1HRI4

Structure determination of antiviral compound sch 38057 complexed with human rhinovirus 14
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
40
structure length
40
Chain Sequence
b'INYYKDAASTSSAGQSLSMDPSKFTEPVKDLMLKGAPALN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN RHINOVIRUS 14 COAT PROTEIN (SUBUNIT VP1)
publication title Structure determination of antiviral compound SCH 38057 complexed with human rhinovirus 14.
pubmed doi rcsb
source organism Human rhinovirus 14
molecule tags Virus
total genus 2
structure length 40
sequence length 40
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1992-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
4 PF02226 Pico_P1A Picornavirus coat protein (VP4)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.80.10 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 Picornavirus coat protein VP4 1hri400
1COV4 3J8F4 1RUJ4 4RHV4 4GB34 1VBD4 1RUH4 1ASJ4 1RUF4 1Z7S4 4Q4Y4 4Q4W4 1MQTD 1RUD4 1AL24 4Q4X4 1RUC4 1PO14 2HWC4 2RS14 1VBA4 1BEV4 1D4M4 1PVC4 1OOPD 1RUG4 1VBE4 4PDWD 2X5ID 1RVF4 1POV0 1R094 2R074 2RS34 4Q4V4 1HRV4 1K5MD 1R084 3JBG4 1NA1D 1PIV4 1AR64 1AR74 1NCQD 1PO24 1RUE4 1EV14 1VBB4 1H8TD 2HWB4 2R064 1AR94 2RR14 2RMU4 1RMU4 2RM24 1RUI4 1VBC4 1AR84 1EAH4 1RHI4 1HRI4 1HXS4 2RS54 3JD74 2R044 2PLV4 1VRH4
chains in the Genus database with same CATH superfamily
2EX3A 1COV4 3P4PA 2H88A 1VBD4 3AE3A 1RUF4 3AECA 1YQ4A 3VR9A 3GQHA 5C2TA 2RS14 1VBA4 3VR8A 1VBE4 3SFDA 2X5ID 3GQKA 2RS34 1NA1D 3AEGA 1XHZA 1AR64 1VBB4 1EV14 1AR94 4YTNA 2RMU4 1RMU4 1RUI4 1VBC4 3AEFA 1L0VA 1AR84 1YQ3A 1NENA 4YTMA 2WS3A 1VRH4 3CIRA 2R7FA 3J8F4 1RUJ4 4GB34 1Z7S4 3VRBA 4YSYA 3SFEA 4KX6A 2HWC4 1PVC4 1RUG4 1RVF4 3ABVA 3AEBA 2R074 3JBG4 2PZSA 2PY5A 1NCQD 1RUE4 1PO24 1NEKA 2H89A 1EAH4 4YXDA 3JD74 5C3JA 2WQYA 4RHV4 3AE2A 1ZP0A 2B76A 2WDVA 1XHXA 3AE8A 3AE7A 3AE1A 1XI1A 3AEAA 2WDQA 1KFYA 4Q4W4 1MQTD 1AL24 4Q4X4 1RUC4 1PO14 1BEV4 1D4M4 4PDWD 3AE5A 1R094 4Q4V4 4YSZA 1HRV4 1R084 3P4SA 1PIV4 4YSXA 2WDRA 2RR14 2HWB4 2WU5A 3AEEA 4YTPA 2PW9A 2PYLA 1HRI4 2PLV4 4YT0A 3AE6A 1ZOYA 3SUCA 1RUH4 3P4QA 1ASJ4 2ACZA 3FI7A 2WU2A 4Q4Y4 1RUD4 3AE4A 3P4RA 1OOPD 1KF6A 1POV0 2FBWA 1K5MD 2WP9A 1AR74 1H8TD 2R064 3AEDA 2RM24 2PYJA 1RHI4 2RS54 1HXS4 3VRAA 2R044 3AE9A
chains in the Genus database with same CATH topology
1COV4 3J8F4 1RUJ4 4RHV4 4GB34 1VBD4 1RUH4 1ASJ4 1RUF4 1Z7S4 4Q4Y4 4Q4W4 1MQTD 1RUD4 1AL24 4Q4X4 1RUC4 1PO14 2HWC4 2RS14 1VBA4 1BEV4 1D4M4 1PVC4 1OOPD 1RUG4 1VBE4 4PDWD 2X5ID 1RVF4 1POV0 1R094 2R074 2RS34 4Q4V4 1HRV4 1K5MD 1R084 3JBG4 1NA1D 1PIV4 1AR64 1AR74 1NCQD 1PO24 1RUE4 1EV14 1VBB4 1H8TD 2HWB4 2R064 1AR94 2RR14 2RMU4 1RMU4 2RM24 1RUI4 1VBC4 1AR84 1EAH4 1RHI4 1HRI4 1HXS4 2RS54 3JD74 2R044 2PLV4 1VRH4
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1COV 4;  3J8F 4;  1RUJ 4;  4RHV 4;  4GB3 4;  1VBD 4;  1RUH 4;  1ASJ 4;  1RUF 4;  1Z7S 4;  4Q4Y 4;  4Q4W 4;  1MQT D;  1RUD 4;  1AL2 4;  4Q4X 4;  1RUC 4;  1PO1 4;  2HWC 4;  2RS1 4;  1VBA 4;  1BEV 4;  1D4M 4;  1PVC 4;  1OOP D;  1RUG 4;  1VBE 4;  4PDW D;  2X5I D;  1RVF 4;  1POV 0;  1R09 4;  2R07 4;  2RS3 4;  4Q4V 4;  1HRV 4;  1K5M D;  1R08 4;  3JBG 4;  1NA1 D;  1PIV 4;  1AR6 4;  1AR7 4;  1NCQ D;  1PO2 4;  1RUE 4;  1EV1 4;  1VBB 4;  1H8T D;  2HWB 4;  2R06 4;  1AR9 4;  2RR1 4;  2RMU 4;  1RMU 4;  2RM2 4;  1RUI 4;  1VBC 4;  1AR8 4;  1EAH 4;  1RHI 4;  1HRI 4;  1HXS 4;  2RS5 4;  3JD7 4;  2R04 4;  2PLV 4;  1VRH 4; 
#chains in the Genus database with same CATH topology
 2EX3 A;  1COV 4;  3P4P A;  2H88 A;  1VBD 4;  3AE3 A;  1RUF 4;  3AEC A;  1YQ4 A;  3VR9 A;  3GQH A;  5C2T A;  2RS1 4;  1VBA 4;  3VR8 A;  1VBE 4;  3SFD A;  2X5I D;  3GQK A;  2RS3 4;  1NA1 D;  3AEG A;  1XHZ A;  1AR6 4;  1VBB 4;  1EV1 4;  1AR9 4;  4YTN A;  2RMU 4;  1RMU 4;  1RUI 4;  1VBC 4;  3AEF A;  1L0V A;  1AR8 4;  1YQ3 A;  1NEN A;  4YTM A;  2WS3 A;  1VRH 4;  3CIR A;  2R7F A;  3J8F 4;  1RUJ 4;  4GB3 4;  1Z7S 4;  3VRB A;  4YSY A;  3SFE A;  4KX6 A;  2HWC 4;  1PVC 4;  1RUG 4;  1RVF 4;  3ABV A;  3AEB A;  2R07 4;  3JBG 4;  2PZS A;  2PY5 A;  1NCQ D;  1RUE 4;  1PO2 4;  1NEK A;  2H89 A;  1EAH 4;  4YXD A;  3JD7 4;  5C3J A;  2WQY A;  4RHV 4;  3AE2 A;  1ZP0 A;  2B76 A;  2WDV A;  1XHX A;  3AE8 A;  3AE7 A;  3AE1 A;  1XI1 A;  3AEA A;  2WDQ A;  1KFY A;  4Q4W 4;  1MQT D;  1AL2 4;  4Q4X 4;  1RUC 4;  1PO1 4;  1BEV 4;  1D4M 4;  4PDW D;  3AE5 A;  1R09 4;  4Q4V 4;  4YSZ A;  1HRV 4;  1R08 4;  3P4S A;  1PIV 4;  4YSX A;  2WDR A;  2RR1 4;  2HWB 4;  2WU5 A;  3AEE A;  4YTP A;  2PW9 A;  2PYL A;  1HRI 4;  2PLV 4;  4YT0 A;  3AE6 A;  1ZOY A;  3SUC A;  1RUH 4;  3P4Q A;  1ASJ 4;  2ACZ A;  3FI7 A;  2WU2 A;  4Q4Y 4;  1RUD 4;  3AE4 A;  3P4R A;  1OOP D;  1KF6 A;  1POV 0;  2FBW A;  1K5M D;  2WP9 A;  1AR7 4;  1H8T D;  2R06 4;  3AED A;  2RM2 4;  2PYJ A;  1RHI 4;  2RS5 4;  1HXS 4;  3VRA A;  2R04 4;  3AE9 A; 
#chains in the Genus database with same CATH homology
 1COV 4;  3J8F 4;  1RUJ 4;  4RHV 4;  4GB3 4;  1VBD 4;  1RUH 4;  1ASJ 4;  1RUF 4;  1Z7S 4;  4Q4Y 4;  4Q4W 4;  1MQT D;  1RUD 4;  1AL2 4;  4Q4X 4;  1RUC 4;  1PO1 4;  2HWC 4;  2RS1 4;  1VBA 4;  1BEV 4;  1D4M 4;  1PVC 4;  1OOP D;  1RUG 4;  1VBE 4;  4PDW D;  2X5I D;  1RVF 4;  1POV 0;  1R09 4;  2R07 4;  2RS3 4;  4Q4V 4;  1HRV 4;  1K5M D;  1R08 4;  3JBG 4;  1NA1 D;  1PIV 4;  1AR6 4;  1AR7 4;  1NCQ D;  1PO2 4;  1RUE 4;  1EV1 4;  1VBB 4;  1H8T D;  2HWB 4;  2R06 4;  1AR9 4;  2RR1 4;  2RMU 4;  1RMU 4;  2RM2 4;  1RUI 4;  1VBC 4;  1AR8 4;  1EAH 4;  1RHI 4;  1HRI 4;  1HXS 4;  2RS5 4;  3JD7 4;  2R04 4;  2PLV 4;  1VRH 4; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...