A;  1LTB D;  2R7Z H;  5KNC A;  1PRT D;  2MP1 A;  3ONA B;  1B70 B;  3HOY H;  1EY9 A;  4WJ4 A;  4A3K H;  1PFB A;  4A3D B;  1SNM A;  1TWF B;  4RKB A;  3ERQ A;  1ZXT A;  1PV4 A;  4LAA A;  5A2Q E;  3C3L A;  3CCJ A;  4EQ5 A;  4LF8 Q;  3LNN A;  5IYD H;  5AFW A;  1VQ6 A;  1NMF A;  2OT2 A;  2G9H D;  1QZG A;  3CPW A;  1KLU D;  3QOJ A;  1TY2 A;  4QMG A;  1UUP A;  1GUW A;  3G71 A;  1VQN A;  1ENF A;  5IP9 H;  4A3C H;  4MHE A;  3GTO H;  4GZY C;  1PRT B;  5CBA E;  1SRU A;  3GD7 A;  4EQO A;  5E1F A;  1PH8 A;  2RVL A;  1NNX A;  2CH4 W;  3IFD A;  3CCM A;  1BF4 A;  3M4O H;  1DM0 B;  5ELO A;  2HCC A;  3S24 A;  1WI5 A;  5DM7 3;  4LJZ C;  4C3J B;  1E0B A;  1Y1W H;  1CKO A;  2EXZ A;  4BXX G;  3L9A X;  4DR5 Q;  1I94 L;  1PHJ A;  4CKB A;  3A8J E;  3GO5 A;  2KEC A;  4OL7 A;  1PH9 A;  1B7Y B;  2UUC Q;  4FF1 A;  2ZT9 C;  4N9P A;  1KRT A;  3HKZ B;  5K5P A;  3AYH B;  1J6Q A;  1JB3 A;  4LF5 Q;  3UDI A;  1TKW B;  2HQE A;  1JT8 A;  2CWA A;  4A3J G;  4GLV B;  4IUQ A;  2R7Z G;  1SYF A;  2VY3 A;  3S15 B;  1SE8 A;  3K5L A;  1SYD A;  2WAQ E;  4ZKC B;  4RH6 A;  3CCR A;  4JYA Q;  2WB1 G;  3A74 A;  1M90 C;  1KAW A;  3OTO Q;  1TII D;  3I4M H;  5C0X I;  4DNR B;  4EX5 A;  4ULL A;  1G51 A;  1MSH A;  2N55 A;  4XT3 B;  5JJZ A;  1WJJ A;  3SDZ A;  5GAE C;  1E2W A;  2CWP A;  4GNX C;  1GUS A;  5EAY A;  1TWA B;  4MIU A;  4DNI A;  4NB3 A;  5IP9 G;  3JAM E;  4A3C G;  5EPK A;  2QF7 A;  4LF4 Q;  2F4I A;  3MC0 B;  4ALP A;  4GLX A;  2PPB C;  4BY1 B;  1YVC A;  3G48 A;  1BCP D;  5M5Y B;  2AKW B;  3PUW A;  4NW2 A;  4YCU A;  1CHQ D;  1NMG A;  4YHH Q;  4QIW B;  2F0S A;  3J7Z C;  3T1Y Q;  4G7H C;  1XNR Q;  2L4N A;  1S5E D;  4OXP A;  1Y1W G;  3OIP A;  1Z6H A;  2YTV A;  1LAB A;  2E8G A;  2K6A A;  1G29 1;  3OW7 A;  4S3S A;  1WYD A;  3M7N A;  3V2T A;  2A73 B;  3GTK H;  3K80 C;  3T53 B;  1X3F A;  4DKA C;  2L15 A;  1XTC D;  1SR3 A;  4CBV A;  2HD3 A;  4R1J A;  2Q2I A;  1L2F A;  3I7F A;  3CCU A;  1V1P A;  5IGC A;  2TMP A;  4ZAI A;  2EY5 A;  1R9T B;  2QDL A;  2CKZ B;  1LTL A;  4DR1 L;  5CV9 A;  2A6E D;  1EUJ A;  3H3V H;  1LTS D;  2C5C A;  5JEA H;  3E0J A;  3M85 A;  1XTD A;  2WIN B;  1RIP A;  1BCP B;  1SNO A;  1LUZ A;  1N34 Q;  4CKC A;  2I0Q A;  1EWH A;  4UDU C;  4X3S A;  3I4M G;  4G57 A;  2CQO A;  1QWY A;  3DHQ A;  1MJC A;  1YI2 A;  2AWN A;  1VQ8 A;  1N32 L;  2QW7 A;  4AQY L;  4JI3 Q;  1TR5 A;  4LFC Q;  5C5M A;  5IGF A;  5AJ3 Q;  5COY A;  1QE6 A;  4RWS C;  1C0A A;  1SLJ A;  3J81 c;  4Z9C B;  1B9N A;  2NVQ H;  3F2B A;  1LM0 A; 
#chains in the Genus database with same CATH homology
 4DV5 Q;  3CCL A;  4PZ7 A;  2KHI A;  3RLO A;  4DV0 Q;  4LF4 L;  4LF9 L;  4A3L G;  4R4I A;  4TVA B;  5C3E G;  2ES2 A;  1D7Q A;  1QUQ A;  1TWA H;  1Y1V H;  2I5H A;  1EOV A;  5LMN Q;  2VL6 A;  3K7A H;  4JG2 A;  3HOW G;  4OWX B;  3CPF A;  4LUV A;  2RHQ B;  4IPG A;  3KDF A;  3K8A A;  4JI1 L;  3T1Y L;  1NE3 A;  1N36 Q;  4JI6 Q;  3H0G G;  1Q8K A;  1I3Q H;  4O2D A;  3UDF A;  4BY7 H;  3J7A 5;  4KHP L;  4NXM Q;  1L0W A;  1U0L A;  5M5Y H;  4R4T A;  1L1O A;  2JE6 I;  3W1G A;  4X62 Q;  1NJI C;  3CAM A;  1X9N A;  2ZTE A;  1HR0 Q;  2Y0S G;  4DV4 Q;  2Y0S E;  4LF7 L;  3U4V A;  1VS0 A;  5IP7 G;  3KFU A;  1L1O B;  4B3T L;  1UE7 A;  3HKS A;  1XPR A;  1IBM L;  2XTI A;  5GAD C;  3PUX A;  2NVX H;  4LF6 Q;  3I4N H;  4C3H H;  3J81 j;  4UY8 C;  3E0E A;  4K0K L;  1OXT A;  4X6A H;  3HKZ E;  1X3G A;  2ZM6 L;  1K8A C;  3HOY G;  3NEL A;  5H1S E;  4KI0 A;  4A3K G;  2YV5 A;  1CKM A;  2E2H H;  3PO2 H;  3RZD H;  2I5L X;  1C9O A;  4UP9 A;  1R9T H;  1WFQ A;  1M1K C;  3GTL H;  4IPC A;  1Q7Y C;  2WP8 J;  3GTJ H;  3F2C A;  3U50 C;  2K14 A;  3CMA A;  3RR5 A;  2R93 G;  1YZ6 A;  4IJH A;  1N34 L;  1IBK L;  4A3D H;  1XMQ L;  1CKN B;  1UE5 A;  5IYD G;  2D62 A;  5LMU L;  3HFZ B;  4DV7 Q;  5E7N A;  4JOI A;  3Q8D A;  4IOA A;  4POF A;  1GVP A;  4DUY Q;  2OTJ A;  3S17 H;  1VQF A;  4LFC L;  2UU9 Q;  3S14 H;  1IXR A;  3F1Z A;  5AJ3 L;  4DV6 L;  4C2M H;  3NEN A;  2B63 G;  2N78 A;  1XPU A;  4QGU A;  3JAM i;  1XMO L;  3RLN A;  1KL9 A;  3T1H L;  5DLQ E;  3CP0 A;  2IX1 A;  1H95 A;  3FP9 A;  2JA6 G;  1PVO A;  2E5L L;  3FKI H;  4AIM A;  2VW9 A;  4DV5 L;  2E2I H;  3JC6 6;  4DV0 L;  1S3O A;  5C0X J;  1JJG A;  2QEX A;  1X56 A;  1PH7 A;  1JB7 A;  1YIT A;  2HIX A;  2AMC B;  3HOX G;  4MNO A;  2VUM H;  5LMN L;  3PF4 A;  1NTG A;  4FDB A;  1HJP A;  4JI1 Q;  4JI2 Q;  3UDG A;  1C7Y A;  2YU9 H;  2K52 A;  3CD6 A;  4X66 Q;  4JI7 Q;  4A3B H;  2A1A A;  1UE1 A;  1N36 L;  4JI6 L;  2EIF A;  1E1T A;  2BA1 A;  4L5Q A;  2LSS A;  1BBW A;  1X54 A;  5IT9 c;  4NXM L;  4H02 A;  3ULJ A;  3CF5 A;  1E3P A;  2JEB I;  2K4K A;  4QIW E;  1EIF A;  4A3F H;  2MO0 A;  1CUK A;  1HR0 L;  1VQD A;  5HGQ A;  2YYZ A;  4DV4 L;  2H5X A;  4A3E G;  2ZJQ A;  2NZH A;  5BR8 Q;  1PH4 A;  5IYC H;  3U58 A;  1IBM Q;  1I5F A;  2KBN A;  4BBS H;  1AE3 A;  2DUD A;  4XIG S;  1IZ6 A;  4LF6 L;  3B6Y A;  3I4N G;  2ZM6 Q;  4BXX H;  2R92 G;  4JBM A;  3CXC A;  1N9W A;  5M5W H;  2PNH A;  1TXY A;  3AFQ A;  2BH8 A;  4AYB E;  5IYB H;  3PO2 G;  4DK6 C;  1OXX K;  1VQI A;  3S15 H;  4A3M H;  3CC7 A;  4PMW A;  3I55 A;  1AE2 A;  2OTL A;  1WCM G;  4GOP C;  1J5E Q;  4A76 A;  4GLA C;  4DR6 Q;  2Q2T A;  4B3R Q;  4GKK Q;  2B3G A;  4A3D G;  2UXB Q;  1EQQ A;  3S1R H;  5FLM H;  1QVF A;  2VNU D;  1KQS A;  3PUZ A;  4DV7 L;  4X65 Q;  3OW2 A;  1VQ4 A;  2JJQ A;  1ASY A;  1K83 H;  1PYS B;  4LWC A;  3PIP A;  2FXQ A;  1PH3 A;  5ELN A;  4P74 A;  4R4C A;  1O7I A;  1UWV A;  3J80 i;  2KHJ A;  2HHH Q;  4A93 H;  3MEF A;  3GTP H;  2XGT A;  2UU9 L;  3UE1 A;  4HJ8 A;  4GN5 A;  3T1H Q;  2GVB A;  5LMN W;  2JK8 A;  2E5L Q;  5C4J H;  3DLL A;  2CFM A;  4X64 Q;  1P8L A;  4R4Q A;  5M3M H;  3PF5 A;  4A3G H;  3FKI G;  4UPA A;  2E2J H;  1E1O A;  1X65 A;  2OWO A;  4JCV E;  5J3B A;  5C4X G;  4JV5 Q;  3RN2 A;  4BA2 I;  1YHA A;  3KJP A;  1VQJ A;  1KRS A;  3BJU A;  2LXJ A;  4JI2 L;  4KHZ A;  5GAH C;  1QUQ B;  4QL5 A;  4X66 L;  4DPG A;  4JI7 L;  3SGI A;  4A3I G;  4A3B G;  1BBU A;  4BY1 H;  2Z6K C;  4BA1 I;  1V43 A;  3EBE A;  3TRZ A;  2UXD Q;  3KDF B;  2HQL A;  2F3I A;  4DUZ Q;  4DV1 L;  1OXV A;  4ME3 A;  4B3M Q;  2IY5 B;  1UEB A;  4QJF A;  1PYB A;  2CCZ A;  2IHF A;  3BU2 A;  5C44 G;  1PH6 A;  4OO1 G;  5BR8 L;  5IYC G;  4HIK A;  5JJL A;  1U5K A;  1HNZ Q;  4B3S Q;  3RZO H;  2OQ0 A;  4BBR H;  3HKZ G;  4JI0 L;  3PSI A;  1IYJ B;  1Z9F A;  3UDX A;  4PZ6 A;  1W2B A;  1VQE A;  1KHI A;  2K5H A;  3AEV A;  1W3S A;  2HIV A;  2F52 A;  3PGZ A;  4IOC A;  5JEA G;  1DGS A;  3CCE A;  1CSP A;  4DR4 Q;  4GKJ L;  5IYB G;  1L1O C;  2N8N A;  4DV3 Q;  1VQ9 A;  1YIJ A;  1HNX Q;  4AH6 A;  5M3F H;  3CCS A;  1J5E L;  4JBJ A;  2KEN A;  5JJI A;  4NXN L;  1VQC A;  4OO1 I;  4DR6 L;  3RN5 A;  4B3R L;  4GKK L;  3S2D H;  3LGJ A;  2UXB L;  4HJ7 A;  3HOU H;  2AWO A;  3D31 A;  2JA5 H;  2ZTD A;  5FLM G;  1UE6 A;  4L5S A;  1Q81 C;  4X65 L;  3NBH B;  4DR2 Q;  1RL2 A;  4P71 A;  4GNX A;  2OCE A;  3H3V I;  4YY3 Q;  2B29 A;  1BKB A;  1IBL Q;  1QVG A;  1VQG A;  2HHH L;  2ZJP A;  4A93 G;  1OXS C;  2OQK A;  2EXD A;  1X55 A;  3KF6 A;  4DAY B;  4LFB L;  2D0O A;  1CSQ A;  1HZ9 A;  4DAM A;  4GNX B;  4HJ5 A;  1IL2 A;  1EIY B;  3HOV H;  2JA8 H;  4X64 L;  2I5M X;  3KF6 B;  2K75 A;  3PO3 H;  3CC4 A;  1Q1B A;  3FHW A;  1Y1V G;  3GDE A;  1E24 A;  1YHB A;  3WWV A;  2VZA A;  4JV5 L;  3KLW A;  3PCO B;  3PUV A;  4YWL A;  4JOI C;  2UUA Q;  1NY4 A;  2VQE Q;  3GTQ H;  4BY7 G;  3CCV A;  4BY1 G;  1SFO H;  2ASB A;  1VQL A;  1PH2 A;  4DV1 Q;  1I6H H;  3HOZ H;  2UXD L;  1E22 A;  4IJL A;  3GTG H;  4DUZ L;  3F2D A;  4A3L H;  5C3E H;  3S16 H;  4B3M L;  4MTN A;  2IT1 A;  1SMX A;  3G6E A;  4P75 A;  4DV2 Q;  3J81 i;  1AH9 A;  4YCV A;  3ER0 A;  1VQP A;  3HOW H;  3AQQ A;  2PQA A;  3KYH C;  1Q46 A;  1SRO A;  2YTX A;  3KJO A;  4GN3 B;  1V1Q A;  4IFD G;  2WFW A;  3H0G H;  3CC2 A;  3CQZ H;  4JI0 Q;  1YJN A;  1K3R A;  1HNZ L;  4B3S L;  3K81 C;  2PQA B;  1I94 Q;  2A19 A;  4BBR G;  1JMC A;  4NPS A;  1EFW A;  4DR5 L;  2PMZ E;  3VDY A;  4R4O A;  4AYB G;  2KCT A;  4GKJ Q;  3RLF A;  1D8L A;  1K9M C;  2EQS A;  4IPH A;  4DR4 L;  1PH1 A;  5M5X H;  2BA0 A;  3L0O A;  1HZC A;  4JI8 Q;  5IP7 H;  4DV3 L;  2UXC L;  1MIU A;  2NZO A;  3STB C;  1HNX L;  2PI2 E;  4OWT B;  1VQK A;  3TS0 A;  4NXN Q;  1HNW Q;  2MFI A;  4POG A;  3I4O A;  4A3J H;  2GN5 A;  2A8V A;  1E7Z A;  2R7Z H;  4IFD I;  3ERS X;  1B70 B;  3HOU G;  2JA5 G;  3HOY H;  5IY0 A;  4LUZ A;  3JAM c;  4WJ4 A;  4A3K H;  4DR2 L;  3W5O A;  1GM5 A;  4TQU S;  1VQO A;  1YNX A;  2JA7 H;  3S1Q H;  4YY3 L;  1IBL L;  1PA6 A;  4IO9 A;  4JYA L;  1PV4 A;  4LFB Q;  3G4S A;  2N49 A;  2RCN A;  2C35 B;  4Y7N H;  5IWA Q;  3CCJ A;  4EQ5 A;  4LF8 Q;  2GVA A;  1VQB A;  5IYD H;  3HOV G;  2JA9 A;  1VQ6 A;  1KIX A;  3PV0 A;  1NMF A;  2UUB L;  1HZA A;  4A75 A;  1PFS A;  1EQR A;  4WJ3 M;  4C3I H;  2QA4 A;  2F4V L;  1EYG A;  1QZG A;  3CPW A;  2Q2H A;  4HJA A;  2VUM G;  5FJ8 H;  4Y52 H;  1A0I A;  1Q12 A;  3TRE A;  1HR0 W;  2V1C C;  2Z6K A;  3K0X A;  1A63 A;  2QGQ A;  1S40 A;  2UUA L;  1WOC A;  2ZJR A;  1TWG H;  3EIV A;  1FJG Q;  3CCQ A;  1MJE A;  3G71 A;  3NEM A;  2VQE L;  1VQN A;  5IP9 H;  1YBY A;  4A3C H;  2JA6 H;  4JI4 Q;  1Z47 A;  3AFP A;  4RMF A;  3L2P A;  3GTO H;  3ICE A;  3TS2 A;  3HOZ G;  2AHO B;  1SRU A;  3GD7 A;  4YWK A;  4A3F G;  2LXK A;  1Q82 C;  1VCI A;  1PH8 A;  1Y14 B;  1NBW A;  1X3E A;  3HOX H;  4DV2 L;  1VQH A;  3CCM A;  3M4O H;  2Q2U A;  1QVC A;  1HZB A;  4P73 A;  5ELO A;  3CW2 C;  3S24 A;  4YHH L;  2BH2 A;  1WI5 A;  3TEH B;  1V9P A;  3EN2 A;  3S1N H;  4BBS G;  4JI5 L;  2JQO A;  1Y1W H;  4KLK A;  1XNR L;  1CKO A;  4BXX G;  4OX9 Q;  2ID0 A;  2IX0 A;  3OYY A;  4DR5 Q;  1N33 Q;  3IRB A;  1I94 L;  1PHJ A;  2DGY A;  3TQY A;  2JEA I;  5GAG C;  1KXL A;  3GO5 A;  4A4I A;  1PH9 A;  2UUC Q;  1B7Y B;  1VQM A;  2MNA A;  1KRT A;  2ALY B;  4A3E H;  1PH5 A;  2UXC Q;  4HIM A;  5K36 G;  1G6P A;  4A3M G;  1JE5 A;  4JI8 L;  1Q86 C;  3AYH B;  1J6Q A;  4LF5 Q;  1HNW L;  1P16 A;  4UP7 A;  3ULL A;  3U4Z A;  4LFA Q;  3UDI A;  5C0X G;  3W1B A;  2ZTC A;  4OWW B;  1GKH A;  1I50 H;  1OTC A;  1JT8 A;  3A5U A;  2CWA A;  2K5V A;  3J80 c;  4A3J G;  4GLV B;  4IPD A;  4DR1 Q;  2NVT H;  2VY3 A;  2R92 H;  1X6O A;  2R7Z G;  1SE8 A;  4XTC S;  4HIO A;  1YJW A;  2WAQ G;  2WAQ E;  2Z0S A;  4QY7 A;  4LUO A;  2VQF L;  3CCR A;  4JYA Q;  2WB1 G;  2WB1 E;  1XJV A;  4DR7 Q;  2JA7 G;  1CKN A;  1XPO A;  3A74 A;  2MO1 A;  1M90 C;  1TWC H;  3E9I A;  5HY6 A;  3ULP A;  1WCM H;  1KAW A;  1BVS A;  3OTO Q;  3H15 A;  3A5Z B;  5IWA L;  2VS1 A;  3I4M H;  3D0F A;  5C0X I;  1XNQ L;  1EWI A;  1SN8 A;  4EX5 A;  4LF8 L;  2UUB Q;  1G51 A;  1TWF H;  5M3M G;  4A3G G;  5GRO A;  2RF4 A;  2N3S A;  3BZC A;  1LYL A;  3KOJ A;  2F4V Q;  1N32 Q;  1B8A A;  1WJJ A;  4AQY Q;  4O0A A;  5GAE C;  1FVI A;  4JI3 L;  1JJC B;  3PUY A;  5FJ8 G;  2R6G A;  1VQ7 A;  4DR3 Q;  3STB D;  2CWP A;  4GNX C;  5JJK A;  5EAY A;  4DNI A;  1KD1 C;  1ASZ A;  1FJG L;  4NB3 A;  5JEA J;  2HT1 A;  5IP9 G;  1Q1E A;  3M9B A;  1QZH A;  4A3C G;  4JI4 L;  4UP8 A;  4LF4 Q;  2YTY A;  4RG1 A;  4LF9 Q;  2K5N A;  3E9H A;  4J15 A;  5FLX c;  3DM3 A;  2NVY H;  4ALP A;  4GLX A;  3I2Z A;  4HID A;  5C4X H;  3J81 c;  1YVC A;  3G48 A;  2ATW A;  3M4P A;  1FL0 A;  5GQO A;  2AKW B;  3PUW A;  4YCU A;  4YHH Q;  1NMG A;  4APV A;  4DK3 C;  4JI5 Q;  3J7Z C;  2NN6 G;  3RNU A;  3T1Y Q;  3UE0 A;  1XNR Q;  3MXN B;  4A3I H;  2D0P A;  4OXP A;  4HJ9 A;  2K50 A;  1Y1W G;  4KHP Q;  3KF8 B;  2YTV A;  2E8G A;  1G29 1;  4OX9 L;  1N33 L;  1HH2 P;  1K0R A;  1TWH H;  1WYD A;  3M7N A;  4OON A;  4GOP A;  1N8R C;  4X62 L;  1S72 A;  4LF7 Q;  2UUC L;  4C3J H;  3GTK H;  3K80 C;  4L5R C;  1A8V A;  4MZ9 A;  1GO3 E;  4YCW A;  1X3F A;  4YWM A;  4DKA C;  2L15 A;  1SR3 A;  5C44 H;  2R7F A;  4R1J A;  2KCM A;  2IHE A;  2PI2 A;  5M3F G;  2Q2I A;  1L2F A;  4B3T Q;  3I7F A;  2R7D A;  3CCU A;  4GOP B;  4JBK A;  4LF5 L;  1VQ5 A;  4LFA L;  3CME A;  4GS3 A;  2NN6 I;  4JBW A;  1KC8 C;  1A62 A;  4K0K Q;  4GN4 B;  2CKZ B;  1LTL A;  4DR1 L;  4LW1 A;  2VQF Q;  1EUJ A;  4PG3 A;  3H3V H;  4QQB X;  3M85 A;  1OXU A;  1XTD A;  3F8T A;  4DR7 L;  1K73 C;  1RIP A;  1K8G A;  1LUZ A;  4L5T A;  1XNQ Q;  2R93 H;  3OTO L;  3A0J A;  3M3Y H;  1N34 Q;  2I0Q A;  1IBK Q;  1XMQ Q;  1MKH A;  2MQH A;  3ZJY C;  3I56 A;  3I4M G;  4P72 A;  3K7U C;  2CQO A;  4PZ8 A;  5LMU Q;  2JA8 G;  1GD7 A;  1MJC A;  1YI2 A;  2AWN A;  1YJ9 A;  1VQ8 A;  2RHS B;  5IE8 A;  3PO3 G;  1YEZ A;  1FGU A;  1N32 L;  4AQY L;  4JI3 Q;  3PIO A;  4IFD J;  4JC0 A;  4LFC Q;  4DUY L;  3S2H H;  4LNQ A;  5AJ3 Q;  1VQA A;  4DV6 Q;  2B63 H;  3GTM H;  3S1M H;  4DR3 L;  3M4Q A;  1JJ2 A;  1XMO Q;  2NVQ H;  1YHQ A;  1C0A A;  1SLJ A;  3BZK A;  1T9H A;  3L7Z C;  3F2B A;  1LM0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...