1HRFA

Solution structure of the epidermal growth factor-like domain of heregulin-alpha, a ligand for p180erb4
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
67
structure length
67
Chain Sequence
GTSHLVKCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCQPGFTGARCTENVPMKVQNQEKAEELYQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Solution structure of the epidermal growth factor-like domain of heregulin-alpha, a ligand for p180erbB-4.
pubmed rcsb
source organism Homo sapiens
molecule tags Growth factor
molecule keywords HEREGULIN ALPHA
total genus 7
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 1994-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00008 EGF EGF-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 1hrfA00
4OTJA 1JV2B 1FJSL 1LQDA 4RRYA 2KB9A 1EGFA 2D1JB 3KQEL 1FFMA 2BQ6A 3BT2A 5IKTA 2WG3C 4Z0LA 4BTIA 1URKA 1COUA 1LPGA 4ZHAB 1IQIL 2OYUP 4RRXA 4C16A 1Z6EL 1UZKA 3LN0A 5JB8E 4OTYA 3M36L 1K37A 2W3IB 2FLRL 3ENSA 3N8WB 2XBYL 2P16L 1EPIA 5IKRA 1APQA 5JVYA 1W7XL 2ADXA 4G1MB 1NT0A 4Y76B 1FAKL 4JZFL 2YGOA 3IITB 1PFXL 4NA9L 3QH0A 2WFTA 1EPHA 1TPGA 3F1SB 1HZ8A 2MGPA 3TBDA 2WPJE 3TK5B 4ZXXL 1UZQA 3N8YB 2I9AA 4JYUL 2UWOB 3LIWB 3LC5B 2WFXB 1PTHA 2EI7B 3P5BL 3FFGL 1V3XB 4CUDA 1HT5A 4X8VL 1IJQA 1MOXC 1KIGL 2BMGA 4BXSA 1I0UA 4LMFA 5JBBE 3ZYGA 2Y5HL 2J34B 4CUFA 1G1QA 1G2MB 1FAXL 1SZBA 4ISIL 3ZYIB 4RS0A 4Y7BB 2VH0B 3RR3A 1DX5I 2Y5GL 1EQGA 2J2UB 4CSYA 1F7MA 2P28B 2W2ME 4E1GA 3FBYA 1X7AL 1IQML 4CUEA 3SOQA 1MQ5L 2VVCK 2PR3B 2BOKL 2P3FL 1IQFL 2K2SB 1JBUL 1APOA 1IGXA 5IKQA 3HO4A 3MDLA 2MHPA 1ATDA 5CKQA 1NFXB 1WU1B 2XBWL 2FZZL 1DVAL 2BQ7A 2PUQL 1L5GB 1CQEA 3N8ZA 2W3KB 3NJPC 1ATAA 1LPZA 3EGFA 5E8DA 1CVWL 1FF7A 1HX2A 2DDUA 2FLBL 2WPME 3CFWA 1DIYA 5EGMB 1EAIC 4ZXYL 1N7DA 2G00L 1XFEA 1HT8A 1ZAQA 2Y80B 3OLTA 4BDWA 1YGCL 2P26A 1EBVA 3MQEA 5F19A 4ZAEB 2J4IB 2BZ6L 1IP0A 1EPGA 4Y71B 1U67A 1F7EA 4A7IA 2W2OE 3BPSE 3N8XA 3C9AC 1G2LB 1N1IA 1IOEL 3SW2A 1EMOA 1WHFA 3QMOA 2P93L 3Q7DA 1EQHA 2XC5L 2EI6B 3PGHA 1B9WA 1IQKL 1NZIA 4ZH8B 3NTBA 3Q3KB 1KLIL 1F0SB 2Y82B 3ZYJB 4MMXB 4BDXA 2FLGA 5IKVA 2PHBB 4Y79B 6COXA 1UZJA 3V64C 4FM5A 3LTFB 1NFYB 1CX2A 3LC3B 1NQLB 2VH6B 3KRKA 1NFWB 2VWLL 1NPEB 4MMZB 2BOHA 3NTGA 4Y7AB 1DDXA 1YO8A 4Y6DB 2W2QE 2Y81B 1IQEL 1K36A 2UWPB 3ELAL 2EI8B 3TK6B 1O5DL 1RFNB 3TGFA 2KV4A 5KN5C 3H5CB 4BTUA 2Y7ZB 3GCXE 4X8TL 1L3YA 1LMJA 4BTTA 4RUTA 5L30L 2RNLA 2WPHE 2P3TA 3LAQA 3TZIA 4PH9A 4LORA 4X8SL 4YT7L 4NGAL 4M11A 1IQNL 2AYLA 2UWLB 3N8YA 5CKNA 2W26B 2WPKE 3IJEB 1PGEA 2WYJB 5K0HB 1KLOA 2BO2A 2WG4B 1Q4GA 1HJ7A 2KL7A 3F6UL 1F0RB 3DEMA 1A3PA 3HO3A 2P3FN 1UZPA 1BF9A 1IGZA 5JBCE 3LTGD 2VJ3A 1ATBA 1LPKA 2NPRA 2P94L 3CS7L 1ATEA 1XDTR 4D90A 3U7UG 2BOXA 2CJIB 1TLEA 1TOZA 5KIRA 4JYVL 3SOVA 2W86A 3KK6A 1P9JA 2H9EL 3HS7A 2J94B 1EMNA 1QFKL 1FE2A 1G1RA 1P0SL 4Z6AL 2WPLE 1AUTL 2W2PE 1CVUA 4O1ZA 2M74A 4XLWA 3U73A 2Y38A 3M37L 1G1SA 3R05A 1HCGB 2GD4A 2JKHL 1OB1C 2J95B 2F9BL 2XC0L 2VWOL 1G1TA 4JZEL 5L2ZL 1XKBA 2WPIE 1HREA 1IQJL 3BT1A 1KSNB 3QCWA 2XC4L 1HAFA 3KL6B 1C5MF 4Z0KB 2OYEP 3N8WA 4M10A 2W2NE 1J9CL 1IQGL 2BQWA 5CKMA 4TGFA 1HAEA 2Q1JB 2RA0L 5I46L 3K9XA 1IVOC 1WHEA 3N8VA 2FD6A 1HRFA 2TGFA 2WYGB 5CISA 3CENL 4YT6L 5L2YL 1W8BL 4AQTA 1XKAL 2P3UA 4MMYB 3POYA 2YGPA 2Y7XB 5JVZA 2BOUA 3FCSB 4X8UL 4YZUB 4JZDL 1IOXA 1KLJL 1PXXA 3OLUA 2VWNL 1MQ6L 4D0FA 1Z6CA 1FSBA 1CCFA 3CA7A 4RRWA 1U8CB 1CCVA 1PRHA 3LN1A 4XBMA 1M1XB 3HPTA 3KQBL 4ISHL 2I9BA 4COXA 1DQBA 2P95L 3TH3L 2XBVL 1EPJA 2MGRA 5F1AA 2K2TA 1GK5A 1CEJA 2VWMK 2J38B 5JW1A 5JB9E 4XL1A 2Y5FL 2RHPA 3ASIA 2XBXL 1EZQB 2VVUL 1JL9A 1IQLL 4D0EA 5COXA 4BXWA 3GCWE 1NFUB 1YUKB 3KQDL 5JBAE 3V65B 3HS5A 2B7DL 3HO5A 1ADXA 3SOBB 3KCGL 4O02B 4NG9L 1YUGA 3GISX 3HS6A 3NT1A 1IQHL 3KQCL 1YUFA 5FDQA 2VVVL 4RRZA
chains in the Genus database with same CATH superfamily
4OTJA 1JV2B 1FJSL 1LQDA 4RRYA 2KB9A 1EGFA 2D1JB 3KQEL 1FFMA 2BQ6A 3BT2A 5IKTA 2WG3C 4Z0LA 4BTIA 1URKA 1COUA 1LPGA 4ZHAB 1IQIL 2OYUP 4RRXA 4C16A 2KNIA 1Z6EL 1UZKA 3LN0A 5JB8E 4OTYA 3M36L 1K37A 2W3IB 2FLRL 3ENSA 1LMMA 3N8WB 2XBYL 2P16L 1EPIA 5IKRA 1APQA 5JVYA 1LK9A 1W7XL 2ADXA 4G1MB 1NT0A 4Y76B 1FAKL 4JZFL 2YGOA 3IITB 1PFXL 4NA9L 3QH0A 2WFTA 4GU4A 1EPHA 1TPGA 3F1SB 1HZ8A 2MGPA 3TBDA 2WPJE 3TK5B 4ZXXL 1UZQA 3N8YB 2I9AA 4JYUL 2UWOB 3LIWB 3LC5B 2WFXB 1PTHA 2EI7B 3P5BL 3FFGL 1V3XB 4CUDA 1HT5A 4X8VL 1IJQA 1MOXC 1KIGL 2BMGA 4BXSA 1I0UA 4LMFA 5JBBE 3ZYGA 2Y5HL 2J34B 4CUFA 1G1QA 1G2MB 1FAXL 1SZBA 4ISIL 3ZYIB 4RS0A 4Y7BB 2VH0B 3RR3A 1DX5I 2Y5GL 1EQGA 2J2UB 4CSYA 1F7MA 2P28B 2W2ME 4E1GA 3FBYA 1X7AL 1IQML 1V1HA 4CUEA 3SOQA 1MQ5L 2VVCK 2PR3B 2BOKL 2P3FL 1IQFL 2K2SB 2YGQA 1JBUL 1APOA 1IGXA 5IKQA 3HO4A 3MDLA 2HORA 2MHPA 1ATDA 5CKQA 1NFXB 1WU1B 2XBWL 2FZZL 1DVAL 2BQ7A 2PUQL 1L5GB 1CQEA 3N8ZA 2W3KB 3NJPC 1ATAA 1LPZA 3EGFA 5E8DA 1CVWL 1FF7A 1HX2A 2DDUA 2FLBL 2WPME 3CFWA 1DIYA 5EGMB 1EAIC 4ZXYL 1N7DA 2G00L 1XFEA 1HT8A 1ZAQA 2BT7A 2Y80B 3OLTA 4BDWA 1YGCL 2P26A 1EBVA 3MQEA 5F19A 2WZPP 4ZAEB 2J4IB 2BZ6L 1IP0A 1EPGA 4Y71B 1U67A 1F7EA 4A7IA 2W2OE 3BPSE 3N8XA 3C9AC 1G2LB 1N1IA 1IOEL 3SW2A 1EMOA 1WHFA 3QMOA 2P93L 3Q7DA 1EQHA 2XC5L 2EI6B 3PGHA 1B9WA 1IQKL 3S6XA 1NZIA 4ZH8B 2H9EC 3NTBA 3Q3KB 1KLIL 1F0SB 2Y82B 3ZYJB 4MMXB 4BDXA 2FLGA 5IKVA 2PHBB 4Y79B 6COXA 1UZJA 3V64C 4FM5A 3LTFB 1NFYB 1CX2A 3LC3B 1NQLB 2VH6B 3KRKA 1NFWB 2VWLL 1NPEB 4MMZB 2BOHA 3NTGA 4Y7AB 1DDXA 1YO8A 4Y6DB 2W2QE 2Y81B 1IQEL 1K36A 2UWPB 3ELAL 2EI8B 3TK6B 1O5DL 1RFNB 3TGFA 2KV4A 5KN5C 3H5CB 4BTUA 2Y7ZB 3GCXE 4X8TL 1L3YA 1LMJA 4BTTA 4RUTA 5L30L 2RNLA 2WPHE 2P3TA 3LAQA 3TZIA 4GU3A 4PH9A 4LORA 4X8SL 4YT7L 4NGAL 4M11A 1IQNL 2AYLA 2UWLB 3N8YA 5CKNA 2W26B 2WPKE 3IJEB 1PGEA 2WYJB 5K0HB 1KLOA 2BO2A 2WG4B 1Q4GA 1HJ7A 2KL7A 3F6UL 1F0RB 3DEMA 1A3PA 3HO3A 2P3FN 1UZPA 1BF9A 1IGZA 5JBCE 3LTGD 2VJ3A 1ATBA 1LPKA 2NPRA 2P94L 3CS7L 1ATEA 1XDTR 4D90A 3U7UG 2BOXA 2CJIB 1TLEA 1TOZA 5KIRA 4JYVL 3SOVA 2W86A 3KK6A 1P9JA 2H9EL 3HS7A 2J94B 1EMNA 1QFKL 1FE2A 1G1RA 1P0SL 4Z6AL 2WPLE 1AUTL 2W2PE 1CVUA 4O1ZA 2M74A 4XLWA 3U73A 2Y38A 3M37L 1G1SA 3R05A 2JJLA 1HCGB 2GD4A 2JKHL 1OB1C 2J95B 2F9BL 2XC0L 2VWOL 1G1TA 4JZEL 5L2ZL 1XKBA 2WPIE 1HREA 1KKEA 1IQJL 3BT1A 1KSNB 3QCWA 2XC4L 1HAFA 3KL6B 1C5MF 4Z0KB 2OYEP 3N8WA 4M10A 2W2NE 1J9CL 1IQGL 2BQWA 5CKMA 4TGFA 1HAEA 1QIUA 2Q1JB 2RA0L 5I46L 3K9XA 1IVOC 1WHEA 3N8VA 2FD6A 1HRFA 2TGFA 2WYGB 5CISA 2BSFA 3CENL 4YT6L 5L2YL 1W8BL 4AQTA 1XKAL 2P3UA 4MMYB 3POYA 2YGPA 2Y7XB 5JVZA 2BOUA 3FCSB 4X8UL 4YZUB 4JZDL 1IOXA 1KLJL 1PXXA 3OLUA 2VWNL 2HOXA 1MQ6L 4D0FA 1Z6CA 4A94C 1FSBA 1CCFA 3CA7A 4RRWA 1U8CB 1CCVA 1PRHA 3LN1A 4XBMA 1M1XB 3HPTA 2VRSA 3KQBL 4ISHL 2I9BA 4COXA 1DQBA 2P95L 3TH3L 2XBVL 1EPJA 2MGRA 5F1AA 2K2TA 1GK5A 1CEJA 2VWMK 2J38B 5JW1A 5JB9E 4XL1A 2Y5FL 2RHPA 3ASIA 2XBXL 2BT8A 1EZQB 2VVUL 1JL9A 1IQLL 4D0EA 5COXA 4BXWA 3GCWE 1NFUB 1YUKB 3KQDL 5JBAE 3V65B 3HS5A 2B7DL 3HO5A 1ADXA 3SOBB 3KCGL 4O02B 4NG9L 1YUGA 3GISX 3HS6A 1V1IA 3NT1A 1IQHL 3KQCL 1YUFA 5FDQA 2VVVL 4RRZA
chains in the Genus database with same CATH topology
4OTJA 1JV2B 1FJSL 1LQDA 4RRYA 2KB9A 1EGFA 2D1JB 3KQEL 1FFMA 2BQ6A 3BT2A 5IKTA 2WG3C 4Z0LA 4BTIA 1URKA 1COUA 1LPGA 4ZHAB 1IQIL 2OYUP 4RRXA 4C16A 2KNIA 1Z6EL 1UZKA 3LN0A 5JB8E 4OTYA 3M36L 1K37A 2W3IB 2FLRL 3ENSA 1LMMA 3N8WB 2XBYL 2P16L 1EPIA 5IKRA 1APQA 5JVYA 1W7XL 2ADXA 4G1MB 1NT0A 4Y76B 1FAKL 4JZFL 2YGOA 3IITB 1PFXL 4NA9L 3QH0A 2WFTA 1EPHA 1TPGA 3F1SB 1HZ8A 2MGPA 3TBDA 2WPJE 3TK5B 4ZXXL 1UZQA 3N8YB 2I9AA 4JYUL 2UWOB 3LIWB 3LC5B 2WFXB 1PTHA 2EI7B 3P5BL 3FFGL 1V3XB 4CUDA 1HT5A 4X8VL 1IJQA 1MOXC 1KIGL 2BMGA 4BXSA 1I0UA 4LMFA 5JBBE 3ZYGA 2Y5HL 2J34B 4CUFA 1G1QA 1G2MB 1FAXL 1SZBA 4ISIL 3ZYIB 4RS0A 4Y7BB 2VH0B 3RR3A 1DX5I 2Y5GL 1EQGA 2J2UB 4CSYA 1F7MA 2P28B 2W2ME 4E1GA 3FBYA 1X7AL 1IQML 4CUEA 3SOQA 1MQ5L 2VVCK 2PR3B 2BOKL 2P3FL 1IQFL 2K2SB 2YGQA 1JBUL 1APOA 1IGXA 5IKQA 3HO4A 3MDLA 2MHPA 1ATDA 5CKQA 1NFXB 1WU1B 2XBWL 2FZZL 1DVAL 2BQ7A 2PUQL 1L5GB 1CQEA 3N8ZA 2W3KB 3NJPC 1ATAA 1LPZA 3EGFA 5E8DA 1CVWL 1FF7A 1HX2A 2DDUA 2FLBL 2WPME 3CFWA 1DIYA 5EGMB 1EAIC 4ZXYL 1N7DA 2G00L 1XFEA 1HT8A 1ZAQA 2Y80B 3OLTA 4BDWA 1YGCL 2P26A 1EBVA 3MQEA 5F19A 2WZPP 4ZAEB 2J4IB 2BZ6L 1IP0A 1EPGA 4Y71B 1U67A 1F7EA 4A7IA 2W2OE 3BPSE 3N8XA 3C9AC 1G2LB 1N1IA 1IOEL 3SW2A 1EMOA 1WHFA 3QMOA 2P93L 3Q7DA 1EQHA 2XC5L 2EI6B 3PGHA 1B9WA 1IQKL 3S6XA 1NZIA 4ZH8B 2H9EC 3NTBA 3Q3KB 1KLIL 1F0SB 2Y82B 3ZYJB 4MMXB 4BDXA 2FLGA 5IKVA 2PHBB 4Y79B 6COXA 1UZJA 3V64C 4FM5A 3LTFB 1NFYB 1CX2A 3LC3B 1NQLB 2VH6B 3KRKA 1NFWB 2VWLL 1NPEB 4MMZB 2BOHA 3NTGA 4Y7AB 1DDXA 1YO8A 4Y6DB 2W2QE 2Y81B 1IQEL 1K36A 2UWPB 3ELAL 2EI8B 3TK6B 1O5DL 1RFNB 3TGFA 2KV4A 5KN5C 3H5CB 4BTUA 2Y7ZB 3GCXE 4X8TL 1L3YA 1LMJA 4BTTA 4RUTA 5L30L 2RNLA 2WPHE 2P3TA 3LAQA 3TZIA 4PH9A 4LORA 4X8SL 4YT7L 4NGAL 4M11A 1IQNL 2AYLA 2UWLB 3N8YA 5CKNA 2W26B 2WPKE 3IJEB 1PGEA 2WYJB 5K0HB 1KLOA 2BO2A 2WG4B 1Q4GA 1HJ7A 2KL7A 3F6UL 1F0RB 3DEMA 1A3PA 3HO3A 2P3FN 1UZPA 1BF9A 1IGZA 5JBCE 3LTGD 2VJ3A 1ATBA 1LPKA 2NPRA 2P94L 3CS7L 1ATEA 1XDTR 4D90A 3U7UG 2BOXA 2CJIB 1TLEA 1TOZA 5KIRA 4JYVL 3SOVA 2W86A 3KK6A 1P9JA 2H9EL 3HS7A 2J94B 1EMNA 1QFKL 1FE2A 1G1RA 1P0SL 4Z6AL 2WPLE 1AUTL 2W2PE 1CVUA 4O1ZA 2M74A 4XLWA 3U73A 2Y38A 3M37L 1G1SA 3R05A 1HCGB 2GD4A 2JKHL 1OB1C 2J95B 2F9BL 2XC0L 2VWOL 1G1TA 4JZEL 5L2ZL 1XKBA 2WPIE 1HREA 1IQJL 3BT1A 1KSNB 3QCWA 2XC4L 1HAFA 3KL6B 1C5MF 4Z0KB 2OYEP 3N8WA 4M10A 2W2NE 1J9CL 1IQGL 2BQWA 5CKMA 4TGFA 1HAEA 2Q1JB 2RA0L 5I46L 3K9XA 1IVOC 1WHEA 3N8VA 2FD6A 1HRFA 2TGFA 2WYGB 5CISA 3CENL 4YT6L 5L2YL 1W8BL 4AQTA 1XKAL 2P3UA 4MMYB 3POYA 2YGPA 2Y7XB 5JVZA 2BOUA 3FCSB 4X8UL 4YZUB 4JZDL 1IOXA 1KLJL 1PXXA 3OLUA 2VWNL 1MQ6L 4D0FA 1Z6CA 4A94C 1FSBA 1CCFA 3CA7A 4RRWA 1U8CB 1CCVA 1PRHA 3LN1A 4XBMA 1M1XB 3HPTA 3KQBL 4ISHL 2I9BA 4COXA 1DQBA 2P95L 3TH3L 2XBVL 1EPJA 2MGRA 5F1AA 2K2TA 1GK5A 1CEJA 2VWMK 2J38B 5JW1A 5JB9E 4XL1A 2Y5FL 2RHPA 3ASIA 2XBXL 1EZQB 2VVUL 1JL9A 1IQLL 4D0EA 5COXA 4BXWA 3GCWE 1NFUB 1YUKB 3KQDL 5JBAE 3V65B 3HS5A 2B7DL 3HO5A 1ADXA 3SOBB 3KCGL 4O02B 4NG9L 1YUGA 3GISX 3HS6A 3NT1A 1IQHL 3KQCL 1YUFA 5FDQA 2VVVL 4RRZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OTJ A;  1JV2 B;  1FJS L;  1LQD A;  4RRY A;  2KB9 A;  1EGF A;  2D1J B;  3KQE L;  1FFM A;  2BQ6 A;  3BT2 A;  5IKT A;  2WG3 C;  4Z0L A;  4BTI A;  1URK A;  1COU A;  1LPG A;  4ZHA B;  1IQI L;  2OYU P;  4RRX A;  4C16 A;  1Z6E L;  1UZK A;  3LN0 A;  5JB8 E;  4OTY A;  3M36 L;  1K37 A;  2W3I B;  2FLR L;  3ENS A;  3N8W B;  2XBY L;  2P16 L;  1EPI A;  5IKR A;  1APQ A;  5JVY A;  1W7X L;  2ADX A;  4G1M B;  1NT0 A;  4Y76 B;  1FAK L;  4JZF L;  2YGO A;  3IIT B;  1PFX L;  4NA9 L;  3QH0 A;  2WFT A;  1EPH A;  1TPG A;  3F1S B;  1HZ8 A;  2MGP A;  3TBD A;  2WPJ E;  3TK5 B;  4ZXX L;  1UZQ A;  3N8Y B;  2I9A A;  4JYU L;  2UWO B;  3LIW B;  3LC5 B;  2WFX B;  1PTH A;  2EI7 B;  3P5B L;  3FFG L;  1V3X B;  4CUD A;  1HT5 A;  4X8V L;  1IJQ A;  1MOX C;  1KIG L;  2BMG A;  4BXS A;  1I0U A;  4LMF A;  5JBB E;  3ZYG A;  2Y5H L;  2J34 B;  4CUF A;  1G1Q A;  1G2M B;  1FAX L;  1SZB A;  4ISI L;  3ZYI B;  4RS0 A;  4Y7B B;  2VH0 B;  3RR3 A;  1DX5 I;  2Y5G L;  1EQG A;  2J2U B;  4CSY A;  1F7M A;  2P28 B;  2W2M E;  4E1G A;  3FBY A;  1X7A L;  1IQM L;  4CUE A;  3SOQ A;  1MQ5 L;  2VVC K;  2PR3 B;  2BOK L;  2P3F L;  1IQF L;  2K2S B;  1JBU L;  1APO A;  1IGX A;  5IKQ A;  3HO4 A;  3MDL A;  2MHP A;  1ATD A;  5CKQ A;  1NFX B;  1WU1 B;  2XBW L;  2FZZ L;  1DVA L;  2BQ7 A;  2PUQ L;  1L5G B;  1CQE A;  3N8Z A;  2W3K B;  3NJP C;  1ATA A;  1LPZ A;  3EGF A;  5E8D A;  1CVW L;  1FF7 A;  1HX2 A;  2DDU A;  2FLB L;  2WPM E;  3CFW A;  1DIY A;  5EGM B;  1EAI C;  4ZXY L;  1N7D A;  2G00 L;  1XFE A;  1HT8 A;  1ZAQ A;  2Y80 B;  3OLT A;  4BDW A;  1YGC L;  2P26 A;  1EBV A;  3MQE A;  5F19 A;  4ZAE B;  2J4I B;  2BZ6 L;  1IP0 A;  1EPG A;  4Y71 B;  1U67 A;  1F7E A;  4A7I A;  2W2O E;  3BPS E;  3N8X A;  3C9A C;  1G2L B;  1N1I A;  1IOE L;  3SW2 A;  1EMO A;  1WHF A;  3QMO A;  2P93 L;  3Q7D A;  1EQH A;  2XC5 L;  2EI6 B;  3PGH A;  1B9W A;  1IQK L;  1NZI A;  4ZH8 B;  3NTB A;  3Q3K B;  1KLI L;  1F0S B;  2Y82 B;  3ZYJ B;  4MMX B;  4BDX A;  2FLG A;  5IKV A;  2PHB B;  4Y79 B;  6COX A;  1UZJ A;  3V64 C;  4FM5 A;  3LTF B;  1NFY B;  1CX2 A;  3LC3 B;  1NQL B;  2VH6 B;  3KRK A;  1NFW B;  2VWL L;  1NPE B;  4MMZ B;  2BOH A;  3NTG A;  4Y7A B;  1DDX A;  1YO8 A;  4Y6D B;  2W2Q E;  2Y81 B;  1IQE L;  1K36 A;  2UWP B;  3ELA L;  2EI8 B;  3TK6 B;  1O5D L;  1RFN B;  3TGF A;  2KV4 A;  5KN5 C;  3H5C B;  4BTU A;  2Y7Z B;  3GCX E;  4X8T L;  1L3Y A;  1LMJ A;  4BTT A;  4RUT A;  5L30 L;  2RNL A;  2WPH E;  2P3T A;  3LAQ A;  3TZI A;  4PH9 A;  4LOR A;  4X8S L;  4YT7 L;  4NGA L;  4M11 A;  1IQN L;  2AYL A;  2UWL B;  3N8Y A;  5CKN A;  2W26 B;  2WPK E;  3IJE B;  1PGE A;  2WYJ B;  5K0H B;  1KLO A;  2BO2 A;  2WG4 B;  1Q4G A;  1HJ7 A;  2KL7 A;  3F6U L;  1F0R B;  3DEM A;  1A3P A;  3HO3 A;  2P3F N;  1UZP A;  1BF9 A;  1IGZ A;  5JBC E;  3LTG D;  2VJ3 A;  1ATB A;  1LPK A;  2NPR A;  2P94 L;  3CS7 L;  1ATE A;  1XDT R;  4D90 A;  3U7U G;  2BOX A;  2CJI B;  1TLE A;  1TOZ A;  5KIR A;  4JYV L;  3SOV A;  2W86 A;  3KK6 A;  1P9J A;  2H9E L;  3HS7 A;  2J94 B;  1EMN A;  1QFK L;  1FE2 A;  1G1R A;  1P0S L;  4Z6A L;  2WPL E;  1AUT L;  2W2P E;  1CVU A;  4O1Z A;  2M74 A;  4XLW A;  3U73 A;  2Y38 A;  3M37 L;  1G1S A;  3R05 A;  1HCG B;  2GD4 A;  2JKH L;  1OB1 C;  2J95 B;  2F9B L;  2XC0 L;  2VWO L;  1G1T A;  4JZE L;  5L2Z L;  1XKB A;  2WPI E;  1HRE A;  1IQJ L;  3BT1 A;  1KSN B;  3QCW A;  2XC4 L;  1HAF A;  3KL6 B;  1C5M F;  4Z0K B;  2OYE P;  3N8W A;  4M10 A;  2W2N E;  1J9C L;  1IQG L;  2BQW A;  5CKM A;  4TGF A;  1HAE A;  2Q1J B;  2RA0 L;  5I46 L;  3K9X A;  1IVO C;  1WHE A;  3N8V A;  2FD6 A;  1HRF A;  2TGF A;  2WYG B;  5CIS A;  3CEN L;  4YT6 L;  5L2Y L;  1W8B L;  4AQT A;  1XKA L;  2P3U A;  4MMY B;  3POY A;  2YGP A;  2Y7X B;  5JVZ A;  2BOU A;  3FCS B;  4X8U L;  4YZU B;  4JZD L;  1IOX A;  1KLJ L;  1PXX A;  3OLU A;  2VWN L;  1MQ6 L;  4D0F A;  1Z6C A;  1FSB A;  1CCF A;  3CA7 A;  4RRW A;  1U8C B;  1CCV A;  1PRH A;  3LN1 A;  4XBM A;  1M1X B;  3HPT A;  3KQB L;  4ISH L;  2I9B A;  4COX A;  1DQB A;  2P95 L;  3TH3 L;  2XBV L;  1EPJ A;  2MGR A;  5F1A A;  2K2T A;  1GK5 A;  1CEJ A;  2VWM K;  2J38 B;  5JW1 A;  5JB9 E;  4XL1 A;  2Y5F L;  2RHP A;  3ASI A;  2XBX L;  1EZQ B;  2VVU L;  1JL9 A;  1IQL L;  4D0E A;  5COX A;  4BXW A;  3GCW E;  1NFU B;  1YUK B;  3KQD L;  5JBA E;  3V65 B;  3HS5 A;  2B7D L;  3HO5 A;  1ADX A;  3SOB B;  3KCG L;  4O02 B;  4NG9 L;  1YUG A;  3GIS X;  3HS6 A;  3NT1 A;  1IQH L;  3KQC L;  1YUF A;  5FDQ A;  2VVV L;  4RRZ A; 
#chains in the Genus database with same CATH topology
 4OTJ A;  1JV2 B;  1FJS L;  1LQD A;  4RRY A;  2KB9 A;  1EGF A;  2D1J B;  3KQE L;  1FFM A;  2BQ6 A;  3BT2 A;  5IKT A;  2WG3 C;  4Z0L A;  4BTI A;  1URK A;  1COU A;  1LPG A;  4ZHA B;  1IQI L;  2OYU P;  4RRX A;  4C16 A;  2KNI A;  1Z6E L;  1UZK A;  3LN0 A;  5JB8 E;  4OTY A;  3M36 L;  1K37 A;  2W3I B;  2FLR L;  3ENS A;  1LMM A;  3N8W B;  2XBY L;  2P16 L;  1EPI A;  5IKR A;  1APQ A;  5JVY A;  1LK9 A;  1W7X L;  2ADX A;  4G1M B;  1NT0 A;  4Y76 B;  1FAK L;  4JZF L;  2YGO A;  3IIT B;  1PFX L;  4NA9 L;  3QH0 A;  2WFT A;  4GU4 A;  1EPH A;  1TPG A;  3F1S B;  1HZ8 A;  2MGP A;  3TBD A;  2WPJ E;  3TK5 B;  4ZXX L;  1UZQ A;  3N8Y B;  2I9A A;  4JYU L;  2UWO B;  3LIW B;  3LC5 B;  2WFX B;  1PTH A;  2EI7 B;  3P5B L;  3FFG L;  1V3X B;  4CUD A;  1HT5 A;  4X8V L;  1IJQ A;  1MOX C;  1KIG L;  2BMG A;  4BXS A;  1I0U A;  4LMF A;  5JBB E;  3ZYG A;  2Y5H L;  2J34 B;  4CUF A;  1G1Q A;  1G2M B;  1FAX L;  1SZB A;  4ISI L;  3ZYI B;  4RS0 A;  4Y7B B;  2VH0 B;  3RR3 A;  1DX5 I;  2Y5G L;  1EQG A;  2J2U B;  4CSY A;  1F7M A;  2P28 B;  2W2M E;  4E1G A;  3FBY A;  1X7A L;  1IQM L;  1V1H A;  4CUE A;  3SOQ A;  1MQ5 L;  2VVC K;  2PR3 B;  2BOK L;  2P3F L;  1IQF L;  2K2S B;  2YGQ A;  1JBU L;  1APO A;  1IGX A;  5IKQ A;  3HO4 A;  3MDL A;  2HOR A;  2MHP A;  1ATD A;  5CKQ A;  1NFX B;  1WU1 B;  2XBW L;  2FZZ L;  1DVA L;  2BQ7 A;  2PUQ L;  1L5G B;  1CQE A;  3N8Z A;  2W3K B;  3NJP C;  1ATA A;  1LPZ A;  3EGF A;  5E8D A;  1CVW L;  1FF7 A;  1HX2 A;  2DDU A;  2FLB L;  2WPM E;  3CFW A;  1DIY A;  5EGM B;  1EAI C;  4ZXY L;  1N7D A;  2G00 L;  1XFE A;  1HT8 A;  1ZAQ A;  2BT7 A;  2Y80 B;  3OLT A;  4BDW A;  1YGC L;  2P26 A;  1EBV A;  3MQE A;  5F19 A;  2WZP P;  4ZAE B;  2J4I B;  2BZ6 L;  1IP0 A;  1EPG A;  4Y71 B;  1U67 A;  1F7E A;  4A7I A;  2W2O E;  3BPS E;  3N8X A;  3C9A C;  1G2L B;  1N1I A;  1IOE L;  3SW2 A;  1EMO A;  1WHF A;  3QMO A;  2P93 L;  3Q7D A;  1EQH A;  2XC5 L;  2EI6 B;  3PGH A;  1B9W A;  1IQK L;  3S6X A;  1NZI A;  4ZH8 B;  2H9E C;  3NTB A;  3Q3K B;  1KLI L;  1F0S B;  2Y82 B;  3ZYJ B;  4MMX B;  4BDX A;  2FLG A;  5IKV A;  2PHB B;  4Y79 B;  6COX A;  1UZJ A;  3V64 C;  4FM5 A;  3LTF B;  1NFY B;  1CX2 A;  3LC3 B;  1NQL B;  2VH6 B;  3KRK A;  1NFW B;  2VWL L;  1NPE B;  4MMZ B;  2BOH A;  3NTG A;  4Y7A B;  1DDX A;  1YO8 A;  4Y6D B;  2W2Q E;  2Y81 B;  1IQE L;  1K36 A;  2UWP B;  3ELA L;  2EI8 B;  3TK6 B;  1O5D L;  1RFN B;  3TGF A;  2KV4 A;  5KN5 C;  3H5C B;  4BTU A;  2Y7Z B;  3GCX E;  4X8T L;  1L3Y A;  1LMJ A;  4BTT A;  4RUT A;  5L30 L;  2RNL A;  2WPH E;  2P3T A;  3LAQ A;  3TZI A;  4GU3 A;  4PH9 A;  4LOR A;  4X8S L;  4YT7 L;  4NGA L;  4M11 A;  1IQN L;  2AYL A;  2UWL B;  3N8Y A;  5CKN A;  2W26 B;  2WPK E;  3IJE B;  1PGE A;  2WYJ B;  5K0H B;  1KLO A;  2BO2 A;  2WG4 B;  1Q4G A;  1HJ7 A;  2KL7 A;  3F6U L;  1F0R B;  3DEM A;  1A3P A;  3HO3 A;  2P3F N;  1UZP A;  1BF9 A;  1IGZ A;  5JBC E;  3LTG D;  2VJ3 A;  1ATB A;  1LPK A;  2NPR A;  2P94 L;  3CS7 L;  1ATE A;  1XDT R;  4D90 A;  3U7U G;  2BOX A;  2CJI B;  1TLE A;  1TOZ A;  5KIR A;  4JYV L;  3SOV A;  2W86 A;  3KK6 A;  1P9J A;  2H9E L;  3HS7 A;  2J94 B;  1EMN A;  1QFK L;  1FE2 A;  1G1R A;  1P0S L;  4Z6A L;  2WPL E;  1AUT L;  2W2P E;  1CVU A;  4O1Z A;  2M74 A;  4XLW A;  3U73 A;  2Y38 A;  3M37 L;  1G1S A;  3R05 A;  2JJL A;  1HCG B;  2GD4 A;  2JKH L;  1OB1 C;  2J95 B;  2F9B L;  2XC0 L;  2VWO L;  1G1T A;  4JZE L;  5L2Z L;  1XKB A;  2WPI E;  1HRE A;  1KKE A;  1IQJ L;  3BT1 A;  1KSN B;  3QCW A;  2XC4 L;  1HAF A;  3KL6 B;  1C5M F;  4Z0K B;  2OYE P;  3N8W A;  4M10 A;  2W2N E;  1J9C L;  1IQG L;  2BQW A;  5CKM A;  4TGF A;  1HAE A;  1QIU A;  2Q1J B;  2RA0 L;  5I46 L;  3K9X A;  1IVO C;  1WHE A;  3N8V A;  2FD6 A;  1HRF A;  2TGF A;  2WYG B;  5CIS A;  2BSF A;  3CEN L;  4YT6 L;  5L2Y L;  1W8B L;  4AQT A;  1XKA L;  2P3U A;  4MMY B;  3POY A;  2YGP A;  2Y7X B;  5JVZ A;  2BOU A;  3FCS B;  4X8U L;  4YZU B;  4JZD L;  1IOX A;  1KLJ L;  1PXX A;  3OLU A;  2VWN L;  2HOX A;  1MQ6 L;  4D0F A;  1Z6C A;  4A94 C;  1FSB A;  1CCF A;  3CA7 A;  4RRW A;  1U8C B;  1CCV A;  1PRH A;  3LN1 A;  4XBM A;  1M1X B;  3HPT A;  2VRS A;  3KQB L;  4ISH L;  2I9B A;  4COX A;  1DQB A;  2P95 L;  3TH3 L;  2XBV L;  1EPJ A;  2MGR A;  5F1A A;  2K2T A;  1GK5 A;  1CEJ A;  2VWM K;  2J38 B;  5JW1 A;  5JB9 E;  4XL1 A;  2Y5F L;  2RHP A;  3ASI A;  2XBX L;  2BT8 A;  1EZQ B;  2VVU L;  1JL9 A;  1IQL L;  4D0E A;  5COX A;  4BXW A;  3GCW E;  1NFU B;  1YUK B;  3KQD L;  5JBA E;  3V65 B;  3HS5 A;  2B7D L;  3HO5 A;  1ADX A;  3SOB B;  3KCG L;  4O02 B;  4NG9 L;  1YUG A;  3GIS X;  3HS6 A;  1V1I A;  3NT1 A;  1IQH L;  3KQC L;  1YUF A;  5FDQ A;  2VVV L;  4RRZ A; 
#chains in the Genus database with same CATH homology
 4OTJ A;  1JV2 B;  1FJS L;  1LQD A;  4RRY A;  2KB9 A;  1EGF A;  2D1J B;  3KQE L;  1FFM A;  2BQ6 A;  3BT2 A;  5IKT A;  2WG3 C;  4Z0L A;  4BTI A;  1URK A;  1COU A;  1LPG A;  4ZHA B;  1IQI L;  2OYU P;  4RRX A;  4C16 A;  2KNI A;  1Z6E L;  1UZK A;  3LN0 A;  5JB8 E;  4OTY A;  3M36 L;  1K37 A;  2W3I B;  2FLR L;  3ENS A;  1LMM A;  3N8W B;  2XBY L;  2P16 L;  1EPI A;  5IKR A;  1APQ A;  5JVY A;  1W7X L;  2ADX A;  4G1M B;  1NT0 A;  4Y76 B;  1FAK L;  4JZF L;  2YGO A;  3IIT B;  1PFX L;  4NA9 L;  3QH0 A;  2WFT A;  1EPH A;  1TPG A;  3F1S B;  1HZ8 A;  2MGP A;  3TBD A;  2WPJ E;  3TK5 B;  4ZXX L;  1UZQ A;  3N8Y B;  2I9A A;  4JYU L;  2UWO B;  3LIW B;  3LC5 B;  2WFX B;  1PTH A;  2EI7 B;  3P5B L;  3FFG L;  1V3X B;  4CUD A;  1HT5 A;  4X8V L;  1IJQ A;  1MOX C;  1KIG L;  2BMG A;  4BXS A;  1I0U A;  4LMF A;  5JBB E;  3ZYG A;  2Y5H L;  2J34 B;  4CUF A;  1G1Q A;  1G2M B;  1FAX L;  1SZB A;  4ISI L;  3ZYI B;  4RS0 A;  4Y7B B;  2VH0 B;  3RR3 A;  1DX5 I;  2Y5G L;  1EQG A;  2J2U B;  4CSY A;  1F7M A;  2P28 B;  2W2M E;  4E1G A;  3FBY A;  1X7A L;  1IQM L;  4CUE A;  3SOQ A;  1MQ5 L;  2VVC K;  2PR3 B;  2BOK L;  2P3F L;  1IQF L;  2K2S B;  2YGQ A;  1JBU L;  1APO A;  1IGX A;  5IKQ A;  3HO4 A;  3MDL A;  2MHP A;  1ATD A;  5CKQ A;  1NFX B;  1WU1 B;  2XBW L;  2FZZ L;  1DVA L;  2BQ7 A;  2PUQ L;  1L5G B;  1CQE A;  3N8Z A;  2W3K B;  3NJP C;  1ATA A;  1LPZ A;  3EGF A;  5E8D A;  1CVW L;  1FF7 A;  1HX2 A;  2DDU A;  2FLB L;  2WPM E;  3CFW A;  1DIY A;  5EGM B;  1EAI C;  4ZXY L;  1N7D A;  2G00 L;  1XFE A;  1HT8 A;  1ZAQ A;  2Y80 B;  3OLT A;  4BDW A;  1YGC L;  2P26 A;  1EBV A;  3MQE A;  5F19 A;  2WZP P;  4ZAE B;  2J4I B;  2BZ6 L;  1IP0 A;  1EPG A;  4Y71 B;  1U67 A;  1F7E A;  4A7I A;  2W2O E;  3BPS E;  3N8X A;  3C9A C;  1G2L B;  1N1I A;  1IOE L;  3SW2 A;  1EMO A;  1WHF A;  3QMO A;  2P93 L;  3Q7D A;  1EQH A;  2XC5 L;  2EI6 B;  3PGH A;  1B9W A;  1IQK L;  3S6X A;  1NZI A;  4ZH8 B;  2H9E C;  3NTB A;  3Q3K B;  1KLI L;  1F0S B;  2Y82 B;  3ZYJ B;  4MMX B;  4BDX A;  2FLG A;  5IKV A;  2PHB B;  4Y79 B;  6COX A;  1UZJ A;  3V64 C;  4FM5 A;  3LTF B;  1NFY B;  1CX2 A;  3LC3 B;  1NQL B;  2VH6 B;  3KRK A;  1NFW B;  2VWL L;  1NPE B;  4MMZ B;  2BOH A;  3NTG A;  4Y7A B;  1DDX A;  1YO8 A;  4Y6D B;  2W2Q E;  2Y81 B;  1IQE L;  1K36 A;  2UWP B;  3ELA L;  2EI8 B;  3TK6 B;  1O5D L;  1RFN B;  3TGF A;  2KV4 A;  5KN5 C;  3H5C B;  4BTU A;  2Y7Z B;  3GCX E;  4X8T L;  1L3Y A;  1LMJ A;  4BTT A;  4RUT A;  5L30 L;  2RNL A;  2WPH E;  2P3T A;  3LAQ A;  3TZI A;  4PH9 A;  4LOR A;  4X8S L;  4YT7 L;  4NGA L;  4M11 A;  1IQN L;  2AYL A;  2UWL B;  3N8Y A;  5CKN A;  2W26 B;  2WPK E;  3IJE B;  1PGE A;  2WYJ B;  5K0H B;  1KLO A;  2BO2 A;  2WG4 B;  1Q4G A;  1HJ7 A;  2KL7 A;  3F6U L;  1F0R B;  3DEM A;  1A3P A;  3HO3 A;  2P3F N;  1UZP A;  1BF9 A;  1IGZ A;  5JBC E;  3LTG D;  2VJ3 A;  1ATB A;  1LPK A;  2NPR A;  2P94 L;  3CS7 L;  1ATE A;  1XDT R;  4D90 A;  3U7U G;  2BOX A;  2CJI B;  1TLE A;  1TOZ A;  5KIR A;  4JYV L;  3SOV A;  2W86 A;  3KK6 A;  1P9J A;  2H9E L;  3HS7 A;  2J94 B;  1EMN A;  1QFK L;  1FE2 A;  1G1R A;  1P0S L;  4Z6A L;  2WPL E;  1AUT L;  2W2P E;  1CVU A;  4O1Z A;  2M74 A;  4XLW A;  3U73 A;  2Y38 A;  3M37 L;  1G1S A;  3R05 A;  1HCG B;  2GD4 A;  2JKH L;  1OB1 C;  2J95 B;  2F9B L;  2XC0 L;  2VWO L;  1G1T A;  4JZE L;  5L2Z L;  1XKB A;  2WPI E;  1HRE A;  1IQJ L;  3BT1 A;  1KSN B;  3QCW A;  2XC4 L;  1HAF A;  3KL6 B;  1C5M F;  4Z0K B;  2OYE P;  3N8W A;  4M10 A;  2W2N E;  1J9C L;  1IQG L;  2BQW A;  5CKM A;  4TGF A;  1HAE A;  2Q1J B;  2RA0 L;  5I46 L;  3K9X A;  1IVO C;  1WHE A;  3N8V A;  2FD6 A;  1HRF A;  2TGF A;  2WYG B;  5CIS A;  3CEN L;  4YT6 L;  5L2Y L;  1W8B L;  4AQT A;  1XKA L;  2P3U A;  4MMY B;  3POY A;  2YGP A;  2Y7X B;  5JVZ A;  2BOU A;  3FCS B;  4X8U L;  4YZU B;  4JZD L;  1IOX A;  1KLJ L;  1PXX A;  3OLU A;  2VWN L;  1MQ6 L;  4D0F A;  1Z6C A;  4A94 C;  1FSB A;  1CCF A;  3CA7 A;  4RRW A;  1U8C B;  1CCV A;  1PRH A;  3LN1 A;  4XBM A;  1M1X B;  3HPT A;  3KQB L;  4ISH L;  2I9B A;  4COX A;  1DQB A;  2P95 L;  3TH3 L;  2XBV L;  1EPJ A;  2MGR A;  5F1A A;  2K2T A;  1GK5 A;  1CEJ A;  2VWM K;  2J38 B;  5JW1 A;  5JB9 E;  4XL1 A;  2Y5F L;  2RHP A;  3ASI A;  2XBX L;  1EZQ B;  2VVU L;  1JL9 A;  1IQL L;  4D0E A;  5COX A;  4BXW A;  3GCW E;  1NFU B;  1YUK B;  3KQD L;  5JBA E;  3V65 B;  3HS5 A;  2B7D L;  3HO5 A;  1ADX A;  3SOB B;  3KCG L;  4O02 B;  4NG9 L;  1YUG A;  3GIS X;  3HS6 A;  3NT1 A;  1IQH L;  3KQC L;  1YUF A;  5FDQ A;  2VVV L;  4RRZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...