1HR0L

Crystal structure of initiation factor if1 bound to the 30s ribosomal subunit
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
124
structure length
124
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of an initiation factor bound to the 30S ribosomal subunit.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 16
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2000-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1hr0L00
4B3SQ 1N33L 1G6PA 3J81i 4B3TQ 1HZBA 3HOYG 2VS1A 3A74A 4B3RQ 3SGIA 1YVCA 1VQBA 1M1KC 3MEFA 3M4OH 1BBWA 3CCQA 2OTLA 1X3FA 3STBD 1EIYB 3M4QA 4LF8Q 3HOVH 3FKIG 4DV2Q 3PO2G 5IT9c 1YJNA 2RF4A 4A3GG 1HNZQ 1QZGA 4JI0L 3CCVA 1XNQQ 4R1JA 4GN5A 1R9TH 3UE0A 4DV1Q 4B3TL 3TEHB 3OTOL 4AH6A 1CSPA 5FLMG 5C3EH 4WJ3M 2WAQG 3AQQA 1GD7A 3T1YQ 5IP9H 1VQNA 1VQ6A 4GNXC 1TWGH 4A75A 4B3ML 3HOWH 5IY0A 5C4JH 2NVQH 5C0XI 1VQ7A 1I3QH 2BA0A 1A62A 1UEBA 4XTCS 4YY3Q 5AJ3Q 2NZOA 3W1GA 4A3BH 1V1QA 3ULJA 2UXDL 1HNWL 2VY3A 2VZAA 4L5QA 4PZ7A 3L2PA 2Z0SA 2PQAA 1A0IA 5J3BA 2NVXH 4JI5L 4HJ9A 3ICEA 2ASBA 5C44H 1JMCA 1VQLA 4AIMA 3G48A 5M3FG 5JEAJ 1JJ2A 2E2JH 3KF6B 3G6EA 5M5WH 1N32Q 4P75A 5LMUQ 1VQHA 2K5NA 2K4KA 3RR5A 3KJOA 3HOXH 4LF6L 1VQDA 1EYGA 3ERSX 1I5FA 1GM5A 3AFPA 4JBKA 3RNUA 4J15A 4LF9Q 1YITA 5IP9G 4H02A 3K0XA 1Q86C 3K81C 3D31A 4JI3Q 2VQFQ 1QVFA 5IE8A 4Y52H 1EFWA 5IP7G 5M3MG 1KHIA 4ALPA 4O0AA 3CAMA 3PUXA 2JQOA 3HFZB 1VQJA 2D62A 5GAGC 2IHFA 5JJIA 3ZJYC 1T9HA 1PV4A 1X3EA 2JA6G 3KDFB 2F3IA 4YWLA 4JI0Q 4DR7L 3TS0A 4IFDJ 3KF8B 4XIGS 2UUCQ 4DV4L 4P71A 1N34Q 3CCEA 3S1RH 2AWOA 1HZ9A 2Q2TA 2YV5A 4IOCA 3TQYA 5ELNA 1PH7A 2Q2UA 4B3SL 4LF7L 1N33Q 3VDYA 2ZTEA 4B3RL 4A3CG 4AQYL 4IO9A 3HOYH 4APVA 3J80i 1U0LA 4JI1L 1JB7A 1KD1C 4UPAA 1KQSA 2LXKA 4LUVA 4UY8C 2JA8G 2R7ZG 4K0KL 1KXLA 4QL5A 1EOVA 2IX0A 1OXTA 4GOPB 2GN5A 3B6YA 2WFWA 4BBSG 3I4MH 1SROA 2ZM6L 4GKJQ 3HOUG 2DUDA 1SLJA 1H95A 2E2IH 3S16H 3CCSA 1IBML 5JJKA 2GVBA 4A3LH 4TQUS 5IYBG 3PUVA 4X65L 4QY7A 1K9MC 1A63A 4DV0L 4LFBL 3I4OA 1MJEA 3S1NH 1SMXA 1X3GA 3ER0A 1OXUA 2BA1A 2KENA 4A3EH 1EQQA 2JA7G 1YNXA 4C3IH 4LF5Q 1CKNA 1SR3A 4R4IA 4X62L 3UDIA 1IBLQ 4OX9L 2D0PA 4POFA 2R7ZH 1J6QA 2PI2A 4R4CA 4BY1H 2E8GA 2HIVA 1WYDA 3PCOB 2F52A 2VL6A 2K14A 1G291 4A76A 3HOXG 1YIJA 2ALYB 2I5HA 4LFBQ 1BVSA 3UE1A 1QVGA 1JJCB 2WP8J 4LF4L 4DR6L 4YHHQ 1GKHA 3DLLA 2AHOB 1LYLA 2Y0SG 3GD7A 2UXBQ 3I4NH 2BH2A 1J5EL 2C35B 4GN4B 3RZDH 2QEXA 1HNWQ 2LXJA 4DR5L 4YCVA 4X6AH 3K8AA 3A0JA 5IYCH 1L1OC 1GVPA 1MKHA 3KLWA 5M5YH 3M85A 1K73C 4IPHA 1N34L 2IY5B 5FLMH 4JI3L 2CCZA 3F8TA 1RIPA 1OTCA 1VCIA 4RG1A 2L15A 3U50C 4C3JH 2R93H 2RHSB 3EN2A 4MTNA 1Q7YC 1O7IA 1J5EQ 2MFIA 1MIUA 2NN6I 4LW1A 1PH2A 1L0WA 4GLAC 4BY1G 2ZJQA 3STBC 3JAMi 2A8VA 4IPCA 1TWCH 3UDGA 3E9HA 3J81j 1I94Q 1CSQA 3H0GH 5M3FH 4DR2L 1Q8KA 4GNXA 3JC66 4GOPA 4NXMQ 1P16A 3GTPH 1HR0W 4PZ8A 1XMOL 3G4SA 5IWAQ 3U4VA 3UDXA 4JI8L 2FXQA 3PIPA 3G71A 4DAMA 1VS0A 4HJ5A 1C7YA 2R92G 4JV5Q 4JI2L 2BH8A 2JA6H 3GTLH 4JYAL 4KHPL 3PV0A 2Z6KA 1XPUA 4GOPC 1A8VA 4QGUA 1S40A 1JE5A 3FHWA 4BBRH 1K3RA 2R6GA 1BKBA 4RMFA 3S2HH 2I5MX 3I7FA 2ES2A 4EQ5A 3A5ZB 4JI2Q 2GVAA 1C0AA 1L2FA 5BR8L 4A3LG 1PVOA 1X65A 3E9IA 1EQRA 2K5HA 1AH9A 2RHQB 4DV1L 1HZAA 2UUBQ 2UUAL 1XNQL 3FKIH 1HNXL 1Y1WG 2UXCQ 2WB1G 4LFCQ 5DLQE 1E1TA 2XGTA 4C2MH 2ZJRA 4HIDA 4YY3L 4YHHL 3ULPA 2E2HH 1WOCA 3RLFA 4LF4Q 4DR6Q 2MO0A 3RN2A 1D7QA 1PYSB 3F1ZA 4GKKQ 1PH5A 2F4VL 3I2ZA 3RLOA 2UUBL 4JI7L 1LM0A 1X56A 1Y1VG 1YEZA 2VNUD 4IPDA 4KLKA 2NVYH 3I4MG 3CCJA 2I5LX 4DUYL 1D8LA 4NPSA 2B63H 1NMFA 1SE8A 4DR5Q 3CC4A 4JI6L 1UE5A 3T1HQ 1ASYA 2CQOA 1VQ9A 2UU9Q 3BZCA 4EX5A 2PQAB 2OQKA 4A93H 3I56A 1Z9FA 2JEAI 4NB3A 5FJ8H 1PHJA 4JYAQ 4A3GH 3OW2A 1VQEA 1L1OB 3M3YH 4KHPQ 2UXBL 2N8NA 4GNXB 3TRZA 3EBEA 1KL9A 3H0GG 1X9NA 3CCMA 2IHEA 1FJGL 5JEAG 4A3MG 3LGJA 4JI5Q 2KHJA 3I55A 1QVCA 4IJLA 2AWNA 1I6HH 1N8RC 3IRBA 4BXXG 4A3IH 1PH3A 1ASZA 1HR0Q 3U4ZA 1B7YB 1NBWA 4JOIC 2JA7H 2K52A 1W2BA 1IYJB 1CKOA 1IZ6A 4JCVE 3CF5A 1V43A 4DV7Q 4WJ4A 4OWTB 1OXXK 2WB1E 1S3OA 3K7UC 1N36L 3CQZH 4O2DA 2B63G 4DUYQ 4PMWA 1C9OA 4R4QA 5IYCG 1UE1A 1TWAH 2EXDA 1KRSA 3OYYA 2IT1A 2A19A 4JI1Q 5C4XG 2Z6KC 4AQYQ 3F2BA 4QQBX 4DV5L 3J81c 4HJAA 2I0QA 5C44G 3NEMA 2UUAQ 4IOAA 1Q46A 3H3VH 5IYDH 1E24A 4A3FG 2UUCL 3KYHC 1KIXA 1X54A 2A1AA 1P8LA 4P72A 1EWIA 1W3SA 1EUJA 5C4XH 4DV3L 4A3JH 3S2DH 2HHHQ 2MNAA 2YTYA 3CPFA 2Q2HA 4OX9Q 5JJLA 4LWCA 4DK6C 5IYBH 3PF5A 1PH9A 1JT8A 1HH2P 3PSIA 3S14H 1DGSA 4AYBE 3KF6A 2K50A 4IFDI 2CKZB 3RLNA 3M9BA 5IP7H 1FJGQ 2VUMH 3BJUA 3DM3A 4A3EG 4A93G 4DNIA 4BBRG 1XPOA 4DPGA 1TWHH 4X65Q 1IBMQ 2UU9L 3S15H 1AE2A 2VQEL 1QUQA 3HOZH 4HIMA 4DUZQ 2JA9A 1VQOA 1NJIC 4L5RC 3D0FA 4JV5L 4IPGA 1IBKL 1Q82C 3CCLA 2Q2IA 4JOIA 4A4IA 1HNZL 2NVTH 1JJGA 3H15A 1XMQQ 2AMCB 1E3PA 1XNRQ 3L0OA 4GLVB 4C3HH 3AYHB 2H5XA 2JA5G 4A3DG 4OONA 3PF4A 4DR2Q 3W5OA 1M90C 4A3CH 3GDEA 4A3JG 2Y0SE 2JK8A 4PG3A 4DKAC 3CC7A 3CCRA 4YCUA 4LF7Q 1OXVA 2D0OA 4JG2A 4A3KG 4Y7NH 4DV5Q 2KBNA 4DK3C 2CWPA 1I50H 1N9WA 2CFMA 1VQPA 2OTJA 1VQMA 1IL2A 3J80c 1IXRA 1S72A 3K80C 4JI4Q 4B3MQ 2N3SA 1E1OA 2K5VA 1NY4A 2HIXA 2MO1A 5EAYA 1E7ZA 1YI2A 2ZJPA 2YU9H 3S1QH 3L7ZC 3CMEA 1EIFA 3GTKH 1WJJA 2V1CC 2YTXA 2ZTDA 2ID0A 2PNHA 5E7NA 4DV2L 3F2DA 4HIKA 1PYBA 3GTMH 1YBYA 1YHAA 2PI2E 4R4TA 1PH1A 4LFCL 4X62Q 4A3MH 1IBLL 2R92H 1L1OA 1PFSA 1WFQA 4TVAB 1CKNB 1LUZA 2OQ0A 1Q12A 2XTIA 4PZ6A 4DUZL 1G51A 1BBUA 3HKSA 2EIFA 1Q1EA 2LSSA 4X64Q 1KC8C 2HHHL 4NXML 4NXNQ 3KFUA 1GO3E 5GQOA 1VQCA 2R7FA 4JBWA 1XMQL 4ME3A 4P73A 3FP9A 4LUZA 4YWKA 3GTJH 4JBMA 2OWOA 3S17H 4YCWA 4GKJL 2UXDQ 5K36G 3RN5A 3HOZG 2RCNA 2IX1A 1Q81C 1XJVA 2KHIA 4JI6Q 4DV6Q 3AEVA 2R93G 2OCEA 3CP0A 2NZHA 3KDFA 5M5XH 3PIOA 2VQEQ 3PUZA 3CC2A 2KCMA 4NXNL 3M7NA 3S24A 4OO1G 4BY7H 1SFOH 5IWAL 4POGA 3K7AH 4AYBG 1K83H 3PO2H 3HOVG 4GKKL 1UE7A 1MJCA 2F4VQ 3MXNB 3PO3H 1HJPA 4DR4L 4DV4Q 3W1BA 1YHQA 4JI4L 2B29A 4LFAL 1XTDA 1Y1VH 4LF9L 3PUYA 2E5LQ 4A3FH 4DR3Q 3Q8DA 4IFDG 2PMZE 2MQHA 1HZCA 1XNRL 3GTGH 2AKWB 4L5TA 4DR1Q 4LUOA 4DR4Q 4BY7G 4BA2I 5ELOA 4UP9A 5LMNW 1IBKQ 4DR7Q 4LF5L 5IYDG 4A3BG 1N36Q 5FJ8G 2B3GA 1YZ6A 3HKZG 3J7ZC 4X66Q 1VQ4A 3J7A5 2VUMG 3CCUA 4R4OA 3PO3G 5C0XG 3U58A 1TXYA 1NE3A 2QGQA 1YJWA 1Y14B 3HOWG 3UDFA 1U5KA 3BZKA 1HR0L 1X55A 2KCTA 4FDBA 1UE6A 2YTVA 4IJHA 1PA6A 4X64L 1SRUA 5GADC 4BBSH 5HGQA 3HOUH 1CUKA 2HT1A 4KHZA 3ULLA 3S1MH 3JAMc 3TS2A 5LMNL 1VQKA 3PUWA 1AE3A 1SN8A 1I94L 3CW2C 2N78A 1WCMG 1VQ8A 3H3VI 1LTLA 2JJQA 2JA5H 4A3DH 4DV3Q 5FLXc 2K75A 4DR1L 4MZ9A 2HQLA 3GO5A 1KRTA 4LNQA 3KOJA 3PGZA 4DV0Q 1XPRA 3E0EA 1NTGA 4OWWB 1WI5A 4LFAQ 4P74A 3OTOQ 1QZHA 5GAEC 3F2CA 1FVIA 1RL2A 5C0XJ 3T1YL 4X66L 4BA1I 2ZM6Q 2JEBI 1VQGA 1OXSC 5H1SE 5GROA 4GS3A 1YHBA 4HJ7A 2DGYA 5C3EG 4JC0A 1V9PA 2N49A 1K0RA 3TREA 4DV6L 3T1HL 4DAYB 3NBHB 4GLXA 3CMAA 2NN6G 3BU2A 4A3KH 2JA8H 2ZTCA 1NMGA 4HJ8A 2UXCL 4DV7L 1K8GA 3CXCA 1HNXQ 5HY6A 4HIOA 2VW9A 2E5LL 1WCMH 1Z47A 1Q1BA 4QIWE 4YWMA 1YJ9A 3HKZE 3NENA 1Y1WH 1PH8A 3CPWA 4DR3L 4L5SA 3GTOH 4BXXH 4A3IG 5GAHC 4LF6Q 1PH6A 2YYZA 1VQFA 3EIVA 4KI0A 4JI8Q 1VQAA 1PH4A 1TWFH 5BR8Q 2ATWA 5AJ3L 5LMNQ 4OXPA 3NELA 1FL0A 4UP8A 4JBJA 1KAWA 1QUQB 2VQFL 1E22A 5M3MH 1B70B 4OWXB 1UWVA 3M4PA 2QA4A 4QJFA 1K8AC 2EQSA 1VQ5A 2CWAA 2WAQE 1N32L 1B8AA 3AFQA 4GN3B 3KJPA 3GTQH 1X6OA 2JE6I 4K0KQ 5LMUL 3CD6A 4JI7Q 4OO1I 2R7DA 1FGUA 1VQIA 4LF8L 1XMOQ 3A5UA 4UP7A 4MNOA 3I4NG 3WWVA 3RZOH 1CKMA
chains in the Genus database with same CATH superfamily
3J80E 4B3SQ 4G4KA 4FF3A 5IT9E 4G7OC 2A68C 5CV8A 4ZKCB 3FKIB 1AEXA 3M4QA 4K2LA 4BBRB 1FGBD 5JVH3 1RTNA 4U68A 1ZEQX 1CSPA 5FLMG 1Z6HA 4TRDA 3AQQA 5C3XA 4QMGA 4WRDA 1VQ6A 4PMBA 3NTKA 1PTOH 1LTTD 3OMGA 4NW2A 1I3QH 4YY3Q 3OHXC 4A3BH 3ULJA 2UXDL 2F0EA 2QDBA 2PQAA 2EE1A 5J3BA 4DAPA 3I70A 4HJ9A 3S9WA 1VQLA 5M3FG 1UUPA 3KF6B 3HGBA 4IZ8A 1QILA 3KJOA 4CHTB 3ERSX 4J15A 3D6WA 1PFNA 4HMIA 2JA7B 3K0XA 4JI3Q 4ODGA 1YNJD 5IE8A 1EFWA 4O0AA 2QEJC 5E4XA 4XYOA 2JQOA 5CYUA 2D62A 1EY4A 2IHFA 4PNYA 4YWLA 4ZQ3A 4O42A 3TS0A 4XIGS 1I6VC 4P71A 4DV4L 1N34Q 3S1RH 1H9MA 1FR3A 4IOCA 1JE4A 2SEBD 1PZJD 2Q2UA 4B3SL 3DM1A 3MXNA 4LF7L 2ZTEA 2NVXB 3HOYH 2R7ZG 4K0KL 1KXLA 2H1EA 4QL5A 1DZ1A 1LTID 3V2TA 4BBSG 1SROA 1CZGA 3CCSA 5JJKA 1KLUD 2GVBA 4B9WA 5IYBG 1V8QA 1LACA 1X3GA 2KENA 2EPBA 3ER0A 4JV5L 1YNXA 4X62L 3EA6A 4KN4C 3UDIA 1TQOA 1J6QA 1UNSA 1BCPD 1ICFB 4R4CA 5I9PA 1PRTB 3D6CA 2K14A 1G291 5T1GA 2I07B 3HOXG 4RGNA 3PO3B 3UE1A 4LF4L 1JJCB 4IN3A 3K58A 4YHHQ 1GKHA 3DLLA 1LYLA 4BY1B 1RKNA 2I46A 2RDGA 4DR5L 4X6AH 4YCVA 5T1IA 2QF7A 1N34L 2IY5B 1KAAA 5FLMH 4JI3L 2CCZA 2QKIC 2R93H 2RHSB 4MTNA 3ND9A 1O80A 1H9SA 3F2UA 4RFBA 2HD3A 1WVLA 4BY1G 5JOBA 2F3VA 4IPCA 1TWFB 2DJFC 3J81j 1CSQA 1KLGD 3GTLB 1W6KA 4K8JA 4GOPA 1P16A 4UDUC 3G71A 3U4VA 1SJHD 1AZQA 2R92G 1VS0A 4JV5Q 5K5PA 1TWAB 1BNZA 3NTIA 3GTLH 2ICEC 4KKSA 2Z6KA 2XSCA 4GOPC 1A8VA 4IUPA 1K3RA 2K04A 1DD2A 4RGMA 1TS2A 2R7ZB 2ES2A 5C0XH 2G5DA 5EBDA 5K36H 3A5ZB 5EPJA 2GVAA 2XIWA 4DNTB 4DV1L 2DY7A 1EQVA 4PMCA 2F0KA 1V1OA 1NNXA 3D4WA 4LFCQ 5DLQE 1R4QB 4HIDA 3RZDB 2KEEA 4HSPA 1WOCA 2SDFA 1PYSB 3QB3A 4PV1C 1PYWD 2K1BA 2F4VL 3I2ZA 1RDPD 4X3SA 5M5XB 4CGYB 4WJWA 5EPLA 4KMUC 3NK9A 1QJOA 4LJZC 1SNCA 3KBXA 1I50B 4JI6L 1UE5A 4A3BB 1GUGA 4EX5A 4A93H 3SDZA 5CBAE 1BBXC 2JEAI 2N88A 5IGGA 3GV6A 5KYIA 3JAML 1L1OB 3OW2A 4A3GH 4H0LC 1PTOC 4KKTA 2X6LA 4K8IA 1FJGL 4JI5Q 1WD0A 4IJLA 2AWNA 4A3IH 2PO4A 1NBWA 2JA7H 4A3FB 2QW7A 1IYJB 1SYDA 1V43A 5EKLA 2WB1E 4O2DA 4PMWA 3NP8A 3VA5A 1UE1A 1TWAH 3K5LA 3OYYA 4X3KA 2HCIA 3K0YA 3S16B 4QQBX 1B2TA 4C1NI 4HMJA 1X3PA 3TZDA 5CMDA 4IOAA 4IFDH 4A3FG 3K5MA 3KYHC 3I91A 3D4RA 5C4XH 1R9TB 3GTMB 2YTYA 1IL8A 3BG3A 1QE6A 3PF5A 1JT8A 3PSIA 4CBVA 1DGSA 2EY2A 1PMRA 3T56B 3RLNA 3M9BA 1FJGQ 4DNRB 1EIGA 4DNIA 4BBRG 5ELEA 4G7HC 1XPOA 4DPGA 4X65Q 3HOZH 3VYSA 1CHPD 3DWPA 1XXGA 5M5YB 1IBKL 1Q82C 4AYBB 4A4IA 1GUTA 2AMCB 1E3PA 1SJED 1XNRQ 3QG1A 1QNUA 4QF4A 4QIWB 4A3CH 4ILWA 1QG7A 5A2QE 3CC7A 4LF7Q 1OXVA 1GJXA 1PRTF 3EVQA 2KBNA 1N9WA 2CFMA 5M3FB 1LABA 3HRZC 4C3JG 1VQMA 1NR4A 1IL2A 5J39A 5IGEA 1D1IA 3K80C 2A69C 4RCNA 2HIXA 4LK1C 1C8CA 3S1QH 3L7ZC 1PZID 2XRSD 2RSNA 2YTXA 1DM0B 1K3BC 2ID0A 3F2DA 1B4OA 2PI2E 3D3RA 2A74C 4LFCL 4X62Q 4A3MH 2PQEA 3M4YA 4TVAB 1ET9A 1WFQA 1G6ZA 2DNEA 3MXPA 2OQ0A 4FO2A 3WDNA 1BBUA 2LSSA 1Q1EA 3OIPA 4NXML 4YIJA 2HHHL 1QWYA 2O2LD 2R7FA 4JBWA 3BDCA 1XMQL 2KOLA 4DGZA 4YWKA 5K36G 2UXDQ 5C4JB 5FLXL 5BN3A 3RN5A 3HOZG 1CQVA 4JI6Q 1XJVA 1WTRA 4KJNA 3CP0A 3CC2A 3M3YB 3PUZA 3S24A 2FMCA 4BY7H 4POGA 1MJCA 2F4VQ 3MXNB 1PRTC 4N8X1 3PO3H 1I4QA 1JCKB 4DV4Q 4LAAA 2EJFC 3W1BA 2DJGC 4JI4L 3S2DB 2E5LQ 1CT1D 3HEJA 1MSGA 3Q8DA 1I4PA 5E3FA 1DOMA 4L5TA 3NBIA 1SXTA 2KA7A 1T5EA 4BY7G 1Y69U 2IL8A 4LF5L 1TS4A 1PTOF 1TY0A 3Q23A 3HOUB 3Q22A 4K6LA 5ISRA 1HUNA 4BS9A 4IALA 2KCTA 5JJZA 5F2DA 4XT1B 3HOUH 3ULLA 4OEMB 4OIJA 3FVQA 1VQKA 1K8OA 4A3IB 1I94L 1VQ8A 1ENCA 2QDLA 4PQXA 5E1FA 5FLXc 2K75A 1EWHA 3GO5A 2EOTA 4C1NK 1NUCA 1Q8IA 3M4OB 2MGSA 4LFAQ 3MFYA 3OTOQ 4HTHA 2PCFB 3F2CA 1QZHA 4DXFA 1HUMA 4KY7A 5JVG3 1STEA 2Z8LA 3VYTA 1VQGA 5GROA 1YHBA 2N49A 1K0RA 2L11A 2P5ZX 4GLXA 5CV7A 1Y8PB 2F1MA 4A3KH 1F9RA 4HSVA 4KY6A 2ZTCA 4HJ8A 2E2JB 1J9OA 4HIOA 2E5LL 1D6EC 4V190 1Z47A 1Q1BA 1K83B 3HKZE 2G9HD 3OSOA 1H9SB 3VYUA 1Y1WH 3GTOH 5EQ0A 3S17B 3N6RA 1ZYRC 2M9VA 2F0WA 2F0FA 3NWSA 3EIVA 1IW7C 5BR8Q 5IODA 3W2DA 5I6YA 5ELCA 3GTOB 2AUKA 4IUNA 4UP8A 3BS1A 2G9DA 2VQFL 1B70B 1B9MA 1CQFA 3PIO3 1QNKA 3HS0C 1K8AC 1VQ5A 4FP5D 5I4DA 1D5MC 2JE6I 4K0KQ 1I4HA 4OO1I 2B39A 2R7DA 2Z1CA 4LF8L 1BQQT 1RHPA 3WWVA 1HNXL 4F87A 3HOVB 4OIKA 4B3TQ 4B3RQ 1M1KC 4RA8A 2RDHA 5CGKA 3HOVH 2A6HC 1HNZQ 2F0VA 1QZGA 4JI0L 3CCVA 3UE0A 4DV1Q 3OTOL 4AH6A 2E75C 5C3EH 2YU9B 4BBSB 2BDOA 1VQNA 1EL0A 3HOWH 4RGOS 2KCNA 5IY0A 2NVQH 5C0XI 2MPMA 1VQ7A 4KHVA 2R3ZA 2F3WA 2XRQD 3BYYB 4L8JA 5AJ3Q 1V1QA 4DF7A 4L5QA 3VA7A 3L2PA 2GA4B 1A0IA 4JI5L 3MAQA 3ICEA 4JPBW 2ASBA 1BXTA 1JMCA 4AIMA 1VMPA 3G6EA 5LL6X 4P75A 2K4KA 2K5NA 3FDTA 3RR5A 3QO2A 4LF6L 3LNNA 2KHSA 4CJ2C 5I6WA 5G3LD 3MXGA 4HR7B 1YITA 1CA5A 3K81C 1J8IA 2VQFQ 1QVFA 1STYA 5M3MG 1EYCA 1KHIA 3BDOA 5D3IB 3PUXA 3NXWA 1VQJA 5GAGC 1JR0D 1SNDA 1T9HA 2F3IA 4A93B 1E2WA 1S5FD 2KEDA 3CCEA 3GTKB 2AWOA 2Q2TA 2EY6A 2PMZB 1N33Q 3VDYA 2F0JA 2ZT9C 4AQYL 1KTKA 1CK1A 2RQXA 1U0LA 2IWHA 1KQSA 4LUVA 5J22A 1BDOA 1EOVA 2IX0A 2WFWA 2WAQB 3A8JE 2F0QA 3B6YA 1U4RA 3JAME 1SLJA 1H95A 2E2IH 1F77A 4HAEA 4KV6A 4KD3A 2A68D 3PUVA 2CW0C 4QY7A 4DV0L 4LFBL 3VR3A 3CHBD 2WV6D 2JA7G 4KD4A 1EQQA 4C3IH 5C4XG 4OX9L 4POFA 2F03A 2PI2A 2N55A 3QJYA 1RJTA 4BY1H 2HIVA 2O5JC 2F52A 1ZXTA 4IUQA 2D5DA 1YIJA 4LFBQ 1WTHA 1VF5C 2VUMB 2Y0SG 3EFXD 2A73B 1TWGB 1J5EL 2C35B 1II3A 1KABA 4XQJA 3A0JA 5IYCH 4BY7B 1L1OC 3A56A 1CHQD 4DFAA 1OTCA 1RIPA 1VCIA 2L15A 3U50C 4DAVA 3EN2A 1O7IA 2ICIA 1IW7D 1TS3A 2NN6I 2EYLA 3G6JB 4LW1A 1L0WA 2Y0SB 1F2ZA 5JPMC 1SBBB 3JAMi 5TSSA 1TWCH 2BOSA 3E9HA 1I94Q 1Q8KA 4GNXA 3I3CA 5BN5A 3VR6A 4QCLA 4JI8L 2FXQA 3PIPA 4HJ5A 3M7GA 4MN3A 4JI2L 2EYFA 2B2UA 2Q8RE 3MZ5A 3MEHA 1XPUA 2OXPA 5HGTA 4BBRH 1BKBA 2L12A 5DM73 2DY8A 3S2HH 2EDGA 2VXWA 2VB3X 2WKCA 3VYRA 2CQAA 1C0AA 1L2FA 5BR8L 4A3LG 1KNEA 1UAPA 1EQRA 2K5HA 3Q24A 3W3AA 1HZAA 5M5WB 1R4PB 1Y1WG 1AZPA 3NE5B 1NR2A 1M4VA 4C2MH 1ILQA 2EYHA 3ULPA 3C46A 3RLFA 4BWGB 2DNCA 1D7QA 2K5DA 4GKKQ 4XT3B 2EYJA 3RLOA 1DCZA 1PRTD 3R2IA 1LM0A 4IPDA 4TKOB 4R9WA 2PNRC 3CCJA 2B63H 2R61A 4I65A 1ASYA 4FNFA 2L0CA 1EOTA 2K05A 4V0BA 2OQKA 3I56A 3NTHA 3BVGA 2N8NA 3TRZA 1X9NA 1KL9A 3K57A 3CCMA 2IHEA 4A3MG 1SAPA 3IRBA 4U673 2A6ED 1ASZA 3U4ZA 4JOIC 1W2BA 2O4XA 1CKOA 2K03A 1HQMC 1EWCA 4OWTB 1OXXK 3K7UC 2HDLA 2B63G 4DUYQ 4R4QA 2IJ0A 3MC0B 1KRSA 2A19A 1YNND 3J80L 2Z6KC 4AQYQ 3F2BA 3NHHA 1LTAD 5CV4A 4K5WA 1TKWB 1JOQA 3V96A 4F8MA 1EY8A 4X3UA 3H3VH 5JAVA 1HA6A 1GOZA 5L37A 1X54A 3I4LA 1P8LA 4P72A 4RWSC 1EWIA 1E0BA 1EUJA 4A3JH 1FNUA 2MNAA 3T4AC 5JJLA 3GP7A 5DNFA 4C3HG 3S14H 4AYBE 1PTOB 3KF6A 2K50A 4WFN3 3P1HA 4IFDI 2CKZB 4DN4M 3QOLA 5IP7H 2L1BA 4A93G 1B9NA 2K01A 1CTMA 1LTBD 2F0GA 1QUQA 3J7AF 3MHBA 4HIMA 2JA9A 1SE4A 4L5RC 4DA2A 4IPGA 4G57A 2F0DA 3H0GB 3H09A 1EIHA 2KQ3A 1JJGA 3DXJC 1D5XC 4EVOA 3L0OA 3SK5A 3QOJA 3AYHB 3X3MA 3W5OA 1M90C 1Z7TA 2EZVA 4A3JG 1JWSD 3CCRA 2TSSA 1TIID 4YCUA 2D0OA 4X3TA 4A3KG 4DV5Q 2PZWA 2E76C 3J80c 3RD4A 2J0TD 2CVRA 4Z9CB 3VR5A 1E1OA 1NY4A 5EAYA 1E7ZA 2YU9H 3CMEA 2WB1B 1EIFA 4MHEA 5E7NA 2Z9HA 4EQNA 3OWFA 1YBYA 1YHAA 5D3DA 1IBLL 5JEAH 5IGBA 4A3KB 1MBYA 1W6JA 1G51A 2EIFA 4X64Q 3KFUA 3GTJH 4JBMA 3FP9A 4LUZA 3S17H 3V05A 4YCWA 4F88A 2PZTA 4E6IA 4J8QA 1A15A 1Q81C 2A5HA 4DV6Q 3AEVA 2R93G 5M5XH 4WJ4A 4NP5A 4KY5A 4OO1G 2KJXA 4CKCA 1VDZA 4FVMA 5IWAL 1HFNA 2NZ1D 3R3OA 4JK1C 1HJPA 1D1KA 4LFAL 1SE3A 3OPOA 1XTDA 4IFDG 2MQHA 1D2BA 4N9PA 2AKWB 4ZCKA 1JB3A 5ELOA 4UP9A 5LMNW 1RD9D 3J7A5 2VUMG 1H9RA 3U58A 1TXYA 4RHRA 3HOWG 5ELBA 1U5KA 3BZKA 1HR0L 2OEOA 4BBSH 5GADC 1SRUA 5HGQA 1A6XA 2HT1A 1STGA 3S1MH 5FOBB 4KJOA 3PUWA 1SN8A 1WTWA 3CW2C 3NQTA 1WCMG 3LWEA 4FYDA 5NUCA 1CM9A 2JA5H 3A55A 4Y7NB 4A3DH 2SNMA 4DV3Q 1PTOD 5DEHA 4MZ9A 5G3LF 2B2WA 3I4MB 1KRTA 4LNQA 3KOJA 1SYGA 2SNSA 3TZUA 5I2YA 5A2QL 1WI5A 4RKLA 5C0XJ 3NBHA 3T1YL 3TP5A 4N9TA 4K5VA 2CH4A 4ZKBB 3TMEA 2FINB 1XYIA 4JC0A 4DV6L 3TREA 2WKDA 4DAYB 1ZKOA 1WCMB 3KF8A 3NBHB 3QIAA 3OW7A 1NMGA 1WD1A 2LFNA 1U4MA 3C3LA 2UXCL 4DV7L 1TR5A 4FXDA 2NTTA 2VW9A 2EY5A 1WCMH 2X69A 1PH8A 1QB5D 1O7YA 4DR3L 4A3IG 2RCFA 1EEID 2M00A 1F2LA 1PH6A 4JI8Q 3S1RB 1HPCA 1LV9A 1VQAA 5LL6S 3PMFA 5LMNQ 3L3OC 4XQQA 5AFWA 3FMCA 1FL0A 2NN6H 2E2DC 3GTPB 5M3MH 3TP6A 3M4PA 4QJFA 2EQSA 1O7LA 1KDAA 1B8AA 2PZUA 4GN3B 5M3MB 3GTQH 4JI7Q 1FGUA 1VQIA 4MTKA 3E0JA 1A3VA 3EJIA 1FNWA 5EGTA 5ELFA 3I72A 1GD7A 3J81i 3HOYG 2VS1A 3A74A 3SGIA 1YVCA 1A3UA 1EZ6A 3MEFA 1X3FA 3OMCA 3X3NA 4A3MB 3FKIG 4DV2Q 3PO2G 5IT9c 4A3GG 2XN9C 1XNQQ 4GN5A 1AN8A 3TEHB 2XWJB 2WAQG 3T1YQ 3KK7A 4GNXC 3BZDB 3SEBA 4B3ML 1KDBA 2O5IC 4C56C 1A62A 1UEBA 3P20A 4XTCS 2B63B 3W1GA 4FXKC 4FF1A 2B2VC 2VY3A 2Z0SA 1ONLA 1BF4A 1VF7A 3G48A 4HCEA 5JEAJ 1GUNA 1JJ2A 1HCZA 2E2JH 5FO9B 1TT2A 5LMUQ 3HOXH 1SYEA 3R2TA 1M8AA 1STNA 1VQDA 2NBFA 5CC4A 1EYGA 1IKMA 4C3JB 1L0YB 3AFPA 1C48A 1KDCA 2BE5C 5KEEA 5IP9G 3P75A 3MWYW 5C5LA 4IUUA 4Y52H 2F0OA 3MFGA 5IP7G 2HQEA 4DU9A 3BDLA 5C4HA 3HFZB 5C3WA 4M8AA 3HZXA 1X3EA 1I4GA 4RGTA 4DR7L 2UUCQ 4R8IA 1RODA 2YV5A 5IGCA 3TQYA 5ELNA 1PH7A 2B2TC 3J80i 1JB7A 1KD1C 1HFGA 3TP7A 1ILPA 1K0SA 1S4ZA 2ZM6L 4JW0A 3HOUG 4A3EB 1B50A 2Q8TA 1IBML 3FEWX 4TQUS 1JORA 1G91A 3RZOB 1A63A 3I4OA 1MJEA 1SMXA 5COYA 1OXUA 4A3EH 2F0TA 3Q6SA 4R4IA 3IFDA 2EJGC 1BO0A 2OF1A 1WYDA 2L55A 2VL6A 3I4NB 2K5QA 1F9QA 1ICWA 4A76A 2NVTB 4IFDJ 3H6MA 1BVSA 3TBIB 5CR3A 2AHOB 2WACA 1NCVA 3GD7A 2UXBQ 3I4NH 3SHLA 3GTGB 3RZDH 2QEXA 1HNWQ 2B2YC 3K8AA 1PZKD 5M5YH 2LY7A 3F8TA 3H3VC 4C3JH 4DK0A 2IPKD 4OL7A 1Q7YC 2B2YA 4C3HB 2MFIA 1MIUA 1L0XB 2EYOA 4NDXA 4JVZA 3H91A 2PPBC 1DOLA 1PH2A 3ND8A 3E6ZX 4GLAC 4NMZA 3STBC 3A8IE 2K7VA 4FF4A 2BE5D 3UDGA 4DR2L 4HCSA 1LT4D 3GTPH 1HR0W 4PZ8A 5FK9C 4ZUIA 1CFMA 1XMOL 3UDXA 1C7YA 4KK7A 4M1UB 2BH8A 4JYAL 3EROA 1JE5A 3FHWA 2R6GA 3SK4A 2MP1A 4RMFA 1KNAA 2I5MX 2F0SA 2ZXOA 4DK1A 2E2IB 1PVOA 1X65A 2UUBQ 2UUAL 2NVQB 1XNQL 1SNQA 1Q90A 1SFOB 2UXCQ 3T13A 1S5DD 4CDDC 1E1TA 1JQYD 4B9XA 4YY3L 4YHHL 3HP3A 4LF4Q 3RN2A 3F1ZA 3TP8A 1NAPA 2UUBL 3T51B 4JI7L 1Y1VG 1YEZA 5JPNC 1MHWC 2PW5A 2NVYH 3R8BA 1FD7D 3I4MG 2I5LX 1SMYD 4DUYL 2BDNA 4NPSA 1NMFA 1XX8A 4DR5Q 1BUVT 3T1HQ 1VQ9A 3BZCA 3KLSA 4K6DA 1V1PB 4NB3A 5FJ8H 2F0NA 1PHJA 4KHPQ 3BVZA 1GXDC 3M3YH 4GNXB 3H0GG 3T53B 5DAUA 5JEAG 5I9OA 1YNNC 2MUYA 2H4OA 3HKZB 1CZWA 1N8RC 2B8GA 1SYFA 1HR0Q 1EYDA 1IZ6A 1I6HB 3K6OA 1N36L 3K59A 3CQZH 1C9OA 5IYCG 3GTJB 1BR9A 3NUCA 4P2CB 4KTAA 2JYOA 2EYMA 4FXGC 2IT1A 4JI1Q 3NWTA 3C1EA 1AW7A 5C44G 2UUAQ 1Q46A 1ENAA 5IYDH 4IURA 2EYPA 1KIXA 4XDXA 3ONAB 3SXHA 3S2DH 2AQ3B 2HHHQ 1U4PA 1Y8OB 1SNMA 3CPFA 2Q2HA 4LWCA 1PH9A 1NSNS 5IYBH 1SE2A 1HH2P 4EQPA 1B3AA 4C3IG 2VUMH 3DM3A 4A3GB 2JA6B 1LT3D 1WTPA 1STBA 2K5WA 2EXZA 2VQEL 4DUZQ 1NJIC 1VQOA 3URYA 3CCLA 2Q2IA 4JOIA 1HNZL 2NVTH 2CW0D 3H15A 4IUVA 2PW7A 1EY5A 1PXUA 5FKAC 2H5XA 2DN8A 2JA5G 4OONA 3PF4A 4DR2Q 4A3DG 2Y0SE 2JK8A 4PG3A 4JG2A 4Y7NH 4DK3C 2CWPA 3KLRA 2F0LA 1S72A 1HTPA 2Q8IB 4B3MQ 2F0IA 5FO7B 1SEBD 2K5VA 2MO1A 3G7LA 3GTKH 4HEDA 1WJJA 2V1CC 2ZTDA 3S2HB 1B44D 3ITPA 4HIKA 1PYBA 3GTMH 4R4TA 2F0UA 2R92H 1AP0A 1PFSA 1CKNB 1B3QA 1DONA 1Q12A 2L9HA 2XTIA 4DUZL 3HKSA 3DWQA 5C3EB 4NXNQ 1KC8C 1BCPB 2OT2A 1WTXA 1VMCA 4GKJL 3BYTB 2SOBA 3H94A 5EKIA 4A3JB 2RCNA 1MI2A 2IX1A 3K7AB 2K6AA 3DEPA 2OCEA 3PIOA 2VQEQ 4NXNL 3K5OA 3DWAA 1SFOH 3CU7A 4CDFC 1BCPF 3K7AH 5LHY1 3HOVG 1ESFA 2AUJD 3NSWA 1OO9B 1YHQA 5I2XA 1Y1VH 1LTSD 3I90A 1GUSA 2KVMA 2PMZE 1HZCA 1XNRL 4DR1Q 2QCPX 4I7AA 2EJMA 5IT9L 1B1ZA 2J4XA 5E4WC 4A3BG 4XXEA 5M9OA 1N36Q 4F7XA 3J7ZC 2WINB 4X66Q 3CCUA 4R4OA 1GUWA 2LMCB 2QGQA 1Y14B 1EQTA 1X55A 1UE6A 2YTVA 2F0MA 4IJHA 1PA6A 3SVMA 2AQ2B 4H7BA 3VR2A 5IGFA 1CUKA 1PLFA 4FF2A 5LMNL 2JN4A 5DM63 4RH6A 1AE3A 1AFPA 1DOKA 2N78A 5D14A 2E74C 4ABNA 4WORA 1A2TA 3C2PA 1S5BD 4QB4A 3PGZA 1XPRA 1LTRD 4OGQC 1DJRD 4P74A 2A6EC 5GAEC 1RL2A 4BA1I 1OXSC 4GS3A 4HJ7A 3RUZA 2DGYA 5C3EG 3T1HL 2Z6BA 2FMMA 2LKVA 3DEOA 3IKJA 3EQLC 3CMAA 2NN6G 1G2SA 3BU2A 3J81L 1QCBD 2TMPA 1X32A 2VB2X 3HOWB 3CXCA 2C5CA 5HY6A 4YWMA 1YJ9A 2L5TA 3CPWA 1I4XA 5GAHC 4LF6Q 1BCPC 2YYZA 1VQFA 3FRPB 3CRKC 1STAA 5ELDA 1TY2A 4OXPA 3WOEA 3OIQA 1QUQB 1E22A 4OWXB 1UWVA 1EY0A 4CJ1B 3AB9A 3VR4A 5CV5A 4IUTA 2CH4W 3KUPA 2WIIB 1N32L 1O78A 3KJPA 2HDMA 2A6HD 5LMUL 3DHQA 4Q0FA 2B2TA 3A5UA 4MNOA 1CKMA 2NVXH 2RKSA 1N33L 1G6PA 1HZBA 3K5NA 2NTSA 1VQBA 4C3IB 3M4OH 2QILA 1BBWA 1H9JA 5CV6A 2MHVA 3CCQA 2J7ZA 5FLXE 2OTLA 1IYUA 3STBD 1EIYB 4LF8Q 1YJNA 2RF4A 1E2VA 1EU4A 2PYKA 3E5SA 4R1JA 1R9TH 4B3TL 3I8ZA 1A2UA 4WJ3M 2F0HA 5IP9H 1MD2D 1TWGH 3LX0A 4A75A 1FNVA 5C4JH 2BA0A 2EY1A 3DMUA 2MJ8A 4H44C 2NZOA 1HNWL 2VZAA 4PZ7A 3SE0A 3ZYYX 4OHJA 1SYCA 1YNJC 5C44H 4GZYC 1G2TA 4S3SA 2CHBD 5M5WH 1N32Q 1LLRD 1VQHA 1LT5D 1SYBA 1TWCB 2Z4IA 1EFID 1I5FA 4RCOA 5CORA 1GM5A 4JBKA 2AQ1B 3RNUA 4LF9Q 2KECA 4H02A 4KN7C 1Q86C 2FHTA 3D31A 2JA8B 2XNAC 4IQZA 1BOSA 4ALPA 4L6TB 2M2LA 3CAMA 1LTGD 3FPUB 1Y1VB 5JJIA 3ZJYC 3GQBA 1Y1WB 1PV4A 1GHKA 2HUGA 3KDFB 3NPPA 2JA6G 3L9AX 4JI0Q 3J7AV 1I4RA 3KF8B 4RAUC 1HZ9A 1F9PA 5J1ZA 2NYZD 2ZXRA 4B3RL 3N52A 4XQNA 4A3CG 1JWUD 4IO9A 3UI2A 4APVA 3KLSX 4JI1L 4OELB 4UPAA 1EY9A 2LXKA 4UY8C 2JA8G 4A3DB 4QUFA 2JA5B 2F0PA 2B2VA 1OXTA 4GOPB 2GN5A 2LS01 3I4MH 4GKJQ 3TSSA 2DUDA 3D4DA 4ZYSA 1HQRD 3S16H 1S5CD 3LWUA 4A3LH 3GV3A 3A8KE 3P7JA 4X65L 4OO1H 1K9MC 3S1NH 3A7LA 2D2CC 2BA1A 1STHA 3IAYA 4LF5Q 1CKNA 1SR3A 1IBLQ 2D0PA 2R7ZH 2FJ2A 1F9SA 2E8GA 1EYAA 3PCOB 3I73A 1TVXA 2ALYB 2I5HA 1QVGA 4DR6L 2WP8J 4ZAIA 4K2KA 5KNCA 1GHJA 5EBCA 5C44B 4UAIA 2BH2A 4GN4B 5FO8B 2LXJA 2JXMB 1I3QB 1GVPA 1MKHA 3KLWA 3M85A 1U9RA 1K73C 4IPHA 1Q3LA 1IKLA 1TU2B 4RG1A 1J5EQ 4ULLA 1HTLD 3SK6A 2V4DA 2ZJQA 4ZK9B 2A8VA 3D8GA 5M3FH 3H0GH 2F4IA 3JC66 4NXMQ 4ZRZA 2ENBA 3G4SA 5IWAQ 4DAMA 5KNBA 2NB0A 4R8NA 4KHPL 3PV0A 4K5XA 2IX3A 1EY6A 4QGUA 3J81E 1S40A 3OWEB 3I7FA 4J6HA 4EQ5A 3T16A 4JI2Q 4CKEA 1QOHA 3E9IA 1AH9A 2RHQB 3QR8A 4DAYA 1EU3A 3FKIH 2WB1G 3S1NB 3BVMA 2XGTA 2ZJRA 2E2HH 4DR6Q 2MO0A 1IHZA 1PH5A 1X56A 2VNUD 1TWHB 5EPKA 3S15B 1Y8NB 4KLKA 1E2ZA 1CI3M 1D8LA 1SE8A 3CC4A 1ZYRD 2CQOA 2UU9Q 3S14B 4MIUA 2PQAB 2ZXPA 1Z9FA 2K28A 4JYAQ 2K33A 1VQEA 2UXBL 3CKIB 3EBEA 1C4QA 5C6AA 3LGJA 2NWGA 2KHJA 3I55A 5IGDA 1QVCA 2JP1A 1I6HH 4BXXG 1PH3A 2R92B 1B7YB 4RHSA 1ML0D 2K52A 4EQOA 1WTQA 4JCVE 3CF5A 2R93B 4DV7Q 3CRLC 1UEAB 1HHVA 1S3OA 3S1QB 1SNOA 2XVSA 2NUCA 2EXDA 5CV9A 1DYQA 4DXGA 1PFMA 2K32A 3OOCA 2BCOA 5IIFA 4DV5L 3J81c 4HJAA 2I0QA 1K28A 3NEMA 3Q0AA 3C1FA 1ENFA 5BN4A 1JWMD 1E24A 2UUCL 1CA6A 2A1AA 3HG9A 4O1NA 2RBMA 1XWEA 2B8FA 5D65A 1W3SA 4DV3L 2X6GA 4OX9Q 1RF2D 4LMQD 1JICA 1HA5A 4DK6C 4J1MA 2KCCA 5HURA 3BJUA 4A3EG 1K8MA 1TWHH 1RTOA 5KRUA 1IBMQ 2UU9L 1AE2A 3S15H 1O7ZA 3D0FA 4RKBA 5EKKA 4C2MB 4ID6A 1XMQQ 2RSOA 1SDFA 4GLVB 4C3HH 3S1MB 3TN2A 1IYVA 4EGVA 2JSOA 3IL8A 4L63B 3GDEA 4HN7A 4DKAC 1D5ZC 3A7AB 4B08A 1VQPA 1I50H 2OTJA 1IXRA 4ME5A 4CDEC 4JI4Q 1TS5A 2N3SA 5CBEE 3AMUA 1YI2A 3MTSA 3ERQA 3SK8A 1U4LA 3CQZB 3PQIA 2ZJPA 2PNHA 1DXMA 1XTCD 4DV2L 1ESRA 3RMHA 1PH1A 1V1PA 1FYCA 1L1OA 2A69D 3E3XA 3DUZA 1LUZA 5KIXA 4PZ6A 3TDQA 1GO3E 5GQOA 1VQCA 3U9SA 3NQIA 4ME3A 4P73A 2JA6H 5C5MA 2OWOA 2C9OA 3PO2B 2KHIA 3U9OA 3KDFA 2NZHA 2KCMA 4CKBA 3M7NA 3AU7A 4N8FA 2RDFA 3PO2H 4AYBG 1K83H 1A3TA 4GKKL 1UE7A 4DR4L 2E2HB 1HRJA 2RA4A 2B29A 3QWNA 4QUCA 4LF9L 3PUYA 1SMYC 4A3FH 4DR3Q 5KNDA 3GTGH 4XYQA 5A35A 1G8ZD 4LUOA 1EY7A 4DR4Q 4KKUA 1JOKA 2XWBB 4BA2I 1IBKQ 4DR7Q 4ZLTF 5IYDG 1PDQA 4NKLA 3KBGA 5FJ8G 2B3GA 1YZ6A 3HKZG 2HCCA 1VQ4A 3HOXB 3PO3G 1S5ED 5C0XG 1EZ8A 1NE3A 1YJWA 2B2UC 4TSSA 3UDFA 2L4NA 3SR1A 1LT6D 4FDBA 3MXUA 4X64L 2Z4HA 4UHVA 4KHZA 5EJWA 3TS2A 3JAMc 4H13C 2EVBA 1ET6A 5C4XB 3GTQB 3H3VI 1LTLA 1T5XD 2JJQA 4DR1L 1B53A 3IFTA 2HQLA 4DV0Q 1H9KA 2FFKB 3E0EA 1NTGA 4CJ0B 4OWWB 3HOZB 1FVIA 5IOCA 1LO5D 4X66L 1RCVD 1PFBA 3MA2B 3FPPA 2B2WC 2JEBI 2ZM6Q 5H1SE 1V9PA 5KYLA 3R93A 5KGUA 2JA8H 1F2YA 3MVVA 1K8GA 4CDCC 1HNXQ 3PIP3 1F2MA 5C4ZA 4QIWE 3NENA 4BXXH 4L5SA 4ZUJA 3O13A 1JOOA 4K14A 4G7ZC 2NVYB 4KI0A 1HXYD 2KUMA 3A54A 4Q5VA 1PH4A 1MGSA 1TWFH 1GUOA 2ATWA 5AJ3L 3WOFA 3NELA 1JC7A 4JBJA 1KAWA 1SNPA 2D9UA 2QA4A 1WTVA 4I7ZC 2RVLA 2CWAA 2WAQE 2IW3A 3AFQA 3J7YW 1X6OA 3CD6A 1SSOA 1EEFD 1WTOA 1XMOQ 4UP7A 3I4NG 1X3QA 3RZOH 1MSHA 3HOYB
chains in the Genus database with same CATH topology
4B3SQ 1N33L 1G6PA 3J81i 4B3TQ 1HZBA 3HOYG 2VS1A 3A74A 4B3RQ 3SGIA 1YVCA 1VQBA 1M1KC 3MEFA 3M4OH 1BBWA 3CCQA 2OTLA 1X3FA 3STBD 1EIYB 3M4QA 4LF8Q 3HOVH 3FKIG 4DV2Q 3PO2G 5IT9c 1YJNA 2RF4A 4A3GG 1HNZQ 1QZGA 4JI0L 3CCVA 1XNQQ 4R1JA 4GN5A 1R9TH 3UE0A 4DV1Q 4B3TL 3TEHB 3OTOL 4AH6A 1CSPA 5FLMG 5C3EH 4WJ3M 2WAQG 3AQQA 1GD7A 3T1YQ 5IP9H 1VQNA 1VQ6A 4GNXC 1TWGH 4A75A 4B3ML 3HOWH 5IY0A 5C4JH 2NVQH 5C0XI 1VQ7A 1I3QH 2BA0A 1A62A 1UEBA 4XTCS 4YY3Q 5AJ3Q 2NZOA 3W1GA 4A3BH 1V1QA 3ULJA 2UXDL 1HNWL 2VY3A 2VZAA 4L5QA 4PZ7A 3L2PA 2Z0SA 2PQAA 1A0IA 5J3BA 2NVXH 4JI5L 4HJ9A 3ICEA 2ASBA 5C44H 1JMCA 1VQLA 4AIMA 3G48A 5M3FG 5JEAJ 1JJ2A 2E2JH 3KF6B 3G6EA 5M5WH 1N32Q 4P75A 5LMUQ 1VQHA 2K5NA 2K4KA 3RR5A 3KJOA 3HOXH 4LF6L 1VQDA 1EYGA 3ERSX 1I5FA 1GM5A 3AFPA 4JBKA 3RNUA 4J15A 4LF9Q 1YITA 5IP9G 4H02A 3K0XA 1Q86C 3K81C 3D31A 4JI3Q 2VQFQ 1QVFA 5IE8A 4Y52H 1EFWA 5IP7G 5M3MG 1KHIA 4ALPA 4O0AA 3CAMA 3PUXA 2JQOA 3HFZB 1VQJA 2D62A 5GAGC 2IHFA 5JJIA 3ZJYC 1T9HA 1PV4A 1X3EA 2JA6G 3KDFB 2F3IA 4YWLA 4JI0Q 4DR7L 3TS0A 4IFDJ 3KF8B 4XIGS 2UUCQ 4DV4L 4P71A 1N34Q 3CCEA 3S1RH 2AWOA 1HZ9A 2Q2TA 2YV5A 4IOCA 3TQYA 5ELNA 1PH7A 2Q2UA 4B3SL 4LF7L 1N33Q 3VDYA 2ZTEA 4B3RL 4A3CG 4AQYL 4IO9A 3HOYH 4APVA 3J80i 1U0LA 4JI1L 1JB7A 1KD1C 4UPAA 1KQSA 2LXKA 4LUVA 4UY8C 2JA8G 2R7ZG 4K0KL 1KXLA 4QL5A 1EOVA 2IX0A 1OXTA 4GOPB 2GN5A 3B6YA 2WFWA 4BBSG 3I4MH 1SROA 2ZM6L 4GKJQ 3HOUG 2DUDA 1SLJA 1H95A 2E2IH 3S16H 3CCSA 1IBML 5JJKA 2GVBA 4A3LH 4TQUS 5IYBG 3PUVA 4X65L 4QY7A 1K9MC 1A63A 4DV0L 4LFBL 3I4OA 1MJEA 3S1NH 1SMXA 1X3GA 3ER0A 1OXUA 2BA1A 2KENA 4A3EH 1EQQA 2JA7G 1YNXA 4C3IH 4LF5Q 1CKNA 1SR3A 4R4IA 4X62L 3UDIA 1IBLQ 4OX9L 2D0PA 4POFA 2R7ZH 1J6QA 2PI2A 4R4CA 4BY1H 2E8GA 2HIVA 1WYDA 3PCOB 2F52A 2VL6A 2K14A 1G291 4A76A 3HOXG 1YIJA 2ALYB 2I5HA 4LFBQ 1BVSA 3UE1A 1QVGA 1JJCB 2WP8J 4LF4L 4DR6L 4YHHQ 1GKHA 3DLLA 2AHOB 1LYLA 2Y0SG 3GD7A 2UXBQ 3I4NH 2BH2A 1J5EL 2C35B 4GN4B 3RZDH 2QEXA 1HNWQ 2LXJA 4DR5L 4YCVA 4X6AH 3K8AA 3A0JA 5IYCH 1L1OC 1GVPA 1MKHA 3KLWA 5M5YH 3M85A 1K73C 4IPHA 1N34L 2IY5B 5FLMH 4JI3L 2CCZA 3F8TA 1RIPA 1OTCA 1VCIA 4RG1A 2L15A 3U50C 4C3JH 2R93H 2RHSB 3EN2A 4MTNA 1Q7YC 1O7IA 1J5EQ 2MFIA 1MIUA 2NN6I 4LW1A 1PH2A 1L0WA 4GLAC 4BY1G 2ZJQA 3STBC 3JAMi 2A8VA 4IPCA 1TWCH 3UDGA 3E9HA 3J81j 1I94Q 1CSQA 3H0GH 5M3FH 4DR2L 1Q8KA 4GNXA 3JC66 4GOPA 4NXMQ 1P16A 3GTPH 1HR0W 4PZ8A 1XMOL 3G4SA 5IWAQ 3U4VA 3UDXA 4JI8L 2FXQA 3PIPA 3G71A 4DAMA 1VS0A 4HJ5A 1C7YA 2R92G 4JV5Q 4JI2L 2BH8A 2JA6H 3GTLH 4JYAL 4KHPL 3PV0A 2Z6KA 1XPUA 4GOPC 1A8VA 4QGUA 1S40A 1JE5A 3FHWA 4BBRH 1K3RA 2R6GA 1BKBA 4RMFA 3S2HH 2I5MX 3I7FA 2ES2A 4EQ5A 3A5ZB 4JI2Q 2GVAA 1C0AA 1L2FA 5BR8L 4A3LG 1PVOA 1X65A 3E9IA 1EQRA 2K5HA 1AH9A 2RHQB 4DV1L 1HZAA 2UUBQ 2UUAL 1XNQL 3FKIH 1HNXL 1Y1WG 2UXCQ 2WB1G 4LFCQ 5DLQE 1E1TA 2XGTA 4C2MH 2ZJRA 4HIDA 4YY3L 4YHHL 3ULPA 2E2HH 1WOCA 3RLFA 4LF4Q 4DR6Q 2MO0A 3RN2A 1D7QA 1PYSB 3F1ZA 4GKKQ 1PH5A 2F4VL 3I2ZA 3RLOA 2UUBL 4JI7L 1LM0A 1X56A 1Y1VG 1YEZA 2VNUD 4IPDA 4KLKA 2NVYH 3I4MG 3CCJA 2I5LX 4DUYL 1D8LA 4NPSA 2B63H 1NMFA 1SE8A 4DR5Q 3CC4A 4JI6L 1UE5A 3T1HQ 1ASYA 2CQOA 1VQ9A 2UU9Q 3BZCA 4EX5A 2PQAB 2OQKA 4A93H 3I56A 1Z9FA 2JEAI 4NB3A 5FJ8H 1PHJA 4JYAQ 4A3GH 3OW2A 1VQEA 1L1OB 3M3YH 4KHPQ 2UXBL 2N8NA 4GNXB 3TRZA 3EBEA 1KL9A 3H0GG 1X9NA 3CCMA 2IHEA 1FJGL 5JEAG 4A3MG 3LGJA 4JI5Q 2KHJA 3I55A 1QVCA 4IJLA 2AWNA 1I6HH 1N8RC 3IRBA 4BXXG 4A3IH 1PH3A 1ASZA 1HR0Q 3U4ZA 1B7YB 1NBWA 4JOIC 2JA7H 2K52A 1W2BA 1IYJB 1CKOA 1IZ6A 4JCVE 3CF5A 1V43A 4DV7Q 4WJ4A 4OWTB 1OXXK 2WB1E 1S3OA 3K7UC 1N36L 3CQZH 4O2DA 2B63G 4DUYQ 4PMWA 1C9OA 4R4QA 5IYCG 1UE1A 1TWAH 2EXDA 1KRSA 3OYYA 2IT1A 2A19A 4JI1Q 5C4XG 2Z6KC 4AQYQ 3F2BA 4QQBX 4DV5L 3J81c 4HJAA 2I0QA 5C44G 3NEMA 2UUAQ 4IOAA 1Q46A 3H3VH 5IYDH 1E24A 4A3FG 2UUCL 3KYHC 1KIXA 1X54A 2A1AA 1P8LA 4P72A 1EWIA 1W3SA 1EUJA 5C4XH 4DV3L 4A3JH 3S2DH 2HHHQ 2MNAA 2YTYA 3CPFA 2Q2HA 4OX9Q 5JJLA 4LWCA 4DK6C 5IYBH 3PF5A 1PH9A 1JT8A 1HH2P 3PSIA 3S14H 1DGSA 4AYBE 3KF6A 2K50A 4IFDI 2CKZB 3RLNA 3M9BA 5IP7H 1FJGQ 2VUMH 3BJUA 3DM3A 4A3EG 4A93G 4DNIA 4BBRG 1XPOA 4DPGA 1TWHH 4X65Q 1IBMQ 2UU9L 3S15H 1AE2A 2VQEL 1QUQA 3HOZH 4HIMA 4DUZQ 2JA9A 1VQOA 1NJIC 4L5RC 3D0FA 4JV5L 4IPGA 1IBKL 1Q82C 3CCLA 2Q2IA 4JOIA 4A4IA 1HNZL 2NVTH 1JJGA 3H15A 1XMQQ 2AMCB 1E3PA 1XNRQ 3L0OA 4GLVB 4C3HH 3AYHB 2H5XA 2JA5G 4A3DG 4OONA 3PF4A 4DR2Q 3W5OA 1M90C 4A3CH 3GDEA 4A3JG 2Y0SE 2JK8A 4PG3A 4DKAC 3CC7A 3CCRA 4YCUA 4LF7Q 1OXVA 2D0OA 4JG2A 4A3KG 4Y7NH 4DV5Q 2KBNA 4DK3C 2CWPA 1I50H 1N9WA 2CFMA 1VQPA 2OTJA 1VQMA 1IL2A 3J80c 1IXRA 1S72A 3K80C 4JI4Q 4B3MQ 2N3SA 1E1OA 2K5VA 1NY4A 2HIXA 2MO1A 5EAYA 1E7ZA 1YI2A 2ZJPA 2YU9H 3S1QH 3L7ZC 3CMEA 1EIFA 3GTKH 1WJJA 2V1CC 2YTXA 2ZTDA 2ID0A 2PNHA 5E7NA 4DV2L 3F2DA 4HIKA 1PYBA 3GTMH 1YBYA 1YHAA 2PI2E 4R4TA 1PH1A 4LFCL 4X62Q 4A3MH 1IBLL 2R92H 1L1OA 1PFSA 1WFQA 4TVAB 1CKNB 1LUZA 2OQ0A 1Q12A 2XTIA 4PZ6A 4DUZL 1G51A 1BBUA 3HKSA 2EIFA 1Q1EA 2LSSA 4X64Q 1KC8C 2HHHL 4NXML 4NXNQ 3KFUA 1GO3E 5GQOA 1VQCA 2R7FA 4JBWA 1XMQL 4ME3A 4P73A 3FP9A 4LUZA 4YWKA 3GTJH 4JBMA 2OWOA 3S17H 4YCWA 4GKJL 2UXDQ 5K36G 3RN5A 3HOZG 2RCNA 2IX1A 1Q81C 1XJVA 2KHIA 4JI6Q 4DV6Q 3AEVA 2R93G 2OCEA 3CP0A 2NZHA 3KDFA 5M5XH 3PIOA 2VQEQ 3PUZA 3CC2A 2KCMA 4NXNL 3M7NA 3S24A 4OO1G 4BY7H 1SFOH 5IWAL 4POGA 3K7AH 4AYBG 1K83H 3PO2H 3HOVG 4GKKL 1UE7A 1MJCA 2F4VQ 3MXNB 3PO3H 1HJPA 4DR4L 4DV4Q 3W1BA 1YHQA 4JI4L 2B29A 4LFAL 1XTDA 1Y1VH 4LF9L 3PUYA 2E5LQ 4A3FH 4DR3Q 3Q8DA 4IFDG 2PMZE 2MQHA 1HZCA 1XNRL 3GTGH 2AKWB 4L5TA 4DR1Q 4LUOA 4DR4Q 4BY7G 4BA2I 5ELOA 4UP9A 5LMNW 1IBKQ 4DR7Q 4LF5L 5IYDG 4A3BG 1N36Q 5FJ8G 2B3GA 1YZ6A 3HKZG 3J7ZC 4X66Q 1VQ4A 3J7A5 2VUMG 3CCUA 4R4OA 3PO3G 5C0XG 3U58A 1TXYA 1NE3A 2QGQA 1YJWA 1Y14B 3HOWG 3UDFA 1U5KA 3BZKA 1HR0L 1X55A 2KCTA 4FDBA 1UE6A 2YTVA 4IJHA 1PA6A 4X64L 1SRUA 5GADC 4BBSH 5HGQA 3HOUH 1CUKA 2HT1A 4KHZA 3ULLA 3S1MH 3JAMc 3TS2A 5LMNL 1VQKA 3PUWA 1AE3A 1SN8A 1I94L 3CW2C 2N78A 1WCMG 1VQ8A 3H3VI 1LTLA 2JJQA 2JA5H 4A3DH 4DV3Q 5FLXc 2K75A 4DR1L 4MZ9A 2HQLA 3GO5A 1KRTA 4LNQA 3KOJA 3PGZA 4DV0Q 1XPRA 3E0EA 1NTGA 4OWWB 1WI5A 4LFAQ 4P74A 3OTOQ 1QZHA 5GAEC 3F2CA 1FVIA 1RL2A 5C0XJ 3T1YL 4X66L 4BA1I 2ZM6Q 2JEBI 1VQGA 1OXSC 5H1SE 5GROA 4GS3A 1YHBA 4HJ7A 2DGYA 5C3EG 4JC0A 1V9PA 2N49A 1K0RA 3TREA 4DV6L 3T1HL 4DAYB 3NBHB 4GLXA 3CMAA 2NN6G 3BU2A 4A3KH 2JA8H 2ZTCA 1NMGA 4HJ8A 2UXCL 4DV7L 1K8GA 3CXCA 1HNXQ 5HY6A 4HIOA 2VW9A 2E5LL 1WCMH 1Z47A 1Q1BA 4QIWE 4YWMA 1YJ9A 3HKZE 3NENA 1Y1WH 1PH8A 3CPWA 4DR3L 4L5SA 3GTOH 4BXXH 4A3IG 5GAHC 4LF6Q 1PH6A 2YYZA 1VQFA 3EIVA 4KI0A 4JI8Q 1VQAA 1PH4A 1TWFH 5BR8Q 2ATWA 5AJ3L 5LMNQ 4OXPA 3NELA 1FL0A 4UP8A 4JBJA 1KAWA 1QUQB 2VQFL 1E22A 5M3MH 1B70B 4OWXB 1UWVA 3M4PA 2QA4A 4QJFA 1K8AC 2EQSA 1VQ5A 2CWAA 2WAQE 1N32L 1B8AA 3AFQA 4GN3B 3KJPA 3GTQH 1X6OA 2JE6I 4K0KQ 5LMUL 3CD6A 4JI7Q 4OO1I 2R7DA 1FGUA 1VQIA 4LF8L 1XMOQ 3A5UA 4UP7A 4MNOA 3I4NG 3WWVA 3RZOH 1CKMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B3S Q;  1N33 L;  1G6P A;  3J81 i;  4B3T Q;  1HZB A;  3HOY G;  2VS1 A;  3A74 A;  4B3R Q;  3SGI A;  1YVC A;  1VQB A;  1M1K C;  3MEF A;  3M4O H;  1BBW A;  3CCQ A;  2OTL A;  1X3F A;  3STB D;  1EIY B;  3M4Q A;  4LF8 Q;  3HOV H;  3FKI G;  4DV2 Q;  3PO2 G;  5IT9 c;  1YJN A;  2RF4 A;  4A3G G;  1HNZ Q;  1QZG A;  4JI0 L;  3CCV A;  1XNQ Q;  4R1J A;  4GN5 A;  1R9T H;  3UE0 A;  4DV1 Q;  4B3T L;  3TEH B;  3OTO L;  4AH6 A;  1CSP A;  5FLM G;  5C3E H;  4WJ3 M;  2WAQ G;  3AQQ A;  1GD7 A;  3T1Y Q;  5IP9 H;  1VQN A;  1VQ6 A;  4GNX C;  1TWG H;  4A75 A;  4B3M L;  3HOW H;  5IY0 A;  5C4J H;  2NVQ H;  5C0X I;  1VQ7 A;  1I3Q H;  2BA0 A;  1A62 A;  1UEB A;  4XTC S;  4YY3 Q;  5AJ3 Q;  2NZO A;  3W1G A;  4A3B H;  1V1Q A;  3ULJ A;  2UXD L;  1HNW L;  2VY3 A;  2VZA A;  4L5Q A;  4PZ7 A;  3L2P A;  2Z0S A;  2PQA A;  1A0I A;  5J3B A;  2NVX H;  4JI5 L;  4HJ9 A;  3ICE A;  2ASB A;  5C44 H;  1JMC A;  1VQL A;  4AIM A;  3G48 A;  5M3F G;  5JEA J;  1JJ2 A;  2E2J H;  3KF6 B;  3G6E A;  5M5W H;  1N32 Q;  4P75 A;  5LMU Q;  1VQH A;  2K5N A;  2K4K A;  3RR5 A;  3KJO A;  3HOX H;  4LF6 L;  1VQD A;  1EYG A;  3ERS X;  1I5F A;  1GM5 A;  3AFP A;  4JBK A;  3RNU A;  4J15 A;  4LF9 Q;  1YIT A;  5IP9 G;  4H02 A;  3K0X A;  1Q86 C;  3K81 C;  3D31 A;  4JI3 Q;  2VQF Q;  1QVF A;  5IE8 A;  4Y52 H;  1EFW A;  5IP7 G;  5M3M G;  1KHI A;  4ALP A;  4O0A A;  3CAM A;  3PUX A;  2JQO A;  3HFZ B;  1VQJ A;  2D62 A;  5GAG C;  2IHF A;  5JJI A;  3ZJY C;  1T9H A;  1PV4 A;  1X3E A;  2JA6 G;  3KDF B;  2F3I A;  4YWL A;  4JI0 Q;  4DR7 L;  3TS0 A;  4IFD J;  3KF8 B;  4XIG S;  2UUC Q;  4DV4 L;  4P71 A;  1N34 Q;  3CCE A;  3S1R H;  2AWO A;  1HZ9 A;  2Q2T A;  2YV5 A;  4IOC A;  3TQY A;  5ELN A;  1PH7 A;  2Q2U A;  4B3S L;  4LF7 L;  1N33 Q;  3VDY A;  2ZTE A;  4B3R L;  4A3C G;  4AQY L;  4IO9 A;  3HOY H;  4APV A;  3J80 i;  1U0L A;  4JI1 L;  1JB7 A;  1KD1 C;  4UPA A;  1KQS A;  2LXK A;  4LUV A;  4UY8 C;  2JA8 G;  2R7Z G;  4K0K L;  1KXL A;  4QL5 A;  1EOV A;  2IX0 A;  1OXT A;  4GOP B;  2GN5 A;  3B6Y A;  2WFW A;  4BBS G;  3I4M H;  1SRO A;  2ZM6 L;  4GKJ Q;  3HOU G;  2DUD A;  1SLJ A;  1H95 A;  2E2I H;  3S16 H;  3CCS A;  1IBM L;  5JJK A;  2GVB A;  4A3L H;  4TQU S;  5IYB G;  3PUV A;  4X65 L;  4QY7 A;  1K9M C;  1A63 A;  4DV0 L;  4LFB L;  3I4O A;  1MJE A;  3S1N H;  1SMX A;  1X3G A;  3ER0 A;  1OXU A;  2BA1 A;  2KEN A;  4A3E H;  1EQQ A;  2JA7 G;  1YNX A;  4C3I H;  4LF5 Q;  1CKN A;  1SR3 A;  4R4I A;  4X62 L;  3UDI A;  1IBL Q;  4OX9 L;  2D0P A;  4POF A;  2R7Z H;  1J6Q A;  2PI2 A;  4R4C A;  4BY1 H;  2E8G A;  2HIV A;  1WYD A;  3PCO B;  2F52 A;  2VL6 A;  2K14 A;  1G29 1;  4A76 A;  3HOX G;  1YIJ A;  2ALY B;  2I5H A;  4LFB Q;  1BVS A;  3UE1 A;  1QVG A;  1JJC B;  2WP8 J;  4LF4 L;  4DR6 L;  4YHH Q;  1GKH A;  3DLL A;  2AHO B;  1LYL A;  2Y0S G;  3GD7 A;  2UXB Q;  3I4N H;  2BH2 A;  1J5E L;  2C35 B;  4GN4 B;  3RZD H;  2QEX A;  1HNW Q;  2LXJ A;  4DR5 L;  4YCV A;  4X6A H;  3K8A A;  3A0J A;  5IYC H;  1L1O C;  1GVP A;  1MKH A;  3KLW A;  5M5Y H;  3M85 A;  1K73 C;  4IPH A;  1N34 L;  2IY5 B;  5FLM H;  4JI3 L;  2CCZ A;  3F8T A;  1RIP A;  1OTC A;  1VCI A;  4RG1 A;  2L15 A;  3U50 C;  4C3J H;  2R93 H;  2RHS B;  3EN2 A;  4MTN A;  1Q7Y C;  1O7I A;  1J5E Q;  2MFI A;  1MIU A;  2NN6 I;  4LW1 A;  1PH2 A;  1L0W A;  4GLA C;  4BY1 G;  2ZJQ A;  3STB C;  3JAM i;  2A8V A;  4IPC A;  1TWC H;  3UDG A;  3E9H A;  3J81 j;  1I94 Q;  1CSQ A;  3H0G H;  5M3F H;  4DR2 L;  1Q8K A;  4GNX A;  3JC6 6;  4GOP A;  4NXM Q;  1P16 A;  3GTP H;  1HR0 W;  4PZ8 A;  1XMO L;  3G4S A;  5IWA Q;  3U4V A;  3UDX A;  4JI8 L;  2FXQ A;  3PIP A;  3G71 A;  4DAM A;  1VS0 A;  4HJ5 A;  1C7Y A;  2R92 G;  4JV5 Q;  4JI2 L;  2BH8 A;  2JA6 H;  3GTL H;  4JYA L;  4KHP L;  3PV0 A;  2Z6K A;  1XPU A;  4GOP C;  1A8V A;  4QGU A;  1S40 A;  1JE5 A;  3FHW A;  4BBR H;  1K3R A;  2R6G A;  1BKB A;  4RMF A;  3S2H H;  2I5M X;  3I7F A;  2ES2 A;  4EQ5 A;  3A5Z B;  4JI2 Q;  2GVA A;  1C0A A;  1L2F A;  5BR8 L;  4A3L G;  1PVO A;  1X65 A;  3E9I A;  1EQR A;  2K5H A;  1AH9 A;  2RHQ B;  4DV1 L;  1HZA A;  2UUB Q;  2UUA L;  1XNQ L;  3FKI H;  1HNX L;  1Y1W G;  2UXC Q;  2WB1 G;  4LFC Q;  5DLQ E;  1E1T A;  2XGT A;  4C2M H;  2ZJR A;  4HID A;  4YY3 L;  4YHH L;  3ULP A;  2E2H H;  1WOC A;  3RLF A;  4LF4 Q;  4DR6 Q;  2MO0 A;  3RN2 A;  1D7Q A;  1PYS B;  3F1Z A;  4GKK Q;  1PH5 A;  2F4V L;  3I2Z A;  3RLO A;  2UUB L;  4JI7 L;  1LM0 A;  1X56 A;  1Y1V G;  1YEZ A;  2VNU D;  4IPD A;  4KLK A;  2NVY H;  3I4M G;  3CCJ A;  2I5L X;  4DUY L;  1D8L A;  4NPS A;  2B63 H;  1NMF A;  1SE8 A;  4DR5 Q;  3CC4 A;  4JI6 L;  1UE5 A;  3T1H Q;  1ASY A;  2CQO A;  1VQ9 A;  2UU9 Q;  3BZC A;  4EX5 A;  2PQA B;  2OQK A;  4A93 H;  3I56 A;  1Z9F A;  2JEA I;  4NB3 A;  5FJ8 H;  1PHJ A;  4JYA Q;  4A3G H;  3OW2 A;  1VQE A;  1L1O B;  3M3Y H;  4KHP Q;  2UXB L;  2N8N A;  4GNX B;  3TRZ A;  3EBE A;  1KL9 A;  3H0G G;  1X9N A;  3CCM A;  2IHE A;  1FJG L;  5JEA G;  4A3M G;  3LGJ A;  4JI5 Q;  2KHJ A;  3I55 A;  1QVC A;  4IJL A;  2AWN A;  1I6H H;  1N8R C;  3IRB A;  4BXX G;  4A3I H;  1PH3 A;  1ASZ A;  1HR0 Q;  3U4Z A;  1B7Y B;  1NBW A;  4JOI C;  2JA7 H;  2K52 A;  1W2B A;  1IYJ B;  1CKO A;  1IZ6 A;  4JCV E;  3CF5 A;  1V43 A;  4DV7 Q;  4WJ4 A;  4OWT B;  1OXX K;  2WB1 E;  1S3O A;  3K7U C;  1N36 L;  3CQZ H;  4O2D A;  2B63 G;  4DUY Q;  4PMW A;  1C9O A;  4R4Q A;  5IYC G;  1UE1 A;  1TWA H;  2EXD A;  1KRS A;  3OYY A;  2IT1 A;  2A19 A;  4JI1 Q;  5C4X G;  2Z6K C;  4AQY Q;  3F2B A;  4QQB X;  4DV5 L;  3J81 c;  4HJA A;  2I0Q A;  5C44 G;  3NEM A;  2UUA Q;  4IOA A;  1Q46 A;  3H3V H;  5IYD H;  1E24 A;  4A3F G;  2UUC L;  3KYH C;  1KIX A;  1X54 A;  2A1A A;  1P8L A;  4P72 A;  1EWI A;  1W3S A;  1EUJ A;  5C4X H;  4DV3 L;  4A3J H;  3S2D H;  2HHH Q;  2MNA A;  2YTY A;  3CPF A;  2Q2H A;  4OX9 Q;  5JJL A;  4LWC A;  4DK6 C;  5IYB H;  3PF5 A;  1PH9 A;  1JT8 A;  1HH2 P;  3PSI A;  3S14 H;  1DGS A;  4AYB E;  3KF6 A;  2K50 A;  4IFD I;  2CKZ B;  3RLN A;  3M9B A;  5IP7 H;  1FJG Q;  2VUM H;  3BJU A;  3DM3 A;  4A3E G;  4A93 G;  4DNI A;  4BBR G;  1XPO A;  4DPG A;  1TWH H;  4X65 Q;  1IBM Q;  2UU9 L;  3S15 H;  1AE2 A;  2VQE L;  1QUQ A;  3HOZ H;  4HIM A;  4DUZ Q;  2JA9 A;  1VQO A;  1NJI C;  4L5R C;  3D0F A;  4JV5 L;  4IPG A;  1IBK L;  1Q82 C;  3CCL A;  2Q2I A;  4JOI A;  4A4I A;  1HNZ L;  2NVT H;  1JJG A;  3H15 A;  1XMQ Q;  2AMC B;  1E3P A;  1XNR Q;  3L0O A;  4GLV B;  4C3H H;  3AYH B;  2H5X A;  2JA5 G;  4A3D G;  4OON A;  3PF4 A;  4DR2 Q;  3W5O A;  1M90 C;  4A3C H;  3GDE A;  4A3J G;  2Y0S E;  2JK8 A;  4PG3 A;  4DKA C;  3CC7 A;  3CCR A;  4YCU A;  4LF7 Q;  1OXV A;  2D0O A;  4JG2 A;  4A3K G;  4Y7N H;  4DV5 Q;  2KBN A;  4DK3 C;  2CWP A;  1I50 H;  1N9W A;  2CFM A;  1VQP A;  2OTJ A;  1VQM A;  1IL2 A;  3J80 c;  1IXR A;  1S72 A;  3K80 C;  4JI4 Q;  4B3M Q;  2N3S A;  1E1O A;  2K5V A;  1NY4 A;  2HIX A;  2MO1 A;  5EAY A;  1E7Z A;  1YI2 A;  2ZJP A;  2YU9 H;  3S1Q H;  3L7Z C;  3CME A;  1EIF A;  3GTK H;  1WJJ A;  2V1C C;  2YTX A;  2ZTD A;  2ID0 A;  2PNH A;  5E7N A;  4DV2 L;  3F2D A;  4HIK A;  1PYB A;  3GTM H;  1YBY A;  1YHA A;  2PI2 E;  4R4T A;  1PH1 A;  4LFC L;  4X62 Q;  4A3M H;  1IBL L;  2R92 H;  1L1O A;  1PFS A;  1WFQ A;  4TVA B;  1CKN B;  1LUZ A;  2OQ0 A;  1Q12 A;  2XTI A;  4PZ6 A;  4DUZ L;  1G51 A;  1BBU A;  3HKS A;  2EIF A;  1Q1E A;  2LSS A;  4X64 Q;  1KC8 C;  2HHH L;  4NXM L;  4NXN Q;  3KFU A;  1GO3 E;  5GQO A;  1VQC A;  2R7F A;  4JBW A;  1XMQ L;  4ME3 A;  4P73 A;  3FP9 A;  4LUZ A;  4YWK A;  3GTJ H;  4JBM A;  2OWO A;  3S17 H;  4YCW A;  4GKJ L;  2UXD Q;  5K36 G;  3RN5 A;  3HOZ G;  2RCN A;  2IX1 A;  1Q81 C;  1XJV A;  2KHI A;  4JI6 Q;  4DV6 Q;  3AEV A;  2R93 G;  2OCE A;  3CP0 A;  2NZH A;  3KDF A;  5M5X H;  3PIO A;  2VQE Q;  3PUZ A;  3CC2 A;  2KCM A;  4NXN L;  3M7N A;  3S24 A;  4OO1 G;  4BY7 H;  1SFO H;  5IWA L;  4POG A;  3K7A H;  4AYB G;  1K83 H;  3PO2 H;  3HOV G;  4GKK L;  1UE7 A;  1MJC A;  2F4V Q;  3MXN B;  3PO3 H;  1HJP A;  4DR4 L;  4DV4 Q;  3W1B A;  1YHQ A;  4JI4 L;  2B29 A;  4LFA L;  1XTD A;  1Y1V H;  4LF9 L;  3PUY A;  2E5L Q;  4A3F H;  4DR3 Q;  3Q8D A;  4IFD G;  2PMZ E;  2MQH A;  1HZC A;  1XNR L;  3GTG H;  2AKW B;  4L5T A;  4DR1 Q;  4LUO A;  4DR4 Q;  4BY7 G;  4BA2 I;  5ELO A;  4UP9 A;  5LMN W;  1IBK Q;  4DR7 Q;  4LF5 L;  5IYD G;  4A3B G;  1N36 Q;  5FJ8 G;  2B3G A;  1YZ6 A;  3HKZ G;  3J7Z C;  4X66 Q;  1VQ4 A;  3J7A 5;  2VUM G;  3CCU A;  4R4O A;  3PO3 G;  5C0X G;  3U58 A;  1TXY A;  1NE3 A;  2QGQ A;  1YJW A;  1Y14 B;  3HOW G;  3UDF A;  1U5K A;  3BZK A;  1HR0 L;  1X55 A;  2KCT A;  4FDB A;  1UE6 A;  2YTV A;  4IJH A;  1PA6 A;  4X64 L;  1SRU A;  5GAD C;  4BBS H;  5HGQ A;  3HOU H;  1CUK A;  2HT1 A;  4KHZ A;  3ULL A;  3S1M H;  3JAM c;  3TS2 A;  5LMN L;  1VQK A;  3PUW A;  1AE3 A;  1SN8 A;  1I94 L;  3CW2 C;  2N78 A;  1WCM G;  1VQ8 A;  3H3V I;  1LTL A;  2JJQ A;  2JA5 H;  4A3D H;  4DV3 Q;  5FLX c;  2K75 A;  4DR1 L;  4MZ9 A;  2HQL A;  3GO5 A;  1KRT A;  4LNQ A;  3KOJ A;  3PGZ A;  4DV0 Q;  1XPR A;  3E0E A;  1NTG A;  4OWW B;  1WI5 A;  4LFA Q;  4P74 A;  3OTO Q;  1QZH A;  5GAE C;  3F2C A;  1FVI A;  1RL2 A;  5C0X J;  3T1Y L;  4X66 L;  4BA1 I;  2ZM6 Q;  2JEB I;  1VQG A;  1OXS C;  5H1S E;  5GRO A;  4GS3 A;  1YHB A;  4HJ7 A;  2DGY A;  5C3E G;  4JC0 A;  1V9P A;  2N49 A;  1K0R A;  3TRE A;  4DV6 L;  3T1H L;  4DAY B;  3NBH B;  4GLX A;  3CMA A;  2NN6 G;  3BU2 A;  4A3K H;  2JA8 H;  2ZTC A;  1NMG A;  4HJ8 A;  2UXC L;  4DV7 L;  1K8G A;  3CXC A;  1HNX Q;  5HY6 A;  4HIO A;  2VW9 A;  2E5L L;  1WCM H;  1Z47 A;  1Q1B A;  4QIW E;  4YWM A;  1YJ9 A;  3HKZ E;  3NEN A;  1Y1W H;  1PH8 A;  3CPW A;  4DR3 L;  4L5S A;  3GTO H;  4BXX H;  4A3I G;  5GAH C;  4LF6 Q;  1PH6 A;  2YYZ A;  1VQF A;  3EIV A;  4KI0 A;  4JI8 Q;  1VQA A;  1PH4 A;  1TWF H;  5BR8 Q;  2ATW A;  5AJ3 L;  5LMN Q;  4OXP A;  3NEL A;  1FL0 A;  4UP8 A;  4JBJ A;  1KAW A;  1QUQ B;  2VQF L;  1E22 A;  5M3M H;  1B70 B;  4OWX B;  1UWV A;  3M4P A;  2QA4 A;  4QJF A;  1K8A C;  2EQS A;  1VQ5 A;  2CWA A;  2WAQ E;  1N32 L;  1B8A A;  3AFQ A;  4GN3 B;  3KJP A;  3GTQ H;  1X6O A;  2JE6 I;  4K0K Q;  5LMU L;  3CD6 A;  4JI7 Q;  4OO1 I;  2R7D A;  1FGU A;  1VQI A;  4LF8 L;  1XMO Q;  3A5U A;  4UP7 A;  4MNO A;  3I4N G;  3WWV A;  3RZO H;  1CKM A; 
#chains in the Genus database with same CATH topology
 3J80 E;  4B3S Q;  4G4K A;  4FF3 A;  5IT9 E;  4G7O C;  2A68 C;  5CV8 A;  4ZKC B;  3FKI B;  1AEX A;  3M4Q A;  4K2L A;  4BBR B;  1FGB D;  5JVH 3;  1RTN A;  4U68 A;  1ZEQ X;  1CSP A;  5FLM G;  1Z6H A;  4TRD A;  3AQQ A;  5C3X A;  4QMG A;  4WRD A;  1VQ6 A;  4PMB A;  3NTK A;  1PTO H;  1LTT D;  3OMG A;  4NW2 A;  1I3Q H;  4YY3 Q;  3OHX C;  4A3B H;  3ULJ A;  2UXD L;  2F0E A;  2QDB A;  2PQA A;  2EE1 A;  5J3B A;  4DAP A;  3I70 A;  4HJ9 A;  3S9W A;  1VQL A;  5M3F G;  1UUP A;  3KF6 B;  3HGB A;  4IZ8 A;  1QIL A;  3KJO A;  4CHT B;  3ERS X;  4J15 A;  3D6W A;  1PFN A;  4HMI A;  2JA7 B;  3K0X A;  4JI3 Q;  4ODG A;  1YNJ D;  5IE8 A;  1EFW A;  4O0A A;  2QEJ C;  5E4X A;  4XYO A;  2JQO A;  5CYU A;  2D62 A;  1EY4 A;  2IHF A;  4PNY A;  4YWL A;  4ZQ3 A;  4O42 A;  3TS0 A;  4XIG S;  1I6V C;  4P71 A;  4DV4 L;  1N34 Q;  3S1R H;  1H9M A;  1FR3 A;  4IOC A;  1JE4 A;  2SEB D;  1PZJ D;  2Q2U A;  4B3S L;  3DM1 A;  3MXN A;  4LF7 L;  2ZTE A;  2NVX B;  3HOY H;  2R7Z G;  4K0K L;  1KXL A;  2H1E A;  4QL5 A;  1DZ1 A;  1LTI D;  3V2T A;  4BBS G;  1SRO A;  1CZG A;  3CCS A;  5JJK A;  1KLU D;  2GVB A;  4B9W A;  5IYB G;  1V8Q A;  1LAC A;  1X3G A;  2KEN A;  2EPB A;  3ER0 A;  4JV5 L;  1YNX A;  4X62 L;  3EA6 A;  4KN4 C;  3UDI A;  1TQO A;  1J6Q A;  1UNS A;  1BCP D;  1ICF B;  4R4C A;  5I9P A;  1PRT B;  3D6C A;  2K14 A;  1G29 1;  5T1G A;  2I07 B;  3HOX G;  4RGN A;  3PO3 B;  3UE1 A;  4LF4 L;  1JJC B;  4IN3 A;  3K58 A;  4YHH Q;  1GKH A;  3DLL A;  1LYL A;  4BY1 B;  1RKN A;  2I46 A;  2RDG A;  4DR5 L;  4X6A H;  4YCV A;  5T1I A;  2QF7 A;  1N34 L;  2IY5 B;  1KAA A;  5FLM H;  4JI3 L;  2CCZ A;  2QKI C;  2R93 H;  2RHS B;  4MTN A;  3ND9 A;  1O80 A;  1H9S A;  3F2U A;  4RFB A;  2HD3 A;  1WVL A;  4BY1 G;  5JOB A;  2F3V A;  4IPC A;  1TWF B;  2DJF C;  3J81 j;  1CSQ A;  1KLG D;  3GTL B;  1W6K A;  4K8J A;  4GOP A;  1P16 A;  4UDU C;  3G71 A;  3U4V A;  1SJH D;  1AZQ A;  2R92 G;  1VS0 A;  4JV5 Q;  5K5P A;  1TWA B;  1BNZ A;  3NTI A;  3GTL H;  2ICE C;  4KKS A;  2Z6K A;  2XSC A;  4GOP C;  1A8V A;  4IUP A;  1K3R A;  2K04 A;  1DD2 A;  4RGM A;  1TS2 A;  2R7Z B;  2ES2 A;  5C0X H;  2G5D A;  5EBD A;  5K36 H;  3A5Z B;  5EPJ A;  2GVA A;  2XIW A;  4DNT B;  4DV1 L;  2DY7 A;  1EQV A;  4PMC A;  2F0K A;  1V1O A;  1NNX A;  3D4W A;  4LFC Q;  5DLQ E;  1R4Q B;  4HID A;  3RZD B;  2KEE A;  4HSP A;  1WOC A;  2SDF A;  1PYS B;  3QB3 A;  4PV1 C;  1PYW D;  2K1B A;  2F4V L;  3I2Z A;  1RDP D;  4X3S A;  5M5X B;  4CGY B;  4WJW A;  5EPL A;  4KMU C;  3NK9 A;  1QJO A;  4LJZ C;  1SNC A;  3KBX A;  1I50 B;  4JI6 L;  1UE5 A;  4A3B B;  1GUG A;  4EX5 A;  4A93 H;  3SDZ A;  5CBA E;  1BBX C;  2JEA I;  2N88 A;  5IGG A;  3GV6 A;  5KYI A;  3JAM L;  1L1O B;  3OW2 A;  4A3G H;  4H0L C;  1PTO C;  4KKT A;  2X6L A;  4K8I A;  1FJG L;  4JI5 Q;  1WD0 A;  4IJL A;  2AWN A;  4A3I H;  2PO4 A;  1NBW A;  2JA7 H;  4A3F B;  2QW7 A;  1IYJ B;  1SYD A;  1V43 A;  5EKL A;  2WB1 E;  4O2D A;  4PMW A;  3NP8 A;  3VA5 A;  1UE1 A;  1TWA H;  3K5L A;  3OYY A;  4X3K A;  2HCI A;  3K0Y A;  3S16 B;  4QQB X;  1B2T A;  4C1N I;  4HMJ A;  1X3P A;  3TZD A;  5CMD A;  4IOA A;  4IFD H;  4A3F G;  3K5M A;  3KYH C;  3I91 A;  3D4R A;  5C4X H;  1R9T B;  3GTM B;  2YTY A;  1IL8 A;  3BG3 A;  1QE6 A;  3PF5 A;  1JT8 A;  3PSI A;  4CBV A;  1DGS A;  2EY2 A;  1PMR A;  3T56 B;  3RLN A;  3M9B A;  1FJG Q;  4DNR B;  1EIG A;  4DNI A;  4BBR G;  5ELE A;  4G7H C;  1XPO A;  4DPG A;  4X65 Q;  3HOZ H;  3VYS A;  1CHP D;  3DWP A;  1XXG A;  5M5Y B;  1IBK L;  1Q82 C;  4AYB B;  4A4I A;  1GUT A;  2AMC B;  1E3P A;  1SJE D;  1XNR Q;  3QG1 A;  1QNU A;  4QF4 A;  4QIW B;  4A3C H;  4ILW A;  1QG7 A;  5A2Q E;  3CC7 A;  4LF7 Q;  1OXV A;  1GJX A;  1PRT F;  3EVQ A;  2KBN A;  1N9W A;  2CFM A;  5M3F B;  1LAB A;  3HRZ C;  4C3J G;  1VQM A;  1NR4 A;  1IL2 A;  5J39 A;  5IGE A;  1D1I A;  3K80 C;  2A69 C;  4RCN A;  2HIX A;  4LK1 C;  1C8C A;  3S1Q H;  3L7Z C;  1PZI D;  2XRS D;  2RSN A;  2YTX A;  1DM0 B;  1K3B C;  2ID0 A;  3F2D A;  1B4O A;  2PI2 E;  3D3R A;  2A74 C;  4LFC L;  4X62 Q;  4A3M H;  2PQE A;  3M4Y A;  4TVA B;  1ET9 A;  1WFQ A;  1G6Z A;  2DNE A;  3MXP A;  2OQ0 A;  4FO2 A;  3WDN A;  1BBU A;  2LSS A;  1Q1E A;  3OIP A;  4NXM L;  4YIJ A;  2HHH L;  1QWY A;  2O2L D;  2R7F A;  4JBW A;  3BDC A;  1XMQ L;  2KOL A;  4DGZ A;  4YWK A;  5K36 G;  2UXD Q;  5C4J B;  5FLX L;  5BN3 A;  3RN5 A;  3HOZ G;  1CQV A;  4JI6 Q;  1XJV A;  1WTR A;  4KJN A;  3CP0 A;  3CC2 A;  3M3Y B;  3PUZ A;  3S24 A;  2FMC A;  4BY7 H;  4POG A;  1MJC A;  2F4V Q;  3MXN B;  1PRT C;  4N8X 1;  3PO3 H;  1I4Q A;  1JCK B;  4DV4 Q;  4LAA A;  2EJF C;  3W1B A;  2DJG C;  4JI4 L;  3S2D B;  2E5L Q;  1CT1 D;  3HEJ A;  1MSG A;  3Q8D A;  1I4P A;  5E3F A;  1DOM A;  4L5T A;  3NBI A;  1SXT A;  2KA7 A;  1T5E A;  4BY7 G;  1Y69 U;  2IL8 A;  4LF5 L;  1TS4 A;  1PTO F;  1TY0 A;  3Q23 A;  3HOU B;  3Q22 A;  4K6L A;  5ISR A;  1HUN A;  4BS9 A;  4IAL A;  2KCT A;  5JJZ A;  5F2D A;  4XT1 B;  3HOU H;  3ULL A;  4OEM B;  4OIJ A;  3FVQ A;  1VQK A;  1K8O A;  4A3I B;  1I94 L;  1VQ8 A;  1ENC A;  2QDL A;  4PQX A;  5E1F A;  5FLX c;  2K75 A;  1EWH A;  3GO5 A;  2EOT A;  4C1N K;  1NUC A;  1Q8I A;  3M4O B;  2MGS A;  4LFA Q;  3MFY A;  3OTO Q;  4HTH A;  2PCF B;  3F2C A;  1QZH A;  4DXF A;  1HUM A;  4KY7 A;  5JVG 3;  1STE A;  2Z8L A;  3VYT A;  1VQG A;  5GRO A;  1YHB A;  2N49 A;  1K0R A;  2L11 A;  2P5Z X;  4GLX A;  5CV7 A;  1Y8P B;  2F1M A;  4A3K H;  1F9R A;  4HSV A;  4KY6 A;  2ZTC A;  4HJ8 A;  2E2J B;  1J9O A;  4HIO A;  2E5L L;  1D6E C;  4V19 0;  1Z47 A;  1Q1B A;  1K83 B;  3HKZ E;  2G9H D;  3OSO A;  1H9S B;  3VYU A;  1Y1W H;  3GTO H;  5EQ0 A;  3S17 B;  3N6R A;  1ZYR C;  2M9V A;  2F0W A;  2F0F A;  3NWS A;  3EIV A;  1IW7 C;  5BR8 Q;  5IOD A;  3W2D A;  5I6Y A;  5ELC A;  3GTO B;  2AUK A;  4IUN A;  4UP8 A;  3BS1 A;  2G9D A;  2VQF L;  1B70 B;  1B9M A;  1CQF A;  3PIO 3;  1QNK A;  3HS0 C;  1K8A C;  1VQ5 A;  4FP5 D;  5I4D A;  1D5M C;  2JE6 I;  4K0K Q;  1I4H A;  4OO1 I;  2B39 A;  2R7D A;  2Z1C A;  4LF8 L;  1BQQ T;  1RHP A;  3WWV A;  1HNX L;  4F87 A;  3HOV B;  4OIK A;  4B3T Q;  4B3R Q;  1M1K C;  4RA8 A;  2RDH A;  5CGK A;  3HOV H;  2A6H C;  1HNZ Q;  2F0V A;  1QZG A;  4JI0 L;  3CCV A;  3UE0 A;  4DV1 Q;  3OTO L;  4AH6 A;  2E75 C;  5C3E H;  2YU9 B;  4BBS B;  2BDO A;  1VQN A;  1EL0 A;  3HOW H;  4RGO S;  2KCN A;  5IY0 A;  2NVQ H;  5C0X I;  2MPM A;  1VQ7 A;  4KHV A;  2R3Z A;  2F3W A;  2XRQ D;  3BYY B;  4L8J A;  5AJ3 Q;  1V1Q A;  4DF7 A;  4L5Q A;  3VA7 A;  3L2P A;  2GA4 B;  1A0I A;  4JI5 L;  3MAQ A;  3ICE A;  4JPB W;  2ASB A;  1BXT A;  1JMC A;  4AIM A;  1VMP A;  3G6E A;  5LL6 X;  4P75 A;  2K4K A;  2K5N A;  3FDT A;  3RR5 A;  3QO2 A;  4LF6 L;  3LNN A;  2KHS A;  4CJ2 C;  5I6W A;  5G3L D;  3MXG A;  4HR7 B;  1YIT A;  1CA5 A;  3K81 C;  1J8I A;  2VQF Q;  1QVF A;  1STY A;  5M3M G;  1EYC A;  1KHI A;  3BDO A;  5D3I B;  3PUX A;  3NXW A;  1VQJ A;  5GAG C;  1JR0 D;  1SND A;  1T9H A;  2F3I A;  4A93 B;  1E2W A;  1S5F D;  2KED A;  3CCE A;  3GTK B;  2AWO A;  2Q2T A;  2EY6 A;  2PMZ B;  1N33 Q;  3VDY A;  2F0J A;  2ZT9 C;  4AQY L;  1KTK A;  1CK1 A;  2RQX A;  1U0L A;  2IWH A;  1KQS A;  4LUV A;  5J22 A;  1BDO A;  1EOV A;  2IX0 A;  2WFW A;  2WAQ B;  3A8J E;  2F0Q A;  3B6Y A;  1U4R A;  3JAM E;  1SLJ A;  1H95 A;  2E2I H;  1F77 A;  4HAE A;  4KV6 A;  4KD3 A;  2A68 D;  3PUV A;  2CW0 C;  4QY7 A;  4DV0 L;  4LFB L;  3VR3 A;  3CHB D;  2WV6 D;  2JA7 G;  4KD4 A;  1EQQ A;  4C3I H;  5C4X G;  4OX9 L;  4POF A;  2F03 A;  2PI2 A;  2N55 A;  3QJY A;  1RJT A;  4BY1 H;  2HIV A;  2O5J C;  2F52 A;  1ZXT A;  4IUQ A;  2D5D A;  1YIJ A;  4LFB Q;  1WTH A;  1VF5 C;  2VUM B;  2Y0S G;  3EFX D;  2A73 B;  1TWG B;  1J5E L;  2C35 B;  1II3 A;  1KAB A;  4XQJ A;  3A0J A;  5IYC H;  4BY7 B;  1L1O C;  3A56 A;  1CHQ D;  4DFA A;  1OTC A;  1RIP A;  1VCI A;  2L15 A;  3U50 C;  4DAV A;  3EN2 A;  1O7I A;  2ICI A;  1IW7 D;  1TS3 A;  2NN6 I;  2EYL A;  3G6J B;  4LW1 A;  1L0W A;  2Y0S B;  1F2Z A;  5JPM C;  1SBB B;  3JAM i;  5TSS A;  1TWC H;  2BOS A;  3E9H A;  1I94 Q;  1Q8K A;  4GNX A;  3I3C A;  5BN5 A;  3VR6 A;  4QCL A;  4JI8 L;  2FXQ A;  3PIP A;  4HJ5 A;  3M7G A;  4MN3 A;  4JI2 L;  2EYF A;  2B2U A;  2Q8R E;  3MZ5 A;  3MEH A;  1XPU A;  2OXP A;  5HGT A;  4BBR H;  1BKB A;  2L12 A;  5DM7 3;  2DY8 A;  3S2H H;  2EDG A;  2VXW A;  2VB3 X;  2WKC A;  3VYR A;  2CQA A;  1C0A A;  1L2F A;  5BR8 L;  4A3L G;  1KNE A;  1UAP A;  1EQR A;  2K5H A;  3Q24 A;  3W3A A;  1HZA A;  5M5W B;  1R4P B;  1Y1W G;  1AZP A;  3NE5 B;  1NR2 A;  1M4V A;  4C2M H;  1ILQ A;  2EYH A;  3ULP A;  3C46 A;  3RLF A;  4BWG B;  2DNC A;  1D7Q A;  2K5D A;  4GKK Q;  4XT3 B;  2EYJ A;  3RLO A;  1DCZ A;  1PRT D;  3R2I A;  1LM0 A;  4IPD A;  4TKO B;  4R9W A;  2PNR C;  3CCJ A;  2B63 H;  2R61 A;  4I65 A;  1ASY A;  4FNF A;  2L0C A;  1EOT A;  2K05 A;  4V0B A;  2OQK A;  3I56 A;  3NTH A;  3BVG A;  2N8N A;  3TRZ A;  1X9N A;  1KL9 A;  3K57 A;  3CCM A;  2IHE A;  4A3M G;  1SAP A;  3IRB A;  4U67 3;  2A6E D;  1ASZ A;  3U4Z A;  4JOI C;  1W2B A;  2O4X A;  1CKO A;  2K03 A;  1HQM C;  1EWC A;  4OWT B;  1OXX K;  3K7U C;  2HDL A;  2B63 G;  4DUY Q;  4R4Q A;  2IJ0 A;  3MC0 B;  1KRS A;  2A19 A;  1YNN D;  3J80 L;  2Z6K C;  4AQY Q;  3F2B A;  3NHH A;  1LTA D;  5CV4 A;  4K5W A;  1TKW B;  1JOQ A;  3V96 A;  4F8M A;  1EY8 A;  4X3U A;  3H3V H;  5JAV A;  1HA6 A;  1GOZ A;  5L37 A;  1X54 A;  3I4L A;  1P8L A;  4P72 A;  4RWS C;  1EWI A;  1E0B A;  1EUJ A;  4A3J H;  1FNU A;  2MNA A;  3T4A C;  5JJL A;  3GP7 A;  5DNF A;  4C3H G;  3S14 H;  4AYB E;  1PTO B;  3KF6 A;  2K50 A;  4WFN 3;  3P1H A;  4IFD I;  2CKZ B;  4DN4 M;  3QOL A;  5IP7 H;  2L1B A;  4A93 G;  1B9N A;  2K01 A;  1CTM A;  1LTB D;  2F0G A;  1QUQ A;  3J7A F;  3MHB A;  4HIM A;  2JA9 A;  1SE4 A;  4L5R C;  4DA2 A;  4IPG A;  4G57 A;  2F0D A;  3H0G B;  3H09 A;  1EIH A;  2KQ3 A;  1JJG A;  3DXJ C;  1D5X C;  4EVO A;  3L0O A;  3SK5 A;  3QOJ A;  3AYH B;  3X3M A;  3W5O A;  1M90 C;  1Z7T A;  2EZV A;  4A3J G;  1JWS D;  3CCR A;  2TSS A;  1TII D;  4YCU A;  2D0O A;  4X3T A;  4A3K G;  4DV5 Q;  2PZW A;  2E76 C;  3J80 c;  3RD4 A;  2J0T D;  2CVR A;  4Z9C B;  3VR5 A;  1E1O A;  1NY4 A;  5EAY A;  1E7Z A;  2YU9 H;  3CME A;  2WB1 B;  1EIF A;  4MHE A;  5E7N A;  2Z9H A;  4EQN A;  3OWF A;  1YBY A;  1YHA A;  5D3D A;  1IBL L;  5JEA H;  5IGB A;  4A3K B;  1MBY A;  1W6J A;  1G51 A;  2EIF A;  4X64 Q;  3KFU A;  3GTJ H;  4JBM A;  3FP9 A;  4LUZ A;  3S17 H;  3V05 A;  4YCW A;  4F88 A;  2PZT A;  4E6I A;  4J8Q A;  1A15 A;  1Q81 C;  2A5H A;  4DV6 Q;  3AEV A;  2R93 G;  5M5X H;  4WJ4 A;  4NP5 A;  4KY5 A;  4OO1 G;  2KJX A;  4CKC A;  1VDZ A;  4FVM A;  5IWA L;  1HFN A;  2NZ1 D;  3R3O A;  4JK1 C;  1HJP A;  1D1K A;  4LFA L;  1SE3 A;  3OPO A;  1XTD A;  4IFD G;  2MQH A;  1D2B A;  4N9P A;  2AKW B;  4ZCK A;  1JB3 A;  5ELO A;  4UP9 A;  5LMN W;  1RD9 D;  3J7A 5;  2VUM G;  1H9R A;  3U58 A;  1TXY A;  4RHR A;  3HOW G;  5ELB A;  1U5K A;  3BZK A;  1HR0 L;  2OEO A;  4BBS H;  5GAD C;  1SRU A;  5HGQ A;  1A6X A;  2HT1 A;  1STG A;  3S1M H;  5FOB B;  4KJO A;  3PUW A;  1SN8 A;  1WTW A;  3CW2 C;  3NQT A;  1WCM G;  3LWE A;  4FYD A;  5NUC A;  1CM9 A;  2JA5 H;  3A55 A;  4Y7N B;  4A3D H;  2SNM A;  4DV3 Q;  1PTO D;  5DEH A;  4MZ9 A;  5G3L F;  2B2W A;  3I4M B;  1KRT A;  4LNQ A;  3KOJ A;  1SYG A;  2SNS A;  3TZU A;  5I2Y A;  5A2Q L;  1WI5 A;  4RKL A;  5C0X J;  3NBH A;  3T1Y L;  3TP5 A;  4N9T A;  4K5V A;  2CH4 A;  4ZKB B;  3TME A;  2FIN B;  1XYI A;  4JC0 A;  4DV6 L;  3TRE A;  2WKD A;  4DAY B;  1ZKO A;  1WCM B;  3KF8 A;  3NBH B;  3QIA A;  3OW7 A;  1NMG A;  1WD1 A;  2LFN A;  1U4M A;  3C3L A;  2UXC L;  4DV7 L;  1TR5 A;  4FXD A;  2NTT A;  2VW9 A;  2EY5 A;  1WCM H;  2X69 A;  1PH8 A;  1QB5 D;  1O7Y A;  4DR3 L;  4A3I G;  2RCF A;  1EEI D;  2M00 A;  1F2L A;  1PH6 A;  4JI8 Q;  3S1R B;  1HPC A;  1LV9 A;  1VQA A;  5LL6 S;  3PMF A;  5LMN Q;  3L3O C;  4XQQ A;  5AFW A;  3FMC A;  1FL0 A;  2NN6 H;  2E2D C;  3GTP B;  5M3M H;  3TP6 A;  3M4P A;  4QJF A;  2EQS A;  1O7L A;  1KDA A;  1B8A A;  2PZU A;  4GN3 B;  5M3M B;  3GTQ H;  4JI7 Q;  1FGU A;  1VQI A;  4MTK A;  3E0J A;  1A3V A;  3EJI A;  1FNW A;  5EGT A;  5ELF A;  3I72 A;  1GD7 A;  3J81 i;  3HOY G;  2VS1 A;  3A74 A;  3SGI A;  1YVC A;  1A3U A;  1EZ6 A;  3MEF A;  1X3F A;  3OMC A;  3X3N A;  4A3M B;  3FKI G;  4DV2 Q;  3PO2 G;  5IT9 c;  4A3G G;  2XN9 C;  1XNQ Q;  4GN5 A;  1AN8 A;  3TEH B;  2XWJ B;  2WAQ G;  3T1Y Q;  3KK7 A;  4GNX C;  3BZD B;  3SEB A;  4B3M L;  1KDB A;  2O5I C;  4C56 C;  1A62 A;  1UEB A;  3P20 A;  4XTC S;  2B63 B;  3W1G A;  4FXK C;  4FF1 A;  2B2V C;  2VY3 A;  2Z0S A;  1ONL A;  1BF4 A;  1VF7 A;  3G48 A;  4HCE A;  5JEA J;  1GUN A;  1JJ2 A;  1HCZ A;  2E2J H;  5FO9 B;  1TT2 A;  5LMU Q;  3HOX H;  1SYE A;  3R2T A;  1M8A A;  1STN A;  1VQD A;  2NBF A;  5CC4 A;  1EYG A;  1IKM A;  4C3J B;  1L0Y B;  3AFP A;  1C48 A;  1KDC A;  2BE5 C;  5KEE A;  5IP9 G;  3P75 A;  3MWY W;  5C5L A;  4IUU A;  4Y52 H;  2F0O A;  3MFG A;  5IP7 G;  2HQE A;  4DU9 A;  3BDL A;  5C4H A;  3HFZ B;  5C3W A;  4M8A A;  3HZX A;  1X3E A;  1I4G A;  4RGT A;  4DR7 L;  2UUC Q;  4R8I A;  1ROD A;  2YV5 A;  5IGC A;  3TQY A;  5ELN A;  1PH7 A;  2B2T C;  3J80 i;  1JB7 A;  1KD1 C;  1HFG A;  3TP7 A;  1ILP A;  1K0S A;  1S4Z A;  2ZM6 L;  4JW0 A;  3HOU G;  4A3E B;  1B50 A;  2Q8T A;  1IBM L;  3FEW X;  4TQU S;  1JOR A;  1G91 A;  3RZO B;  1A63 A;  3I4O A;  1MJE A;  1SMX A;  5COY A;  1OXU A;  4A3E H;  2F0T A;  3Q6S A;  4R4I A;  3IFD A;  2EJG C;  1BO0 A;  2OF1 A;  1WYD A;  2L55 A;  2VL6 A;  3I4N B;  2K5Q A;  1F9Q A;  1ICW A;  4A76 A;  2NVT B;  4IFD J;  3H6M A;  1BVS A;  3TBI B;  5CR3 A;  2AHO B;  2WAC A;  1NCV A;  3GD7 A;  2UXB Q;  3I4N H;  3SHL A;  3GTG B;  3RZD H;  2QEX A;  1HNW Q;  2B2Y C;  3K8A A;  1PZK D;  5M5Y H;  2LY7 A;  3F8T A;  3H3V C;  4C3J H;  4DK0 A;  2IPK D;  4OL7 A;  1Q7Y C;  2B2Y A;  4C3H B;  2MFI A;  1MIU A;  1L0X B;  2EYO A;  4NDX A;  4JVZ A;  3H91 A;  2PPB C;  1DOL A;  1PH2 A;  3ND8 A;  3E6Z X;  4GLA C;  4NMZ A;  3STB C;  3A8I E;  2K7V A;  4FF4 A;  2BE5 D;  3UDG A;  4DR2 L;  4HCS A;  1LT4 D;  3GTP H;  1HR0 W;  4PZ8 A;  5FK9 C;  4ZUI A;  1CFM A;  1XMO L;  3UDX A;  1C7Y A;  4KK7 A;  4M1U B;  2BH8 A;  4JYA L;  3ERO A;  1JE5 A;  3FHW A;  2R6G A;  3SK4 A;  2MP1 A;  4RMF A;  1KNA A;  2I5M X;  2F0S A;  2ZXO A;  4DK1 A;  2E2I B;  1PVO A;  1X65 A;  2UUB Q;  2UUA L;  2NVQ B;  1XNQ L;  1SNQ A;  1Q90 A;  1SFO B;  2UXC Q;  3T13 A;  1S5D D;  4CDD C;  1E1T A;  1JQY D;  4B9X A;  4YY3 L;  4YHH L;  3HP3 A;  4LF4 Q;  3RN2 A;  3F1Z A;  3TP8 A;  1NAP A;  2UUB L;  3T51 B;  4JI7 L;  1Y1V G;  1YEZ A;  5JPN C;  1MHW C;  2PW5 A;  2NVY H;  3R8B A;  1FD7 D;  3I4M G;  2I5L X;  1SMY D;  4DUY L;  2BDN A;  4NPS A;  1NMF A;  1XX8 A;  4DR5 Q;  1BUV T;  3T1H Q;  1VQ9 A;  3BZC A;  3KLS A;  4K6D A;  1V1P B;  4NB3 A;  5FJ8 H;  2F0N A;  1PHJ A;  4KHP Q;  3BVZ A;  1GXD C;  3M3Y H;  4GNX B;  3H0G G;  3T53 B;  5DAU A;  5JEA G;  5I9O A;  1YNN C;  2MUY A;  2H4O A;  3HKZ B;  1CZW A;  1N8R C;  2B8G A;  1SYF A;  1HR0 Q;  1EYD A;  1IZ6 A;  1I6H B;  3K6O A;  1N36 L;  3K59 A;  3CQZ H;  1C9O A;  5IYC G;  3GTJ B;  1BR9 A;  3NUC A;  4P2C B;  4KTA A;  2JYO A;  2EYM A;  4FXG C;  2IT1 A;  4JI1 Q;  3NWT A;  3C1E A;  1AW7 A;  5C44 G;  2UUA Q;  1Q46 A;  1ENA A;  5IYD H;  4IUR A;  2EYP A;  1KIX A;  4XDX A;  3ONA B;  3SXH A;  3S2D H;  2AQ3 B;  2HHH Q;  1U4P A;  1Y8O B;  1SNM A;  3CPF A;  2Q2H A;  4LWC A;  1PH9 A;  1NSN S;  5IYB H;  1SE2 A;  1HH2 P;  4EQP A;  1B3A A;  4C3I G;  2VUM H;  3DM3 A;  4A3G B;  2JA6 B;  1LT3 D;  1WTP A;  1STB A;  2K5W A;  2EXZ A;  2VQE L;  4DUZ Q;  1NJI C;  1VQO A;  3URY A;  3CCL A;  2Q2I A;  4JOI A;  1HNZ L;  2NVT H;  2CW0 D;  3H15 A;  4IUV A;  2PW7 A;  1EY5 A;  1PXU A;  5FKA C;  2H5X A;  2DN8 A;  2JA5 G;  4OON A;  3PF4 A;  4DR2 Q;  4A3D G;  2Y0S E;  2JK8 A;  4PG3 A;  4JG2 A;  4Y7N H;  4DK3 C;  2CWP A;  3KLR A;  2F0L A;  1S72 A;  1HTP A;  2Q8I B;  4B3M Q;  2F0I A;  5FO7 B;  1SEB D;  2K5V A;  2MO1 A;  3G7L A;  3GTK H;  4HED A;  1WJJ A;  2V1C C;  2ZTD A;  3S2H B;  1B44 D;  3ITP A;  4HIK A;  1PYB A;  3GTM H;  4R4T A;  2F0U A;  2R92 H;  1AP0 A;  1PFS A;  1CKN B;  1B3Q A;  1DON A;  1Q12 A;  2L9H A;  2XTI A;  4DUZ L;  3HKS A;  3DWQ A;  5C3E B;  4NXN Q;  1KC8 C;  1BCP B;  2OT2 A;  1WTX A;  1VMC A;  4GKJ L;  3BYT B;  2SOB A;  3H94 A;  5EKI A;  4A3J B;  2RCN A;  1MI2 A;  2IX1 A;  3K7A B;  2K6A A;  3DEP A;  2OCE A;  3PIO A;  2VQE Q;  4NXN L;  3K5O A;  3DWA A;  1SFO H;  3CU7 A;  4CDF C;  1BCP F;  3K7A H;  5LHY 1;  3HOV G;  1ESF A;  2AUJ D;  3NSW A;  1OO9 B;  1YHQ A;  5I2X A;  1Y1V H;  1LTS D;  3I90 A;  1GUS A;  2KVM A;  2PMZ E;  1HZC A;  1XNR L;  4DR1 Q;  2QCP X;  4I7A A;  2EJM A;  5IT9 L;  1B1Z A;  2J4X A;  5E4W C;  4A3B G;  4XXE A;  5M9O A;  1N36 Q;  4F7X A;  3J7Z C;  2WIN B;  4X66 Q;  3CCU A;  4R4O A;  1GUW A;  2LMC B;  2QGQ A;  1Y14 B;  1EQT A;  1X55 A;  1UE6 A;  2YTV A;  2F0M A;  4IJH A;  1PA6 A;  3SVM A;  2AQ2 B;  4H7B A;  3VR2 A;  5IGF A;  1CUK A;  1PLF A;  4FF2 A;  5LMN L;  2JN4 A;  5DM6 3;  4RH6 A;  1AE3 A;  1AFP A;  1DOK A;  2N78 A;  5D14 A;  2E74 C;  4ABN A;  4WOR A;  1A2T A;  3C2P A;  1S5B D;  4QB4 A;  3PGZ A;  1XPR A;  1LTR D;  4OGQ C;  1DJR D;  4P74 A;  2A6E C;  5GAE C;  1RL2 A;  4BA1 I;  1OXS C;  4GS3 A;  4HJ7 A;  3RUZ A;  2DGY A;  5C3E G;  3T1H L;  2Z6B A;  2FMM A;  2LKV A;  3DEO A;  3IKJ A;  3EQL C;  3CMA A;  2NN6 G;  1G2S A;  3BU2 A;  3J81 L;  1QCB D;  2TMP A;  1X32 A;  2VB2 X;  3HOW B;  3CXC A;  2C5C A;  5HY6 A;  4YWM A;  1YJ9 A;  2L5T A;  3CPW A;  1I4X A;  5GAH C;  4LF6 Q;  1BCP C;  2YYZ A;  1VQF A;  3FRP B;  3CRK C;  1STA A;  5ELD A;  1TY2 A;  4OXP A;  3WOE A;  3OIQ A;  1QUQ B;  1E22 A;  4OWX B;  1UWV A;  1EY0 A;  4CJ1 B;  3AB9 A;  3VR4 A;  5CV5 A;  4IUT A;  2CH4 W;  3KUP A;  2WII B;  1N32 L;  1O78 A;  3KJP A;  2HDM A;  2A6H D;  5LMU L;  3DHQ A;  4Q0F A;  2B2T A;  3A5U A;  4MNO A;  1CKM A;  2NVX H;  2RKS A;  1N33 L;  1G6P A;  1HZB A;  3K5N A;  2NTS A;  1VQB A;  4C3I B;  3M4O H;  2QIL A;  1BBW A;  1H9J A;  5CV6 A;  2MHV A;  3CCQ A;  2J7Z A;  5FLX E;  2OTL A;  1IYU A;  3STB D;  1EIY B;  4LF8 Q;  1YJN A;  2RF4 A;  1E2V A;  1EU4 A;  2PYK A;  3E5S A;  4R1J A;  1R9T H;  4B3T L;  3I8Z A;  1A2U A;  4WJ3 M;  2F0H A;  5IP9 H;  1MD2 D;  1TWG H;  3LX0 A;  4A75 A;  1FNV A;  5C4J H;  2BA0 A;  2EY1 A;  3DMU A;  2MJ8 A;  4H44 C;  2NZO A;  1HNW L;  2VZA A;  4PZ7 A;  3SE0 A;  3ZYY X;  4OHJ A;  1SYC A;  1YNJ C;  5C44 H;  4GZY C;  1G2T A;  4S3S A;  2CHB D;  5M5W H;  1N32 Q;  1LLR D;  1VQH A;  1LT5 D;  1SYB A;  1TWC B;  2Z4I A;  1EFI D;  1I5F A;  4RCO A;  5COR A;  1GM5 A;  4JBK A;  2AQ1 B;  3RNU A;  4LF9 Q;  2KEC A;  4H02 A;  4KN7 C;  1Q86 C;  2FHT A;  3D31 A;  2JA8 B;  2XNA C;  4IQZ A;  1BOS A;  4ALP A;  4L6T B;  2M2L A;  3CAM A;  1LTG D;  3FPU B;  1Y1V B;  5JJI A;  3ZJY C;  3GQB A;  1Y1W B;  1PV4 A;  1GHK A;  2HUG A;  3KDF B;  3NPP A;  2JA6 G;  3L9A X;  4JI0 Q;  3J7A V;  1I4R A;  3KF8 B;  4RAU C;  1HZ9 A;  1F9P A;  5J1Z A;  2NYZ D;  2ZXR A;  4B3R L;  3N52 A;  4XQN A;  4A3C G;  1JWU D;  4IO9 A;  3UI2 A;  4APV A;  3KLS X;  4JI1 L;  4OEL B;  4UPA A;  1EY9 A;  2LXK A;  4UY8 C;  2JA8 G;  4A3D B;  4QUF A;  2JA5 B;  2F0P A;  2B2V A;  1OXT A;  4GOP B;  2GN5 A;  2LS0 1;  3I4M H;  4GKJ Q;  3TSS A;  2DUD A;  3D4D A;  4ZYS A;  1HQR D;  3S16 H;  1S5C D;  3LWU A;  4A3L H;  3GV3 A;  3A8K E;  3P7J A;  4X65 L;  4OO1 H;  1K9M C;  3S1N H;  3A7L A;  2D2C C;  2BA1 A;  1STH A;  3IAY A;  4LF5 Q;  1CKN A;  1SR3 A;  1IBL Q;  2D0P A;  2R7Z H;  2FJ2 A;  1F9S A;  2E8G A;  1EYA A;  3PCO B;  3I73 A;  1TVX A;  2ALY B;  2I5H A;  1QVG A;  4DR6 L;  2WP8 J;  4ZAI A;  4K2K A;  5KNC A;  1GHJ A;  5EBC A;  5C44 B;  4UAI A;  2BH2 A;  4GN4 B;  5FO8 B;  2LXJ A;  2JXM B;  1I3Q B;  1GVP A;  1MKH A;  3KLW A;  3M85 A;  1U9R A;  1K73 C;  4IPH A;  1Q3L A;  1IKL A;  1TU2 B;  4RG1 A;  1J5E Q;  4ULL A;  1HTL D;  3SK6 A;  2V4D A;  2ZJQ A;  4ZK9 B;  2A8V A;  3D8G A;  5M3F H;  3H0G H;  2F4I A;  3JC6 6;  4NXM Q;  4ZRZ A;  2ENB A;  3G4S A;  5IWA Q;  4DAM A;  5KNB A;  2NB0 A;  4R8N A;  4KHP L;  3PV0 A;  4K5X A;  2IX3 A;  1EY6 A;  4QGU A;  3J81 E;  1S40 A;  3OWE B;  3I7F A;  4J6H A;  4EQ5 A;  3T16 A;  4JI2 Q;  4CKE A;  1QOH A;  3E9I A;  1AH9 A;  2RHQ B;  3QR8 A;  4DAY A;  1EU3 A;  3FKI H;  2WB1 G;  3S1N B;  3BVM A;  2XGT A;  2ZJR A;  2E2H H;  4DR6 Q;  2MO0 A;  1IHZ A;  1PH5 A;  1X56 A;  2VNU D;  1TWH B;  5EPK A;  3S15 B;  1Y8N B;  4KLK A;  1E2Z A;  1CI3 M;  1D8L A;  1SE8 A;  3CC4 A;  1ZYR D;  2CQO A;  2UU9 Q;  3S14 B;  4MIU A;  2PQA B;  2ZXP A;  1Z9F A;  2K28 A;  4JYA Q;  2K33 A;  1VQE A;  2UXB L;  3CKI B;  3EBE A;  1C4Q A;  5C6A A;  3LGJ A;  2NWG A;  2KHJ A;  3I55 A;  5IGD A;  1QVC A;  2JP1 A;  1I6H H;  4BXX G;  1PH3 A;  2R92 B;  1B7Y B;  4RHS A;  1ML0 D;  2K52 A;  4EQO A;  1WTQ A;  4JCV E;  3CF5 A;  2R93 B;  4DV7 Q;  3CRL C;  1UEA B;  1HHV A;  1S3O A;  3S1Q B;  1SNO A;  2XVS A;  2NUC A;  2EXD A;  5CV9 A;  1DYQ A;  4DXG A;  1PFM A;  2K32 A;  3OOC A;  2BCO A;  5IIF A;  4DV5 L;  3J81 c;  4HJA A;  2I0Q A;  1K28 A;  3NEM A;  3Q0A A;  3C1F A;  1ENF A;  5BN4 A;  1JWM D;  1E24 A;  2UUC L;  1CA6 A;  2A1A A;  3HG9 A;  4O1N A;  2RBM A;  1XWE A;  2B8F A;  5D65 A;  1W3S A;  4DV3 L;  2X6G A;  4OX9 Q;  1RF2 D;  4LMQ D;  1JIC A;  1HA5 A;  4DK6 C;  4J1M A;  2KCC A;  5HUR A;  3BJU A;  4A3E G;  1K8M A;  1TWH H;  1RTO A;  5KRU A;  1IBM Q;  2UU9 L;  1AE2 A;  3S15 H;  1O7Z A;  3D0F A;  4RKB A;  5EKK A;  4C2M B;  4ID6 A;  1XMQ Q;  2RSO A;  1SDF A;  4GLV B;  4C3H H;  3S1M B;  3TN2 A;  1IYV A;  4EGV A;  2JSO A;  3IL8 A;  4L63 B;  3GDE A;  4HN7 A;  4DKA C;  1D5Z C;  3A7A B;  4B08 A;  1VQP A;  1I50 H;  2OTJ A;  1IXR A;  4ME5 A;  4CDE C;  4JI4 Q;  1TS5 A;  2N3S A;  5CBE E;  3AMU A;  1YI2 A;  3MTS A;  3ERQ A;  3SK8 A;  1U4L A;  3CQZ B;  3PQI A;  2ZJP A;  2PNH A;  1DXM A;  1XTC D;  4DV2 L;  1ESR A;  3RMH A;  1PH1 A;  1V1P A;  1FYC A;  1L1O A;  2A69 D;  3E3X A;  3DUZ A;  1LUZ A;  5KIX A;  4PZ6 A;  3TDQ A;  1GO3 E;  5GQO A;  1VQC A;  3U9S A;  3NQI A;  4ME3 A;  4P73 A;  2JA6 H;  5C5M A;  2OWO A;  2C9O A;  3PO2 B;  2KHI A;  3U9O A;  3KDF A;  2NZH A;  2KCM A;  4CKB A;  3M7N A;  3AU7 A;  4N8F A;  2RDF A;  3PO2 H;  4AYB G;  1K83 H;  1A3T A;  4GKK L;  1UE7 A;  4DR4 L;  2E2H B;  1HRJ A;  2RA4 A;  2B29 A;  3QWN A;  4QUC A;  4LF9 L;  3PUY A;  1SMY C;  4A3F H;  4DR3 Q;  5KND A;  3GTG H;  4XYQ A;  5A35 A;  1G8Z D;  4LUO A;  1EY7 A;  4DR4 Q;  4KKU A;  1JOK A;  2XWB B;  4BA2 I;  1IBK Q;  4DR7 Q;  4ZLT F;  5IYD G;  1PDQ A;  4NKL A;  3KBG A;  5FJ8 G;  2B3G A;  1YZ6 A;  3HKZ G;  2HCC A;  1VQ4 A;  3HOX B;  3PO3 G;  1S5E D;  5C0X G;  1EZ8 A;  1NE3 A;  1YJW A;  2B2U C;  4TSS A;  3UDF A;  2L4N A;  3SR1 A;  1LT6 D;  4FDB A;  3MXU A;  4X64 L;  2Z4H A;  4UHV A;  4KHZ A;  5EJW A;  3TS2 A;  3JAM c;  4H13 C;  2EVB A;  1ET6 A;  5C4X B;  3GTQ B;  3H3V I;  1LTL A;  1T5X D;  2JJQ A;  4DR1 L;  1B53 A;  3IFT A;  2HQL A;  4DV0 Q;  1H9K A;  2FFK B;  3E0E A;  1NTG A;  4CJ0 B;  4OWW B;  3HOZ B;  1FVI A;  5IOC A;  1LO5 D;  4X66 L;  1RCV D;  1PFB A;  3MA2 B;  3FPP A;  2B2W C;  2JEB I;  2ZM6 Q;  5H1S E;  1V9P A;  5KYL A;  3R93 A;  5KGU A;  2JA8 H;  1F2Y A;  3MVV A;  1K8G A;  4CDC C;  1HNX Q;  3PIP 3;  1F2M A;  5C4Z A;  4QIW E;  3NEN A;  4BXX H;  4L5S A;  4ZUJ A;  3O13 A;  1JOO A;  4K14 A;  4G7Z C;  2NVY B;  4KI0 A;  1HXY D;  2KUM A;  3A54 A;  4Q5V A;  1PH4 A;  1MGS A;  1TWF H;  1GUO A;  2ATW A;  5AJ3 L;  3WOF A;  3NEL A;  1JC7 A;  4JBJ A;  1KAW A;  1SNP A;  2D9U A;  2QA4 A;  1WTV A;  4I7Z C;  2RVL A;  2CWA A;  2WAQ E;  2IW3 A;  3AFQ A;  3J7Y W;  1X6O A;  3CD6 A;  1SSO A;  1EEF D;  1WTO A;  1XMO Q;  4UP7 A;  3I4N G;  1X3Q A;  3RZO H;  1MSH A;  3HOY B; 
#chains in the Genus database with same CATH homology
 4B3S Q;  1N33 L;  1G6P A;  3J81 i;  4B3T Q;  1HZB A;  3HOY G;  2VS1 A;  3A74 A;  4B3R Q;  3SGI A;  1YVC A;  1VQB A;  1M1K C;  3MEF A;  3M4O H;  1BBW A;  3CCQ A;  2OTL A;  1X3F A;  3STB D;  1EIY B;  3M4Q A;  4LF8 Q;  3HOV H;  3FKI G;  4DV2 Q;  3PO2 G;  5IT9 c;  1YJN A;  2RF4 A;  4A3G G;  1HNZ Q;  1QZG A;  4JI0 L;  3CCV A;  1XNQ Q;  4R1J A;  4GN5 A;  1R9T H;  3UE0 A;  4DV1 Q;  4B3T L;  3TEH B;  3OTO L;  4AH6 A;  1CSP A;  5FLM G;  5C3E H;  4WJ3 M;  2WAQ G;  3AQQ A;  1GD7 A;  3T1Y Q;  5IP9 H;  1VQN A;  1VQ6 A;  4GNX C;  1TWG H;  4A75 A;  4B3M L;  3HOW H;  5IY0 A;  5C4J H;  2NVQ H;  5C0X I;  1VQ7 A;  1I3Q H;  2BA0 A;  1A62 A;  1UEB A;  4XTC S;  4YY3 Q;  5AJ3 Q;  2NZO A;  3W1G A;  4A3B H;  1V1Q A;  3ULJ A;  2UXD L;  1HNW L;  2VY3 A;  2VZA A;  4L5Q A;  4PZ7 A;  3L2P A;  2Z0S A;  2PQA A;  1A0I A;  5J3B A;  2NVX H;  4JI5 L;  4HJ9 A;  3ICE A;  2ASB A;  5C44 H;  1JMC A;  1VQL A;  4AIM A;  3G48 A;  5M3F G;  5JEA J;  1JJ2 A;  2E2J H;  3KF6 B;  3G6E A;  5M5W H;  1N32 Q;  4P75 A;  5LMU Q;  1VQH A;  2K5N A;  2K4K A;  3RR5 A;  3KJO A;  3HOX H;  4LF6 L;  1VQD A;  1EYG A;  3ERS X;  1I5F A;  1GM5 A;  3AFP A;  4JBK A;  3RNU A;  4J15 A;  4LF9 Q;  1YIT A;  5IP9 G;  4H02 A;  3K0X A;  1Q86 C;  3K81 C;  3D31 A;  4JI3 Q;  2VQF Q;  1QVF A;  5IE8 A;  4Y52 H;  1EFW A;  5IP7 G;  5M3M G;  1KHI A;  4ALP A;  4O0A A;  3CAM A;  3PUX A;  2JQO A;  3HFZ B;  1VQJ A;  2D62 A;  5GAG C;  2IHF A;  5JJI A;  3ZJY C;  1T9H A;  1PV4 A;  1X3E A;  2JA6 G;  3KDF B;  2F3I A;  4YWL A;  4JI0 Q;  4DR7 L;  3TS0 A;  4IFD J;  3KF8 B;  4XIG S;  2UUC Q;  4DV4 L;  4P71 A;  1N34 Q;  3CCE A;  3S1R H;  2AWO A;  1HZ9 A;  2Q2T A;  2YV5 A;  4IOC A;  3TQY A;  5ELN A;  1PH7 A;  2Q2U A;  4B3S L;  4LF7 L;  1N33 Q;  3VDY A;  2ZTE A;  4B3R L;  4A3C G;  4AQY L;  4IO9 A;  3HOY H;  4APV A;  3J80 i;  1U0L A;  4JI1 L;  1JB7 A;  1KD1 C;  4UPA A;  1KQS A;  2LXK A;  4LUV A;  4UY8 C;  2JA8 G;  2R7Z G;  4K0K L;  1KXL A;  4QL5 A;  1EOV A;  2IX0 A;  1OXT A;  4GOP B;  2GN5 A;  3B6Y A;  2WFW A;  4BBS G;  3I4M H;  1SRO A;  2ZM6 L;  4GKJ Q;  3HOU G;  2DUD A;  1SLJ A;  1H95 A;  2E2I H;  3S16 H;  3CCS A;  1IBM L;  5JJK A;  2GVB A;  4A3L H;  4TQU S;  5IYB G;  3PUV A;  4X65 L;  4QY7 A;  1K9M C;  1A63 A;  4DV0 L;  4LFB L;  3I4O A;  1MJE A;  3S1N H;  1SMX A;  1X3G A;  3ER0 A;  1OXU A;  2BA1 A;  2KEN A;  4A3E H;  1EQQ A;  2JA7 G;  1YNX A;  4C3I H;  4LF5 Q;  1CKN A;  1SR3 A;  4R4I A;  4X62 L;  3UDI A;  1IBL Q;  4OX9 L;  2D0P A;  4POF A;  2R7Z H;  1J6Q A;  2PI2 A;  4R4C A;  4BY1 H;  2E8G A;  2HIV A;  1WYD A;  3PCO B;  2F52 A;  2VL6 A;  2K14 A;  1G29 1;  4A76 A;  3HOX G;  1YIJ A;  2ALY B;  2I5H A;  4LFB Q;  1BVS A;  3UE1 A;  1QVG A;  1JJC B;  2WP8 J;  4LF4 L;  4DR6 L;  4YHH Q;  1GKH A;  3DLL A;  2AHO B;  1LYL A;  2Y0S G;  3GD7 A;  2UXB Q;  3I4N H;  2BH2 A;  1J5E L;  2C35 B;  4GN4 B;  3RZD H;  2QEX A;  1HNW Q;  2LXJ A;  4DR5 L;  4YCV A;  4X6A H;  3K8A A;  3A0J A;  5IYC H;  1L1O C;  1GVP A;  1MKH A;  3KLW A;  5M5Y H;  3M85 A;  1K73 C;  4IPH A;  1N34 L;  2IY5 B;  5FLM H;  4JI3 L;  2CCZ A;  3F8T A;  1RIP A;  1OTC A;  1VCI A;  4RG1 A;  2L15 A;  3U50 C;  4C3J H;  2R93 H;  2RHS B;  3EN2 A;  4MTN A;  1Q7Y C;  1O7I A;  1J5E Q;  2MFI A;  1MIU A;  2NN6 I;  4LW1 A;  1PH2 A;  1L0W A;  4GLA C;  4BY1 G;  2ZJQ A;  3STB C;  3JAM i;  2A8V A;  4IPC A;  1TWC H;  3UDG A;  3E9H A;  3J81 j;  1I94 Q;  1CSQ A;  3H0G H;  5M3F H;  4DR2 L;  1Q8K A;  4GNX A;  3JC6 6;  4GOP A;  4NXM Q;  1P16 A;  3GTP H;  1HR0 W;  4PZ8 A;  1XMO L;  3G4S A;  5IWA Q;  3U4V A;  3UDX A;  4JI8 L;  2FXQ A;  3PIP A;  3G71 A;  4DAM A;  1VS0 A;  4HJ5 A;  1C7Y A;  2R92 G;  4JV5 Q;  4JI2 L;  2BH8 A;  2JA6 H;  3GTL H;  4JYA L;  4KHP L;  3PV0 A;  2Z6K A;  1XPU A;  4GOP C;  1A8V A;  4QGU A;  1S40 A;  1JE5 A;  3FHW A;  4BBR H;  1K3R A;  2R6G A;  1BKB A;  4RMF A;  3S2H H;  2I5M X;  3I7F A;  2ES2 A;  4EQ5 A;  3A5Z B;  4JI2 Q;  2GVA A;  1C0A A;  1L2F A;  5BR8 L;  4A3L G;  1PVO A;  1X65 A;  3E9I A;  1EQR A;  2K5H A;  1AH9 A;  2RHQ B;  4DV1 L;  1HZA A;  2UUB Q;  2UUA L;  1XNQ L;  3FKI H;  1HNX L;  1Y1W G;  2UXC Q;  2WB1 G;  4LFC Q;  5DLQ E;  1E1T A;  2XGT A;  4C2M H;  2ZJR A;  4HID A;  4YY3 L;  4YHH L;  3ULP A;  2E2H H;  1WOC A;  3RLF A;  4LF4 Q;  4DR6 Q;  2MO0 A;  3RN2 A;  1D7Q A;  1PYS B;  3F1Z A;  4GKK Q;  1PH5 A;  2F4V L;  3I2Z A;  3RLO A;  2UUB L;  4JI7 L;  1LM0 A;  1X56 A;  1Y1V G;  1YEZ A;  2VNU D;  4IPD A;  4KLK A;  2NVY H;  3I4M G;  3CCJ A;  2I5L X;  4DUY L;  1D8L A;  4NPS A;  2B63 H;  1NMF A;  1SE8 A;  4DR5 Q;  3CC4 A;  4JI6 L;  1UE5 A;  3T1H Q;  1ASY A;  2CQO A;  1VQ9 A;  2UU9 Q;  3BZC A;  4EX5 A;  2PQA B;  2OQK A;  4A93 H;  3I56 A;  1Z9F A;  2JEA I;  4NB3 A;  5FJ8 H;  1PHJ A;  4JYA Q;  4A3G H;  3OW2 A;  1VQE A;  1L1O B;  3M3Y H;  4KHP Q;  2UXB L;  2N8N A;  4GNX B;  3TRZ A;  3EBE A;  1KL9 A;  3H0G G;  1X9N A;  3CCM A;  2IHE A;  1FJG L;  5JEA G;  4A3M G;  3LGJ A;  4JI5 Q;  2KHJ A;  3I55 A;  1QVC A;  4IJL A;  2AWN A;  1I6H H;  1N8R C;  3IRB A;  4BXX G;  4A3I H;  1PH3 A;  1ASZ A;  1HR0 Q;  3U4Z A;  1B7Y B;  1NBW A;  4JOI C;  2JA7 H;  2K52 A;  1W2B A;  1IYJ B;  1CKO A;  1IZ6 A;  4JCV E;  3CF5 A;  1V43 A;  4DV7 Q;  4WJ4 A;  4OWT B;  1OXX K;  2WB1 E;  1S3O A;  3K7U C;  1N36 L;  3CQZ H;  4O2D A;  2B63 G;  4DUY Q;  4PMW A;  1C9O A;  4R4Q A;  5IYC G;  1UE1 A;  1TWA H;  2EXD A;  1KRS A;  3OYY A;  2IT1 A;  2A19 A;  4JI1 Q;  5C4X G;  2Z6K C;  4AQY Q;  3F2B A;  4QQB X;  4DV5 L;  3J81 c;  4HJA A;  2I0Q A;  5C44 G;  3NEM A;  2UUA Q;  4IOA A;  1Q46 A;  3H3V H;  5IYD H;  1E24 A;  4A3F G;  2UUC L;  3KYH C;  1KIX A;  1X54 A;  2A1A A;  1P8L A;  4P72 A;  1EWI A;  1W3S A;  1EUJ A;  5C4X H;  4DV3 L;  4A3J H;  3S2D H;  2HHH Q;  2MNA A;  2YTY A;  3CPF A;  2Q2H A;  4OX9 Q;  5JJL A;  4LWC A;  4DK6 C;  5IYB H;  3PF5 A;  1PH9 A;  1JT8 A;  1HH2 P;  3PSI A;  3S14 H;  1DGS A;  4AYB E;  3KF6 A;  2K50 A;  4IFD I;  2CKZ B;  3RLN A;  3M9B A;  5IP7 H;  1FJG Q;  2VUM H;  3BJU A;  3DM3 A;  4A3E G;  4A93 G;  4DNI A;  4BBR G;  1XPO A;  4DPG A;  1TWH H;  4X65 Q;  1IBM Q;  2UU9 L;  3S15 H;  1AE2 A;  2VQE L;  1QUQ A;  3HOZ H;  4HIM A;  4DUZ Q;  2JA9 A;  1VQO A;  1NJI C;  4L5R C;  3D0F A;  4JV5 L;  4IPG A;  1IBK L;  1Q82 C;  3CCL A;  2Q2I A;  4JOI A;  4A4I A;  1HNZ L;  2NVT H;  1JJG A;  3H15 A;  1XMQ Q;  2AMC B;  1E3P A;  1XNR Q;  3L0O A;  4GLV B;  4C3H H;  3AYH B;  2H5X A;  2JA5 G;  4A3D G;  4OON A;  3PF4 A;  4DR2 Q;  3W5O A;  1M90 C;  4A3C H;  3GDE A;  4A3J G;  2Y0S E;  2JK8 A;  4PG3 A;  4DKA C;  3CC7 A;  3CCR A;  4YCU A;  4LF7 Q;  1OXV A;  2D0O A;  4JG2 A;  4A3K G;  4Y7N H;  4DV5 Q;  2KBN A;  4DK3 C;  2CWP A;  1I50 H;  1N9W A;  2CFM A;  1VQP A;  2OTJ A;  1VQM A;  1IL2 A;  3J80 c;  1IXR A;  1S72 A;  3K80 C;  4JI4 Q;  4B3M Q;  2N3S A;  1E1O A;  2K5V A;  1NY4 A;  2HIX A;  2MO1 A;  5EAY A;  1E7Z A;  1YI2 A;  2ZJP A;  2YU9 H;  3S1Q H;  3L7Z C;  3CME A;  1EIF A;  3GTK H;  1WJJ A;  2V1C C;  2YTX A;  2ZTD A;  2ID0 A;  2PNH A;  5E7N A;  4DV2 L;  3F2D A;  4HIK A;  1PYB A;  3GTM H;  1YBY A;  1YHA A;  2PI2 E;  4R4T A;  1PH1 A;  4LFC L;  4X62 Q;  4A3M H;  1IBL L;  2R92 H;  1L1O A;  1PFS A;  1WFQ A;  4TVA B;  1CKN B;  1LUZ A;  2OQ0 A;  1Q12 A;  2XTI A;  4PZ6 A;  4DUZ L;  1G51 A;  1BBU A;  3HKS A;  2EIF A;  1Q1E A;  2LSS A;  4X64 Q;  1KC8 C;  2HHH L;  4NXM L;  4NXN Q;  3KFU A;  1GO3 E;  5GQO A;  1VQC A;  2R7F A;  4JBW A;  1XMQ L;  4ME3 A;  4P73 A;  3FP9 A;  4LUZ A;  4YWK A;  3GTJ H;  4JBM A;  2OWO A;  3S17 H;  4YCW A;  4GKJ L;  2UXD Q;  5K36 G;  3RN5 A;  3HOZ G;  2RCN A;  2IX1 A;  1Q81 C;  1XJV A;  2KHI A;  4JI6 Q;  4DV6 Q;  3AEV A;  2R93 G;  2OCE A;  3CP0 A;  2NZH A;  3KDF A;  5M5X H;  3PIO A;  2VQE Q;  3PUZ A;  3CC2 A;  2KCM A;  4NXN L;  3M7N A;  3S24 A;  4OO1 G;  4BY7 H;  1SFO H;  5IWA L;  4POG A;  3K7A H;  4AYB G;  1K83 H;  3PO2 H;  3HOV G;  4GKK L;  1UE7 A;  1MJC A;  2F4V Q;  3MXN B;  3PO3 H;  1HJP A;  4DR4 L;  4DV4 Q;  3W1B A;  1YHQ A;  4JI4 L;  2B29 A;  4LFA L;  1XTD A;  1Y1V H;  4LF9 L;  3PUY A;  2E5L Q;  4A3F H;  4DR3 Q;  3Q8D A;  4IFD G;  2PMZ E;  2MQH A;  1HZC A;  1XNR L;  3GTG H;  2AKW B;  4L5T A;  4DR1 Q;  4LUO A;  4DR4 Q;  4BY7 G;  4BA2 I;  5ELO A;  4UP9 A;  5LMN W;  1IBK Q;  4DR7 Q;  4LF5 L;  5IYD G;  4A3B G;  1N36 Q;  5FJ8 G;  2B3G A;  1YZ6 A;  3HKZ G;  3J7Z C;  4X66 Q;  1VQ4 A;  3J7A 5;  2VUM G;  3CCU A;  4R4O A;  3PO3 G;  5C0X G;  3U58 A;  1TXY A;  1NE3 A;  2QGQ A;  1YJW A;  1Y14 B;  3HOW G;  3UDF A;  1U5K A;  3BZK A;  1HR0 L;  1X55 A;  2KCT A;  4FDB A;  1UE6 A;  2YTV A;  4IJH A;  1PA6 A;  4X64 L;  1SRU A;  5GAD C;  4BBS H;  5HGQ A;  3HOU H;  1CUK A;  2HT1 A;  4KHZ A;  3ULL A;  3S1M H;  3JAM c;  3TS2 A;  5LMN L;  1VQK A;  3PUW A;  1AE3 A;  1SN8 A;  1I94 L;  3CW2 C;  2N78 A;  1WCM G;  1VQ8 A;  3H3V I;  1LTL A;  2JJQ A;  2JA5 H;  4A3D H;  4DV3 Q;  5FLX c;  2K75 A;  4DR1 L;  4MZ9 A;  2HQL A;  3GO5 A;  1KRT A;  4LNQ A;  3KOJ A;  3PGZ A;  4DV0 Q;  1XPR A;  3E0E A;  1NTG A;  4OWW B;  1WI5 A;  4LFA Q;  4P74 A;  3OTO Q;  1QZH A;  5GAE C;  3F2C A;  1FVI A;  1RL2 A;  5C0X J;  3T1Y L;  4X66 L;  4BA1 I;  2ZM6 Q;  2JEB I;  1VQG A;  1OXS C;  5H1S E;  5GRO A;  4GS3 A;  1YHB A;  4HJ7 A;  2DGY A;  5C3E G;  4JC0 A;  1V9P A;  2N49 A;  1K0R A;  3TRE A;  4DV6 L;  3T1H L;  4DAY B;  3NBH B;  4GLX A;  3CMA A;  2NN6 G;  3BU2 A;  4A3K H;  2JA8 H;  2ZTC A;  1NMG A;  4HJ8 A;  2UXC L;  4DV7 L;  1K8G A;  3CXC A;  1HNX Q;  5HY6 A;  4HIO A;  2VW9 A;  2E5L L;  1WCM H;  1Z47 A;  1Q1B A;  4QIW E;  4YWM A;  1YJ9 A;  3HKZ E;  3NEN A;  1Y1W H;  1PH8 A;  3CPW A;  4DR3 L;  4L5S A;  3GTO H;  4BXX H;  4A3I G;  5GAH C;  4LF6 Q;  1PH6 A;  2YYZ A;  1VQF A;  3EIV A;  4KI0 A;  4JI8 Q;  1VQA A;  1PH4 A;  1TWF H;  5BR8 Q;  2ATW A;  5AJ3 L;  5LMN Q;  4OXP A;  3NEL A;  1FL0 A;  4UP8 A;  4JBJ A;  1KAW A;  1QUQ B;  2VQF L;  1E22 A;  5M3M H;  1B70 B;  4OWX B;  1UWV A;  3M4P A;  2QA4 A;  4QJF A;  1K8A C;  2EQS A;  1VQ5 A;  2CWA A;  2WAQ E;  1N32 L;  1B8A A;  3AFQ A;  4GN3 B;  3KJP A;  3GTQ H;  1X6O A;  2JE6 I;  4K0K Q;  5LMU L;  3CD6 A;  4JI7 Q;  4OO1 I;  2R7D A;  1FGU A;  1VQI A;  4LF8 L;  1XMO Q;  3A5U A;  4UP7 A;  4MNO A;  3I4N G;  3WWV A;  3RZO H;  1CKM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...