1HRV1

Hrv14/sdz 35-682 complex
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
273
structure length
273
Chain Sequence
b'TVASISSGPKHTQKVPILTANETGATMPVLPSDSIETRTTYMHFNGSETDVECFLGRAACVHVTEIQNKDATGIDNHREAKLFNDWKINLSSLVQLRKKLELFTYVRFDSEYTILATASQPDSANYSSNLVVQAMYVPPGAPNPKEWDDYTWQSASNPSVFFKVGDTSRFSVPYVGLASAYNCFYDGYSHDDAETQYGITVLNHMGSMAFRIVNEHDEHKTLVKIRVYHRAKHVEAWIPRAPRALPYTSIGRTNYPKNTEPVIKKRKGDIKSY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN RHINOVIRUS 14 COAT PROTEIN (SUBUNIT VP1)
molecule tags Virus
source organism Human rhinovirus 14
publication title SDZ 35-682, a new picornavirus capsid-binding agent with potent antiviral activity.
pubmed doi rcsb
total genus 42
structure length 273
sequence length 273
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1995-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1hrv100
2IZWA 2RS53 1VBC2 4RR3A 1RMU2 1RUC2 4WM7C 4GH4C 1AYM3 1VBE3 5D8AB 4WM8C 4CDXB 2RMU1 3JD73 2XBO2 5D8AA 1K5MC 2HWD3 3VBOB 3ZFEA 1V9U1 1AL22 5BNNA 2WS91 4AEDB 5AC91 3VBSB 4Q4V3 5A32B 2HWF2 5BNNB 5CFCC 5K0UA 1ZBE3 4AEDA 3J8F3 4CEWB 1MEC1 1AL0G 5C4WC 4RHV3 3DPRB 3VBFC 1NOVA 1PGL2 1FMD3 1FPN3 1RHI1 1QJX3 1EAH2 1ZBE1 4RR3C 1PO23 1VRH1 4JGYC 1R092 1HRI2 5J98B 1RUC3 1AYN1 2RM21 1RUG2 1RUF3 4JGZA 2WWSA 3VBHA 2QQPA 3JB8A 3NAPA 4IV1A 1A6CA 1VBD1 2XBO3 4JGZB 1VBE1 1ND2C 1ND3C 1K5MB 5DDJ2 3VBOC 3VDDB 1AR91 1PIV3 5L7OB 2GSYA 1BBT3 3CJIC 4GMP3 4CDUB 2HWF3 2R062 1ZBA1 4QPGA 2WFF3 5ABJC 2MEV1 2BFUS 2RR13 4CEYB 1FMD2 1ASJ3 3TN91 1ZBA2 4NWWA 2R061 5JZGC 1QJX2 1BMV1 1QQP3 4BCUA 1NCRA 1E57A 1QJU3 1PO22 1PVC1 3M8LA 2PLV2 4N53A 3LOBA 1R093 1VBE2 1QJY3 1FOD1 1RUG3 1RUF2 3JD72 5C9AC 4CDXA 4CDQC 3ZFGC 1RUG1 1POV0 5K0UC 1HRI1 1NA1A 5BNPC 4Q4V2 5BNOC 1GFF2 2HWE2 1ZBE2 1BBT2 1VBA3 4Q4Y3 4SBVA 2R063 1B35B 2R043 4CEWA 4RHV2 2TBVA 1FPN2 1RUH1 1HRV1 1F8VA 5JZGA 2WLPA 1F2NA 1FPN1 1C8NA 1RUH2 2HWF1 4PDWA 4WM7B 1HRI3 1VBB3 1QJU2 1BEV1 4GH4B 5D8AC 2FZ2A 4YVSB 1C8M2 2VQ0A 3NAPC 1AUYA 3ZFGA 4Q4V1 2X5IA 5AC93 2ZTNA 5CFDA 4CDWA 1RVF1 5DDJ3 3VBSC 1HXS3 2R041 1RUC1 1PO12 1K5MA 3JD71 3VDDA 1RUF1 2DF7A 5C8CC 4CDUC 5ACA1 5L7OA 1EV11 2WFF2 2PLV1 5FOJB 1PO21 1VRH3 5ABJB 1PO11 2R042 1AR83 4GB32 1AR93 1BMV2 3FBMA 1ASJ2 1FMD1 4Q4W2 1QQP2 1FOD3 2RS11 2MEV2 2PLV3 1HXS1 1NCRB 1C8M1 1RVF3 1QJY2 4N53B 1QJU1 1VAKA 1C8M3 2FZ1A 4RQPB 4AEDC 5BNPA 1OOPC 4RHV1 4RQPA 5BNPB 5BNOB 2HWE3 1IHMA 5LK7B 2RS51 1VBA2 4Q4Y2 1NCQA 1BBT1 3DPRC 3VBFB 5C4WA 1MQTC 1R091 4IV3A 3ZFFC 2BPA2 1VRH2 4QPIB 1H8TA 3JBG1 5ACA3 3J8F1 1RHI2 1RUH3 3VBUB 4QPIA 1PGL1 1FOD2 4RS5B 1VBB2 1MEC2 4PDWB 3VBUA 2WZR1 1RB8G 1NCRC 1VB2A 2HWD1 4RS5A 1PVC2 3S6PA 5FMOL 4YVSA 3ZXAC 4CDQB 3CJIA 1ND2B 1ND3B 1QJZA 5AC92 5A32A 1NA1B 5K0UB 1AYM1 2WS92 5CFDB 3CJIB 1HXS2 4Y5Z0 4CDWB 1RUE3 1PO13 1OOPB 2HWC3 2RS12 1QQP1 4N43B 1HRV3 3VBRC 5C8CB 1B35C 2BFUL 4YVWB 4N43A 1VBC1 4GB33 1AR82 1AR92 3IDEA 4NWVA 1VB4A 1EV12 2WFF1 4YVWA 5ACA2 4QPIC 4WM7A 4Q4W3 2XPJA 4Q4X1 2RMU3 2MEV3 1OHFA 4JGYA 1RUI1 2HWB2 1RVF2 3NAPB 5C9AB 2X5IB 4PDWC 4GMP1 1M06G 4IV1C 1D4M3 4FSJA 1PVC3 1COV3 2BUKA 1AR72 2RM23 3JB4C 1BEV2 1RUD1 3VBHB 2WS93 1TME1 1RUE2 3VBRA 1HQNA 2ZZQA 3TN93 1MQTA 2RS13 5ABJA 1HRV2 4N43C 4QPGC 3VBRB 1SMVA 1MQTB 3ZFFB 5C4WB 4IV3B 1AL21 1RHI3 2HWE1 4WM8A 4CEYA 2R071 2RMU2 1RUD2 1MEC3 1VBD3 3ZFEC 4N53C 1AR71 1HX6A 1CJDA 1RMU1 2WZR3 4RQPC 2Y26A 1D4M2 1AYN3 1COV2 4CDQA 2HWB1 1RUI2 3VBOA 1AR73 2RR11 5BNOA 1NCQC 1R081 1RUJ3 2HWC2 2BBVA 1NY72 4Q4X2 3VBHC 1B35A 3VBFA 1QJX1 1NG0A 1OOPA 5L7OC 4RFT0 1WCDJ 3TN92 2R073 2RS32 1AR81 1DDLA 1H8TB 4LLFA 1PIV1 1RUJ1 4FTEA 1PGW1 1EV13 1R1A1 1R1A2 1CD3G 3VBUC 5A33B 1PGW2 1VBC3 4RS5C 5JZGB 1AR61 1AYM2 1V9U3 5DDJ1 2HWB3 5A33A 1AR63 4CDXC 1VBD2 1ND2A 1ND3A 3ZFEB 1TME3 2ZAHA 4GH4A 1NY71 1X33A 5C9AA 1R082 2HWD2 2WZR2 3VBSA 5CFDC 4FTBA 2RM22 4JGZC 3ZFGB 1AYN2 1VBB1 1D4M1 1BEV3 4CDWC 3VDDC 1TMF2 1RUI3 5CFCB 1POV3 5C8CA 1Z7S1 4Q4X3 4CEWC 1EAH1 3J8F2 2GH8A 3JBG2 5CFCA 3DPRA 4EJRA 4Z92B 1Z7S2 2R072 4QPGB 2RS33 1TMF1 1VBA1 4Q4Y1 2RS52 1RMU3 1R1A3 4JGYB 1RUD3 4WM8B 5J96B 2X5IC 5FMOS 1V9U2 1W39A 4FTSA 2XBO1 4IV1B 1RUE1 1AR62 4YVSC 1NA1C 1POV1 1AL23 1TME2 1R083 1QJY1 1X36A 3HAGA 5GKAC 5BNNC 4CDUA 1NCQB 1RUJ2 1PIV2 1TMF3 4Q4W1 2RS31 1ASJ1 4YVWC 1OPOA 4GB31 4Y4YA 3ZFFA 3JBG3 2HWC1 1H8TC 1Z7S3 4GMP0 4CEYC 2RR12 4RR3B 4IV3C 1EAH3 1ZBA3 1COV1
chains in the Genus database with same CATH superfamily
2PQSA 3BU7A 4KG0A 2TEPA 2Y8KA 1VBC2 1TQ5A 1RMU2 1RUC2 4JRLA 3J7LA 1UD1A 4BA6A 5C71A 4WM7C 3POFA 2ZX4A 1IZ3A 4Y20A 1WA6X 5M0TA 2XVGA 1XBFA 2LTNA 3L2YA 2VOTA 2D98A 4MLOA 5KHGA 1F15A 4FPLA 1H2KA 2PHRA 5FZDA 2Q8CA 2V09A 1AL22 1GSLA 4XTPA 4Y1VA 1DQ2A 3SKJE 4B8EA 1QDOA 1IQDC 1LOFA 1E5SA 4OHWA 3LCPA 4Q4V3 3W9AA 1MZ6A 3WQ7A 1JI6A 2BNNA 1WMXA 2HWF2 3N9NA 2CDOA 4X8PA 5FY8A 1AX2A 5K0UA 4CUAA 3FBYA 4QX1A 5CA6A 4QMAA 4K7JA 1O3RA 3Q8CA 5GZEA 4NRQA 2XJQA 3FFZA 4KG8A 1MEC1 2XMLA 1AX1A 5T52A 1O7FA 3F95A 1ACCA 1FI2A 1DLLA 4IE5A 3SISA 4MYEA 3POWA 1FPN3 3C7FA 4K6BA 3AL6A 1RHI1 3H1WA 2DV9A 2WWJA 3I3BA 1ZBE1 2E32A 2TUNA 4IE4A 1BVVA 4BQXA 3V0AA 3SQOA 2OT7A 1WW5A 4JGYC 2WLQA 4KNCA 5FY1A 1ZZCA 3S57A 1HRI2 3D0SA 4PF1A 3ME2A 5IWFA 3O1UA 2BERA 1AYN1 3OYWA 2JXAA 1P8JA 5FZEA 2ZX3A 3DN7A 1RUF3 1LGCA 5H9PA 3VBHA 3A7QA 3NAPA 4IV1A 5GLTA 1A6CA 5FPVA 3MF9A 1UY4A 4E4DX 5CEHA 4NAMA 5KWRA 2GNMA 2ZACA 5FPLA 3VBOC 3GALA 2C5DA 4YM0A 1W6PA 2GN3A 4HSLA 2WAOA 2BOIA 5JPMB 2GSYA 1UCXA 3CJIC 4YZ1A 3WVJA 2R062 4R4XA 4Z82A 1LU1A 3GGLA 2ET7A 3GZTB 1GQGA 3FZ3A 1NT0A 2G1MA 4FP3A 1L7RA 2P2KA 2ZEWA 3D3AA 4FPFA 2WO2A 2A6ZA 4L9BA 3TB0A 3NW4A 2MEV1 3NNFA 2Q8EA 1LGNA 4AR2A 4M3CA 4ATFA 1FMD2 1ASJ3 1KXGA 3C7GA 1ZBA2 5BPXA 1QH6A 5JR7B 1I3HA 2E53A 4Y5TA 3KF3A 3WZ1A 1BMV1 4GKXA 5EJ1B 3KV5A 4UW6A 4EN7B 5EP9A 1E57A 4CPBA 5A7SA 5SV8A 4XC9A 4BM8A 3R4DB 4KGGA 5F6KA 1N1SA 4DZGA 3ES1A 1VPHA 4AFBA 1MS5A 2DBIA 4LORA 3JCIA 3OBRA 5FYHA 3C8XA 2EAKA 3JD72 3INAA 1NX9A 4YWAA 2VULA 4IQPA 3ECQA 4BQ3A 1RUG1 3H3ZA 4P08A 2YFZA 3ES4A 1H1AA 4H7LA 3AKRA 3NKTA 5DAXA 5BUVA 3PL0A 5HBAA 1H9PA 2EALA 3NNGA 1DLCA 3KCXA 2WRAA 1GFF2 3WCRA 4E4ZA 1XPWA 3AZXA 1OQ1A 1BBT2 2W1SA 4MG2A 1UQXA 5C5UA 2JG8A 1VBA3 5JDBA 4EN6B 2Y6HA 2QQWA 4JDNA 4OFGA 4OZXA 4DY5A 4GWIA 1B35B 2R043 4J6GA 5JXHA 4RHV2 5DG1A 5LASA 1FPN2 1RUH1 2Z4FA 5T5LA 1HRV1 2J1VA 2PHTA 3H42B 5JZGA 1OD5A 2VW1A 1LHNA 2R6QA 5DQ0A 3VDBA 2P3YA 2QQLA 4OUMA 1L3JA 3NJXA 5CISA 5LK5A 3ZN6A 3KWVA 2WIIB 1FV3A 4LMFA 1DZTA 1VBB3 1QJU2 1BEV1 1QNWA 4H7MA 3EB7A 1JS9A 1OLMA 4CRQA 3FMGA 3I49A 3USUB 2PA7A 4CCOA 2XB6C 3MEPA 2WNVC 4UBGA 2Z2SB 3WNMA 3DECA 3ZFGA 5FDBA 1Q8SA 3RWKX 2B9VA 4B3NA 1BXHA 2BJSA 2ZTNA 5CFDA 3FUOA 3HNYM 5AC93 3U4XA 2IWGB 4NHKA 4UT5A 4KI5M 1RVF1 1DIWA 3MI8A 4YG3A 1W6OA 1HXS3 2O8QA 3VBSC 3BUCA 2R041 5FP4A 5LBCA 3D82A 4AF9A 1WCQA 4V2VA 2XLGA 4PLMA 2X8KA 4ASKA 4C8DA 1X50A 3RVHA 1C5IA 1OI6A 1W6PB 2VZSA 3IN9A 1I5PA 5FQ0A 3IAPA 5FP7A 4ZPIA 2O1QA 1F35A 2CGOA 5F5IA 4YGEA 1SQ4A 2YZ4A 3ZYJB 1DZQA 5A3UA 3LEKA 4M0NA 5F9TA 3CMGA 4DXTA 4CP9A 4GB32 2O14A 4LO8A 4OI0A 4RSUA 1OSGA 1DQ6A 1SFYA 2FBEA 3KT1A 4P14A 2EXIA 5A7WA 5FBZA 5I0RA 4UFHA 5EHDA 4XJ9A 4L99A 4HKLA 1OKOA 4W6YA 5BXXA 2IXIA 4R9CA 3W5NA 3WP6A 3AFGA 1QJY2 3MW4A 4QU2A 1WUVA 5KHIA 1C8M3 2CTVA 3E5XA 5DUWA 2D6NA 2D93A 4L2NA 4UFLA 4D0QA 2OKXA 1DP0A 2FZ1A 4RQPB 5BNPA 1W03A 4XUPA 2Y6GA 3P3PA 2WYSA 3EQEA 1H2LA 2AYHA 1W8UA 3IIAA 1GWLA 3AZWA 1ZZ8A 2VVFA 1HJGA 3U1XA 4Q5OA 4MX3A 3IPVB 1X9PA 3V0BB 2YBKA 1IHMA 2C0ZA 2RS51 3N9LA 1VBA2 3HD8B 4XMIA 3ZXFA 2ZZJA 3KT7A 4G3YC 1LOGA 4IV3A 2E33A 1W2OA 4D6SA 4DEVA 1JODA 1H8TA 4QPIB 4XQ4A 4AVTA 1X9TA 1IS5A 3J8F1 3MFCA 2W46A 4FPHA 4OULA 4XXPA 1QOSA 4LBQA 4Y20B 5A1FA 2QDNA 4QPIA 4YZ5A 1PGL1 3JUUA 3K4AA 3A0NA 4FO9A 2XJVA 2VAUA 3GHNA 4BQ1A 2WL1A 1W2NA 1W8HA 2Y38A 1NCRC 1YC61 2VJXA 5K4LA 1GU3A 3GF6A 4HOOA 3WG3A 1ND2B 2DU0A 4GWMA 1BVP1 1W2TA 4YW4A 2JECA 2WO1A 3UKVA 1AYM1 2WS92 5CFDB 1ZZBA 4A6OA 5A6YA 1OQEA 5C7GA 4LKDA 1SLBA 1RUE3 1UYZA 1W6NB 1UIKA 1Y9MA 2Y64A 3FHAA 5FYMA 3RRDA 5BNNB 2N7GA 2AH2A 2VZRA 1Q56A 4EROA 1LR5A 5FKCA 3SCGA 1VALA 5E8AA 2DCYA 5HCHA 1VMJA 1BKZA 1SCRA 1J3QA 1G7YA 4YGCA 2ARCA 3LEGA 1YRZA 4GWJA 3WW3A 5L9VA 4YVWB 1V70A 2KA3A 4N43A 4GB33 4O61A 3M3EA 1AR92 1XC6A 3F2ZA 1VB4A 3TYJA 4CUBA 1EV12 5DPNA 4XFBA 4PQQA 1TE1B 4YVWA 2XLFA 5ACA2 1RXFA 2D3RA 3E6DA 4AI0A 2LRPA 1PM4A 2V5DA 3HN3A 5HV4A 4CUCA 3LEIA 5A80A 1UOFA 4JGYA 1N47A 4AQTA 2UY9A 4FPYA 5JSRA 3C7HA 4C0HA 3NAPB 4Q27A 2OX0A 3B93A 1H2MA 2Q0AA 3BCWA 2WWUA 1FYUA 5C3PA 2C1FA 4IV1C 2GAUA 5J7MA 2YROA 1D4M3 4FSJA 1PVC3 4Z2WA 5GZFA 5CAZA 1UZYA 2J1SA 1C1FA 1SPPA 4QD2A 1S0BA 3ACLA 3D6EA 5GZDA 4NMIA 4IEWA 1LOBA 2RM23 3WF4A 4IGQA 1ULCA 4AFMA 4IGPA 4LQRA 3KCYA 1CAUA 4XF9A 3ZSMA 4AZZA 1HQNA 3VKNA 2IXKA 2ZXQA 5C6CA 2RG4A 1OXCA 2XH6A 5FYSA 1H30A 2MPFA 1GP4A 3EBRA 1UU5A 5CBLA 3EHKA 2AGSA 4AHXA 1Q8OA 2R1DA 4A4AA 1YEWA 1VIWB 3OGRA 1J3RA 1JU4A 2ZGMA 5I93A 2PQQA 2CGPA 1FATA 2ILMA 4JDMA 4YW7A 1JH5A 4WM8A 4CXXA 4CEYA 2LW8A 3MPBA 2DUOA 3LA7A 4XDPA 1UPSA 1QGLA 3ZIXA 5J48A 3H8UA 1DU3D 1D0GA 3KS7A 1G9DA 3FL7A 4YM3A 5TSWA 4IEYA 4P9IA 3OGJA 2K46A 3U0ZA 1YXWA 3QOPA 3U78A 1COV2 1YFUA 4OMDA 4WZCA 5AFEA 2JE9A 1OLME 1KDMA 4CU7A 2RR11 4BIFA 2ID4A 1STMA 3MUZ1 4UBHA 3LGRA 3LD8A 1W28A 2W3JA 1NY72 3AP9A 1DBNA 1NLSA 2C6SA 3PMSA 1UWWA 3RGBA 1QJX1 5L9RA 4LNVA 5L7OC 1DGRA 2QCSB 3OPWA 3TBDA 4YGBA 3ASIA 3TN92 2XQXA 2EIDA 3HMYA 1O8PA 2RS32 4FP2A 5JI7A 4LLFA 2YPJA 2D97A 2VBPA 5A6QA 4YW5A 3UGHA 5IK8A 4FI9A 3PU8A 1R1A1 4QX3A 1QY4A 4COWA 1CD3G 1W6QB 3VBUC 4HETA 5LEJA 3FHQA 3S5QA 2XDVA 4K21A 3UJOA 4HSJA 1QH7A 5FUIA 2ZGUA 1AYM2 1V9U3 1REDA 2HWB3 5A33A 4Z2AA 4YZ2A 5A70A 3RS6A 4CDXC 2YBPA 2ZGNA 1VBD2 5AVPA 1ND3A 2W5FA 3GBFA 3VL9A 1SLTA 3GBGA 4GH4A 5CADA 2WAAA 1R082 5JOZA 4LPLA 3PJYA 4W4ZA 3GZUC 3WF3A 2KD7A 4CA9A 1XXNA 4FTBA 3A23A 1VBB1 1D4M1 3G7DA 3I59A 2R49A 2R1BA 3APBA 3M3CA 4WZFA 1AXYA 2GC3A 2YV8A 2ES3A 2BRTA 1HDKA 4ZU4A 4Q4X3 3S0MA 1EAH1 2FDGA 4PIYA 3T1LA 4W6XA 1GZ9A 5FKBA 2HEVF 4Z92B 2ORXA 4PQ9A 2R072 3SMHA 3ZYFA 3RWNA 4CCDA 5CG8A 3DYPA 4QB2A 5FLHA 5DAWA 4OHYA 3PVOA 5JI9A 3GZAA 5FLIA 4XILA 2NQYA 2QZ3A 4YNIA 4OI1A 1VBA1 5JPNB 2RS52 2YUEA 1WMDA 1QDCA 3E5QA 4H3WA 1NLRA 2B8MA 4XABA 4PBOA 1TEIA 2PAKA 1HB2A 2Y6LA 2ARXA 2EIEA 4XFAA 1S0DA 4RGAA 2ZGPA 2E9QA 2X5IC 4BK5A 2W91A 1W39A 2QVSB 3O0VA 1CR7A 1DGWX 5I0DA 2R30A 1AR62 1RUE1 1CAXA 4BXFA 4ZKTB 2FDJA 5BYNA 1ENXA 1MZEA 1W0NA 3NO8A 3ZXJA 5FY9A 3LWCA 4D3WA 2QQIA 2BWAA 2QTWB 1CZTA 5GKAC 5BNNC 3PUAA 3NV2A 1PMJX 2V5YA 4HONA 2IVJA 2GC2A 4YW6A 1ODMA 1LOFC 4N7IA 3MIHA 1TMF3 2D6OX 3T09A 3B02A 2RS31 5I8YA 3S5AA 3MICA 1DQ1A 4RFRB 1JZ5A 3KHBA 3WOGA 1W06A 3ZSEA 1ASJ1 2VOXA 2Q8OA 3T2OA 5LY1A 3FWEA 4XBLA 1H8TC 1AZDA 2DTYA 1Z7S3 2BZDA 4YGDA 4XF3A 5FZ9A 3I7DA 1LENA 3ZIWA 4CEYC 3NV4A 1O91A 4IERA 1EAH3 3N9QA 4IV3C 4A3ZA 1NKGA 5J1XA 5JWPA 2Y0IA 4QB6A 3POSA 1EYBA 3SCHA 1H1IA 2OW4A 1J59A 4RGGA 1AXZA 4BISA 4RR3A 4AG4A 3U10A 2WNVA 1VMHA 2X53S 1ZZ7A 4JQRA 3PURA 4XTMA 4CXYA 3SH4A 3ABZA 3TEYA 5A7QA 2VUAA 4QAWA 4FFFA 3ELNA 3VL8A 4WM8C 4COYA 4CDXB 1JMUB 2RMU1 5DUUA 2XHKA 1FNYA 3QH6A 4EN8B 1QU0A 5A6ZA 1V9U1 4A6SA 4AHZA 1SDDB 1WBFA 1DHKB 3D0JA 2A1XA 2R7EB 4LUMA 3OGSA 4PBPA 3ZYRA 4DPNA 4META 3WT3A 5A1AA 4AEDB 3PMEA 2WBKA 2HEWF 5CZKA 2JDKA 1CGPA 5CFCC 1MS4A 2ZCWA 1C5HA 1ZBE3 3IAQA 1KITA 3CNAA 4YPJA 4AEDA 5LA9A 3I3MA 4DUXA 3PVNA 4BJ0A 2JE7A 2ZBJA 3OB8A 3ZYHA 1QF3A 3B00A 2W9XA 1Y9GA 5FMCA 3UT0A 1KS4A 3U07A 1QJX3 4CP2A 4EWDA 1PX4A 3LAGA 1GZTA 4B4RA 1ZVFA 5IK5A 4LBNA 4RR3C 3POJA 4I30A 2CL2A 4RN5A 4QM8A 4XUTA 2JD4A 4TTGA 2R0FA 3PDQA 1W8ZA 4XJUA 1R092 2QQJA 4C90A 4TWTA 5ISLA 5FZHA 4F83A 2J7MA 1RUG2 2VNVA 3ZX7A 2BNOA 5AVAA 4JGZA 3ZXEA 3EMRA 2WWSA 1JYNA 1LOCA 1MVEA 2XR4A 5E1RA 4LK6A 2XBO3 5DDJ2 1K5MB 1YNAA 3VDDB 5IFTA 1J1LA 2Y6FA 5L7OB 1OH4A 2GNDA 4IDZA 4ONUA 1Y7BA 4GMP3 1X7NA 4QKDA 4MGTA 1YUDA 3VLBB 1H8VA 4QPGA 2WFF3 1O3QA 2JDNA 3WW4A 2DURA 5CKNA 2LS6A 1C4RA 2ZMNA 2GDFA 4CEYB 3DF0A 1NZCA 4NWWA 2R061 4UYBA 1Y9QA 4KH9A 5JZGC 2XL9A 2ZX0A 3E6BA 3LB9A 4XACA 4Q8KA 4BCUA 1NCRA 2VZUA 2JG9C 5KC6A 1U0AA 4XIKA 5LA2A 1W9WA 2ZS6B 2WKKA 2Z69A 4NIDA 2F4PA 4EQVA 2WNVB 2HBTA 2E63A 5DXDA 4V1PA 1T2XA 3LA3A 3WNKA 4JVAA 4CSWA 4Y1XA 1YQ8A 1FOD1 3LSEA 1RUF2 1K12A 2PHWA 2VZ3A 2BU9A 4PIZA 4ZS3A 4ZXEA 3I54A 3VZJA 4JTOA 2WNUC 4YRDA 1QXPA 3TNPB 4LO7A 1EP0A 4AVVA 2VMIA 3GJBA 1POV0 1LNSA 1OUSA 4O9EA 3CEWA 4P9WA 2ERFA 1HRI1 4Q1PA 5FK8A 3IKWA 2FDIA 1D4VB 1LULA 4NHMA 5BNPC 1W3VA 4Q4V2 2B39A 4PCRA 4DOUA 2IC1A 5FRAA 4LK7A 4K9SA 5JOWA 1XU1A 2D6KA 2HWE2 1ZBE2 1UZVA 1RTVA 2WO3A 2ZGRA 4QX0A 5EWSA 3ZM8A 4B4QA 4XDOA 3MF6A 3CBNA 3K75B 2ZMLA 2DCKA 5GJ6A 4B4PA 4ZZ8A 1UY2A 1AJKA 3MV01 2JG8B 4P00B 5JVVA 3OOXA 1UZZA 4QGNA 1RGSA 4QDRA 5T5OA 4ITCA 3GHMA 3UNPA 1I5ZA 5C3OA 1OVPA 2DVBA 2VC9A 1C8NA 1UYYA 4HPKB 1QOOA 2HWF1 5EQUA 5EPAA 4PDWA 2DVDA 3AKQA 5FMDA 3U37A 4ZZ5A 5IVBA 4WM7B 3CIHA 1HRI3 1JUHA 5EXOA 4GH4B 2D6PA 3AMPA 4PLOA 5IT6A 1WGPA 4XE9A 4D6RA 2GP5A 3MIBA 3UK9A 2FZ2A 3NSTA 1MS0A 1QKQA 2J22A 1AUYA 3BVCA 2BDRA 5DUVA 2BNMA 4GXLA 3BI3A 2D5FA 2BBAA 2V72A 3USUA 5IVYA 4CDWA 1X82A 2W08A 1PK6A 5DDJ3 4XDQA 3TEXA 1RUC1 5HCFA 1PO12 1UOBA 3HJRA 5IYYA 4K8RB 2WO7A 3MBWA 2FQPA 5DZFA 4CP0A 1RUF1 1O59A 2H0VA 2ZGLA 3VKFC 2DF7A 1QHDA 1TNFA 5C8CC 3AMMA 4RD7A 4XUOA 4CDUC 5L7OA 4HG6B 5ANQA 5LB6A 1S0GA 2ZGQA 3FX3A 2WFF2 1W6MA 1G6NA 2XJPA 2YG0A 2PLV1 5EZWA 4C1XA 5ABJB 1PO11 1RL3A 1S0FA 2R042 3ZYPA 2GU9A 1GLHA 2O8OA 3DYMA 4HMZA 3VV1A 3ZKYA 3FBMA 4V2WA 1ASJ2 4IEZA 1HB1A 2RE9A 2VOWA 5FOBB 3H8XA 1IOAA 2OQ6A 1FT9A 5DN2A 4PIXA 2CNAA 3OEBA 3ILFA 1NCRB 3WLUA 4BQ5A 3RPQA 1A34A 1QJU1 3HT2A 1VAKA 4QXCA 5FZAA 1YJLA 4LHKA 2D44A 2JB4A 4AGVA 1S0IA 2QQVA 4AFAA 2PHDA 2NZ9A 4I3GA 2BOJA 4YW3A 1JXNA 2P3IA 4AEDC 2XJUA 4QDQA 4GJZA 2WR9A 3LPFA 4A44A 5HV0A 3LFIA 4CCMA 1B09A 1GQHA 3LDKA 4MSVA 4LHNA 1YQ2A 2QUOA 4KGQA 4XW3A 5DZGA 3UKTA 4RQPA 2MHFA 5BNPB 5FO7B 2HJIA 5EYXA 3OEAA 4U2AA 2QQKA 1KDKA 2CU5A 1SLAA 2VR4A 4S2HA 4URAA 1NCQA 1BBT1 3TEWA 3AM2A 4Q1RA 1Y4WA 3MIDA 3VBFB 2BVBA 1UF2C 4W50A 3RMXA 1R091 4LT5A 1U5IA 1US3A 1WLWA 1PHMA 2VPVA 3AXDA 3QACA 1DFQA 1KFUL 5IVVA 3OSDA 1VRH2 5KXDA 3OUJA 4I09A 3JBG1 2C9KA 2PTMA 1A78A 1G9AA 2C26A 3AP4A 4GAZA 2XWJB 5FMBA 5FZ4A 1FOD2 3C7EA 3E97A 4RS5B 5B4XA 3OBTA 4CVUA 4F7ZA 3BODA 1VBB2 3WUCA 1MACA 2X05A 5JMCA 3KHCA 3ZN5A 4KWJA 2WZR1 1VB2A 4MZUA 4FPCA 3I2OA 1O5LA 1YFXA 4CDQB 3CJIA 3C7OA 3KVBA 5AC92 4HL0A 5FO8B 4RGKA 4AVBA 5L9BA 5K0UB 4IEVA 3LDBA 4Q0SA 1HXS2 2WZEA 4AEMA 3W21A 1PO13 1OOPB 1Q5OA 2DYCA 3CQOA 3MW3A 3BIWE 2RS12 5I0UA 4FVVA 4KU7A 3ZSLA 2OZJA 1PX3A 1HRV3 1BYHA 3T2TA 3ZXLA 3UJQA 1XJAA 5KXCA 1V00A 1OFSA 3PIGA 3A22A 2QFEA 1UXZA 1VAMA 2OZ6A 4MGQA 4IUGA 2VMGA 4EE2A 1NYWA 2DU1A 5FCCA 3BGAA 4OQ8A 4AYUA 3WQBA 2WFF1 1Q8VA 1GWKA 3CU7A 2RVAA 4CP9B 4H55A 1GP5A 4QPIC 4AAXA 4F3JA 5FYYA 2V4VA 2XPJA 1KRIA 4E8CA 1Q8QA 1H4HA 1YJKA 4K20A 4XZUG 2WNUA 4CCKA 2JX9A 5LRRA 1W8NA 1J3PA 1RUI1 1MVQA 1UPIA 3RSJA 1FNZA 4QWNA 3IDCB 4A42A 3WF2A 5C9AB 5FZ1A 2WNUB 3AB0A 2IXJA 1C3HA 3AZZA 1POQA 2JDUA 2PXJA 4ARYA 4Q26A 4D7YA 1RIRA 2YPDA 2HH9A 1GZWA 5FZ3A 4QT6A 1YIFA 3U14A 1J84A 4LTAA 1WW7A 2WA4A 4YG6A 2WS93 3Q9OA 1TME1 4XFFA 3WCSA 1GNZA 5SV5A 4Y22B 3VBRA 1CQ9A 1WLTA 5A3TA 1MQTA 3SH5A 1JZ3A 3WP4A 5FZGA 4TLGA 3OJBA 1WCSA 2WN3A 3N7MA 4QPGC 3VBRB 5FWJA 2QQUA 1MQTB 3T3YA 4HLTA 2YYOA 3ZFFB 4O9GA 2LUWA 3LE0A 2W0XA 5JIUA 4IV3B 4TLFA 2VCMA 2Q1MA 2VBBA 3Q8BA 5HI0A 4NVPA 3IMMA 2HWE1 3D8CA 3A0KA 3DYOA 1TG7A 2R071 2RMU2 2JJ6A 4HANA 4M00A 3VZKA 1OLRA 5LBFA 1UXXX 2ZHNA 3HT1A 4JHTA 4ORFA 3KF5A 4P9JA 4M0HA 3SXWA 1JHNA 4XJAA 1RMU1 1ULDA 1WCKA 3DGTA 4PT6A 4E2GA 3AP6A 4RQPC 3ILRA 4UW5A 3VHPA 4HVQA 1D4M2 2RV9A 1JZ8A 1AYN3 2HWB1 3KSCA 3OUIA 1V6NA 3VBOA 1NE4A 3H9AA 4XBNA 5DAVA 5BNOA 1NCQC 1ULGA 4PJYA 1R081 2VG9A 2VXRA 5I0SA 3MIEA 2BBVA 4AQ6A 3HNBM 3H1YA 1LECA 1B35A 1LEDA 3VBHC 3ETQA 1OOPA 1GYKA 5A7PA 1KEXA 4WV8A 2E6VA 2SBAA 4BQ2A 2AC1A 1WZXA 4LBJA 1DDLA 1ZYBA 1RUJ1 1XE8A 5HPOA 5FZCA 1PGW1 5FUNA 2FDKA 1Y43B 3EYPA 1EV13 1YO8A 2YGLA 3RZLA 4OCTA 2XG3A 1YQ6A 1JTZX 3T2QA 1PGW2 4LBQD 4UF0B 4KU8A 1XQNA 2XGXA 3W59A 1AR61 1KGYA 3A21A 5I91A 5F39A 2XUEA 3KLSA 1JZ2A 2GC1A 2ZA9A 1QNYA 4XAAA 4B7EA 2VTXA 2H6BA 2I07B 1ND2A 2WA3A 3WG2A 3ZFEB 4XHBA 3WY6A 5E6HA 2YDEA 3B9IA 3D4KA 4LULA 4YW1A 3VHRA 1CAWB 2VZPA 1PZ8A 2PAMA 2VZ1A 2RM22 3IDAA 1UY1A 2VUDA 2ZKNA 4TN7A 3B94A 4XF4A 3KQRA 1SPPB 4CDWC 3KV6A 3VDDC 1RUI3 1K5JA 2VVEA 1CONA 5A3PA 5C8CA 5GZGA 2WFPA 5FZOB 1QWRA 2ZKLA 4PI2A 4UFMA 3AC0A 4CEWC 3B01A 1GOHA 3J8F2 5AFBA 5C3QA 5FZMA 4TYSA 2WT0A 3VN4A 3DPRA 4AFCA 1EPWA 3MIFA 2KXLA 1H6XA 5CU1A 4BHPA 4EJRA 3POGA 5FZOA 4CU8A 4P9XA 1BZWA 3M3QA 4CE8A 1N1VA 1T6GC 1NQJA 2XUMA 4YARA 1CZSA 4Y24A 4HXCA 5IVEA 5J09A 2PHUA 1U5YA 2ADDA 3KZ4C 2Y6KA 1K45A 2WN2A 1PNGA 2GMPA 4JGYB 3AMHA 4IEQA 4LE4A 1IS3A 3VD4A 4WM8B 5J96B 5FZ8A 2CYFA 3BTYA 5EJZB 2W47A 3BALA 4DB5A 5KHJA 1J1TA 1GNYA 2A3XA 1NA1C 3UL2A 2B4KA 1AL23 1MZFA 1TME2 4TSVA 4ES8A 2BP6A 2YC4A 1AF9A 1G9FA 2XJTA 1QJY1 4BMBA 3RZGA 1JN2P 3HAGA 1CAUB 3LIHA 4NO4A 3ZN4A 4YG0A 1YFYA 3RZJA 1NCQB 2UYBA 1PIV2 1WD3A 2RDRA 4DIQA 4AHWA 2NMNA 2J1RA 4KWLA 4AI3A 1WLDA 2UU8A 1OPOA 3I2KA 2W1WA 4GB31 2EICA 4Y4YA 3JBG3 2ZGOA 3WDUA 4N90A 1O4ZA 5LRSA 2P6HA 1V6JA 2RR12 1WLCA 3OCPA 4P5HA 1RYYA 2DDUA 3NNMA 1QOTA 4CZSA 1RINA 2B9UA 1COV1 5C5TA 3O14A 2BQPA 2YXSA 4HKOA 3WINE 5DABA 4OHXA 1G9CA 1XOYA 2VCAA 5FZKA 3O1VA 2JDHA 4I01A 5FZBA 4GH4C 1AYM3 4LXLA 1VBE3 5G04L 5GLUA 3U75A 5D8AB 1BK1A 2EAAA 3BN6A 4AQSA 5F1RA 4Q0VA 4ARXA 4LITA 3WEZA 4BWOA 1YQ5A 4ET7A 5T54A 2P6CA 3BYWA 3WD5A 2BGPA 4Q0QA 1K5MC 3LA2A 4Y3OA 5D8AA 1WW4A 1MPXA 3JU9A 2BGCA 3K3NA 3ON7A 3I2IA 3IDBB 3I2DA 4QX8A 4LLOA 4AW7A 2Q5TA 3E6CC 3AZYA 4NHYA 4OZOA 5AC91 3N7LA 1W0OA 5DZEA 3WX5A 1TVGA 1UO9A 4J25A 4L8QA 5A32B 4EN9B 4LKEA 3S7EA 1VMFA 4FXGB 2C24A 3IWZA 3ZMNA 3J8F3 4CEWB 5B4NA 1R1ZA 4LHLA 4QKFA 1AL0G 4R9DA 2A5ZA 1WW6A 3PUIA 5C4WC 4MUVA 2DVAA 4XQWA 1QJEA 3DPRB 3I3QA 1NOVA 2ET1A 1FMD3 3N9OA 3O0WA 1PGL2 4QHOA 4A7KA 1ZZ9A 2ZEYA 3WHTA 2CV6A 2JG9B 4W8JA 4OLLA 4CCEA 4PHZA 2W68A 1KFXL 1PO23 1VRH1 2I45A 3KVAA 3EJKA 4JZRA 4BLJA 4R52A 1LCLA 5FZ0A 5A7WB 2A70A 3HBKA 1OA4A 3O7OA 3RFRA 1IG0A 1RUC3 3ATGA 4LBOA 4AGRA 2RM21 5IUQA 3JZVA 2VQUA 4FQ4A 1CVNA 1U5XA 2P3KA 4JV4A 1CPNA 3VDAA 5JXJA 3DCQA 3JB8A 2BTVC 3VDCA 5BY5A 3MDPA 1VBD1 2ZGSA 5LBEA 2FMYA 2VW0A 4JGZB 2B45X 2D43A 1ND2C 1CIYA 1SBEA 1XSRA 3POYA 1CIWA 1AR91 1UMIA 3JXSA 5LCWL 4OI4A 3VD9A 2A3WA 1GWMA 1S0CA 2R0HA 2ORZA 4XAEA 5FY0A 3DUIA 4QQOA 4JQTA 2W39A 2HWF3 2PHLA 3J9SA 5T5PA 1ZREA 1JOBA 3HQXA 5IJRA 1ZBA1 2EVXA 1HN0A 3J4UH 2IFRA 2VZTA 3MO4A 2JG8C 5F32A 2A75A 4F8AA 4CU6A 4B1LA 2WT2A 4FOYA 5FZIA 4G4FA 2WINB 4OI2A 3UGFA 2BFUS 3WNXA 2RR13 3FLRA 2GMMA 1XNDA 3LOIA 4JC1A 2SLIA 3TN91 1RITA 2ZEZA 1WWYA 2BYVE 4H2AA 3WG1A 3POEA 1QJX2 4XQDA 5EFUA 1V6LA 2JIGA 3WQ1A 4BK4A 4JKKA 1BQPA 2DFBA 1Q8PA 3OY8A 4QHBA 1FX5A 1OD3A 3KT4A 2PLV2 4PLNA 4N53A 2A6VA 2KR2A 3VKOA 4BIOA 3LOBA 1CAVB 1D0HA 1L7LA 4YM1A 4ZXKA 1JOJA 3UV9A 1PNFA 4UW4A 1PM7A 2VQTA 3OY8B 3WSOA 2QE3A 2G9ZA 4QKNA 1HKDA 1XB9A 2NLRA 2RHPA 1W8OA 4W6WA 1W9TA 4CDXA 2QQNA 3P1IA 3W58A 4CDQC 2FCTA 2D40A 5IAVA 4A45A 1M4WA 3C3VA 5IAXA 2ARBA 5FYBA 1J58A 5K0UC 3RI9A 3THCA 1NA1A 3WHUA 2FDHA 2XOMA 3I2FA 3CZJA 3THTA 4MXWB 4K8FA 4P5YA 3WNLA 1IPSA 2CSGA 3H3UA 3WP5A 1BJQA 4Q4Y3 3M4FA 3T30A 5FAXA 2R063 1SBFA 1O8SA 2G19A 4CP1A 4Z1VA 2EXHA 5GZCA 5H9SA 4J1WA 3TAYA 1PGSA 1W6QA 1U12A 3ZYBA 2O0OA 1KJLA 2AREA 1SFPA 2YC0A 2ZX2A 5ERLA 3WDYA 1OPMA 1F4HA 1T6BX 4A7ZA 3H0OA 5LA1A 1F2NA 4I2OA 4NIHA 1C28A 3UYJA 1CZVA 1FPN1 1RUH2 2A6XA 2LM3A 2E51A 4QU1A 4QQLA 1DQ0A 2K9ZA 4AE2A 1UX7A 3AKTA 4IETA 3M3IA 2V4AA 3HPNA 2VE1A 3LKJA 4GIQA 1WMEA 4WVWA 1YCIA 5FTTC 1HIXA 4YVSB 3GCWA 3WXPA 5FPUA 1RJ8A 4XVHA 2JKBA 2GALA 4Q4V1 3VKLA 2VL4A 3AKSA 2X5IA 5DUXA 3AYAA 4BMEA 3Q8AA 4AWDA 3M1HA 1IQAA 1Z0HA 3LSDA 4K3UA 4QGLA 3AZVA 2ZPXA 5KHKA 3G6JB 3FE5A 4LO4B 3D5OA 4AXOA 1K5MA 4HFSA 1IG3A 3VDDA 1KJRA 4Q0UA 3GDBA 2RJ2A 1AXKA 4Y1YA 3FJSA 5ACA1 2QNKA 4UW3A 1S0JA 1ZA4A 4DMIA 1EV11 1QMJA 3K2OA 1HB3A 1S1AA 1URXA 2QQOA 3IIIA 4LOTA 3ZYGA 3EXUA 5FOJB 2B7YA 5FIXA 3AYCA 1AR83 3UGGA 3CO2A 2W52A 4ISQA 4XPVA 2X10A 4YYOA 4XF0A 1UW8A 5FY7A 1D2QA 3V64A 1JYCA 3H8RA 4OMCA 4UWDA 2Q8DA 1XNKA 2RDQA 2RS11 2MEV2 4JKMA 3BPSA 3LPGA 1W99A 2JWPA 4LBMA 4TXWA 2PLV3 3N9PA 1HXS1 4XYXA 5FR3A 2W1UA 3A4UA 3RQ0A 2RDNA 1K42A 1RVF3 2CDPA 1RJ7A 4L97A 2GP3A 3KMHA 2G4IA 4H14A 2JICA 5FY5A 5KHHA 2A3YA 2WQ8A 3B5LB 5CVRA 4E2QA 3RZMA 1S2KA 4QGMA 4FPKA 5F5AA 2A73B 4IE6A 4KMQA 4N9HA 1OOPC 1H4GA 4HN1A 4LEJA 3BTZA 3UESA 2IXLA 3V56A 3DL3A 1VR3A 1DZRA 3QLQA 4MADA 4RHV1 4RA0A 5FXWA 3MPPG 1U5ZA 1UL9A 1ZNPA 3MGUA 2HWE3 4P9YA 4IEXA 4HVRA 4Q4Y2 2Q1FA 4A7YA 3T0DA 4FPGA 2ARAA 3DPRC 4QB1A 4DRRA 1OMIA 5C4WA 2G9FA 1OT5A 2BPA2 1ZX5A 4R4ZA 5FREA 5D21A 1OBNA 2EXKA 5IFPA 5JUVA 2H6CA 2JB8A 5JOXA 2GH2A 1HW5A 2Y0OA 3K4ZA 3SEPA 2WNOA 1RHI2 4FOWA 2VECA 4B7KA 3O1PA 1LEMA 3HN1A 4GULA 4Q2FA 3WG4A 4P9GA 1GBGA 2VM9A 1WCUA 5IVCA 1NXD1 1YHFA 2GN7A 1LRHA 1MEC2 4BZ4A 4PDWB 4NOTA 1RB8G 5J3UA 3BPZA 4RS5A 1MR5A 2ZHKA 3S6PA 4UFKA 1MS1A 3OGGA 4X8NA 4Y4RA 2BW8A 4YW2A 3K48A 3ZXAC 1X8EA 3H50A 1VAVA 5L73A 2XL7A 2I2SA 4I0WB 4QXHA 3IMNA 5A32A 3ALQA 3NV1A 3KGLA 3ZMOA 5FWEA 1EY2A 3CJIB 4D8MA 4Y5Z0 2D7FA 2DUPA 4CDWB 2HWC3 4JHZA 2VOVA 2VBDA 1X8MA 4WVVA 2YHJA 3K46A 3LQCA 2OPKA 3I2GA 1RC6A 2UWAA 3VBRC 2PMWB 2VZOA 2OXBA 3T0BA 4C91A 3OPZA 1SACA 2BFUL 4DY3A 4E27A 4AHYA 1W6MB 1AR82 1ZRRA 3IDEA 4OVEA 3JQWA 4NWVA 4WVMB 1YQCA 5GLWA 1UYPA 1XNCA 3WNNA 2D6LX 2Y34A 4XJZA 3WDXA 3GBWA 2ZOEB 5JSOA 4Q4X1 5KXEA 4FOVA 4P9LA 1HV0A 1QXJA 4BYYA 2A6YA 4NRMA 3AX4A 2QQMA 5F37A 1UIJA 4XHXA 1MS9A 3PUHA 1IS6A 1FV2A 4IE7A 1PK6C 5FV3A 4GMP1 5K9YA 1BLZA 1M06G 3I97A 1ODNA 5E88A 3T1MA 4FOQA 5K7PA 1OURA 3AVRA 4XCBA 4DUVA 1COV3 1YI7A 1W6OB 1AR72 4N8MA 4BQWA 2P4EA 1HQLA 3M7AA 4LO6B 1RUD1 3KGZA 3VBHB 2DVGA 2NN8A 5IK4A 1WD4A 1ULPA 4XUNA 1RUE2 2PAEA 4ASMB 4COZA 2ZZQA 1JU3A 5T50A 3E1F1 2RS13 1A8MA 4Y33A 5FLJA 4COVA 5LWBA 3Q8FA 5A3OA 5A3NA 3RI8A 1GP6A 1IGOA 3NQHA 4LKSA 4N43C 4Y22A 5G05L 3RYKA 3R05A 3W5MA 3J7NA 1SMVA 1W8FA 4XFIA 3ZXGA 1DQ4A 4NE9A 3PVBB 3CDZB 4AVCA 3PIJA 4A41A 2VUCA 3USSA 4GQ7A 3WUDA 1QJFA 2JENA 3AYEA 1S4CA 1XYPA 4IEUA 1AL21 3RDIA 3THPA 4ZONA 1VE0A 4M3CB 2YC2A 4HKWA 4CCLA 3R4UA 5HCAA 3KB5A 1F9KA 1RUD2 2VW2A 4K1ZA 3SHRA 2C4XA 2D5HA 1HN1A 2IXCA 3R0RA 3V65A 4M4RA 4KWUA 1BK0A 3L2HA 1W04A 3MUY1 4N53C 4ZU5A 2E7TA 4NPLA 3ZFEC 4JX0A 2ZGTA 5C3SA 3WDTA 1CJDA 3ACGA 3IZOA 5L36A 4QHZA 1LHVA 1IPKA 2LROA 2WZR3 5HXVA 1UYXA 2VCBA 4EZ4A 5FJHA 4QQPA 1LHUA 1BCXA 4CDQA 4COUA 1AHSA 1QEXA 5FYZA 1XRUA 1FAYA 1G8WA 3TNQA 3IPVA 5EIYB 1NLQA 2XKOA 3ITQA 4R8HA 3IBMA 1TZOA 1ZZ6A 4Q29A 5FPAA 2ZJCA 3T0AA 4EWAA 1CESA 3VZNA 1UMHA 4LA2A 1SLIA 4IESA 1KD7A 1D7PM 4MHRA 1WCDJ 3U11A 4AI1A 3ACIA 3M2MA 3ZXDA 5A7OA 1AR81 1DG6A 3AYDA 1GUIA 1H8TB 3GNEA 2PHXA 2JDPA 3OG2A 3BOPA 4HPKA 2NM1A 5F6LB 3ZSJA 4FTEA 1F4AA 4NRPA 4LIUA 3NRUA 2UWCA 2OVUA 1R1A2 3NV3A 1JUIA 3MLLA 5FXVA 2E7AA 4JRAA 1YLLA 2GZWA 2J1TA 3QBQA 1F5FA 1VBC3 4GZ9A 4D94A 5HXMA 4TZDA 4RS5C 5JZGB 3BKZA 1HQWA 3DKWA 4B1MA 1GOGA 4XCAA 4NIGA 3VZMA 3J7HA 3X29B 3HR9A 4FT8A 5DDJ1 3SC7X 1AR63 3WW1A 3ZN6B 1O4YA 1W90A 1PK6B 2ZAHA 2YB7A 1NY71 5BNQA 1X33A 1Z78A 3KD4A 5C9AA 4KL1A 5FY4A 2HWD2 4UFJA 5IHRA 1HLCA 5I0TA 3VBSA 4JGZC 4QM9A 4R9AA 3ROUA 3ZFGB 1JYTA 4J1XA 3SKVA 4NHLA 2BVVA 4NHXA 1O4TA 1Q43A 3ETPA 2GC0A 5CFCB 2VNOA 4OHZA 1Z7S1 4K40A 2A6WA 4PI0A 3AMNA 2AR6A 3O1RA 1O3SA 4Q0PA 1S0EA 2YFUA 4D69A 1AJOA 1JYVA 2GH8A 4C0BA 2FCVA 5F3IA 1W2AX 1LODA 2AUYA 2VZQA 3I4IA 4QKBA 5JLVA 4ZS2A 3R6SA 4BE3A 2RS33 2F17A 1TMF1 4DEQA 3OF1A 4LE3A 3DXUA 2P1BA 4RYDA 1CJPA 3ZLIA 4ZU7A 1MS3A 1V6OA 4XJ8A 4UI9L 4Q4Y1 1H6YA 4CXWA 4DXZA 5JAXA 3PLQA 3AKPA 4AQ2A 1VRBA 1RMU3 4NPMA 5FP9A 1XNBA 3ZO0B 1K3IA 3OYWB 3ZPYA 4JAAA 2JDYA 5CG9A 2OPWA 1AVBA 2ZGKA 5F2SA 4BQ4A 3BTAA 5FUPA 3FC0A 1ZA7A 5FJKA 4LA3A 1V9U2 4KQ7A 1NZIA 2VUJA 3PNAA 1RXGA 3I8TA 4JKLA 4XURA 1OH3A 5FZ7A 4MGYE 4AFDA 1R083 2H0BA 1X36A 3HEIA 2EA7A 2HBUA 3M70A 4FAGA 4PF5A 2JDMA 2NP0A 3AMQA 4YM2A 1UOGA 3MW2A 4CDUA 3BTXA 1QIQA 2K2SA 2E7QA 2ENRA 4XETA 5CKQA 4Q4W1 2RDSA 1WMFA 2ATFA 3ZYIB 3JQXA 4I0BA 5A3WA 4KBZA 4Y5SA 1OF4A 2VMDA 3QH7A 3NWKA 4YVWC 4CCCA 3VUOA 5D2AA 4HT1T 3THDA 1IPJA 1EUTA 1OA3A 4W65A 2HWC1 2B46X 2AEYA 2XVLA 1RUNA 2D6MA 5CYYA 2CWMA 2BV4A 4L92A 3GXUA 1ZBA3 2UURA 4RL7A 3HQRA 2XKPA 1I6XA 2IZWA 5F8PA 2RS53 3VHOA 4ZHNA 3VZOA 2WZ8A 1H1MA 3ENRA 2I74A 2XHNA 2OS2A 4UF0A 4CCNA 1VJ2A 1FXZA 4OQ9A 3BU0A 5CKMA 1UU4A 3W20A 3WP3A 3SITA 3GJAA 4HBNA 3GM8A 4L11A 3WDWA 3SCFA 3JD73 4LHSA 3MIGA 2CGNA 3UETA 4LBKA 3WW2A 5FZFA 2XBO2 3LFMA 2HWD3 2F4LA 3HVDA 3VBOB 3LIGA 3ZFEA 1OFNA 1W9FA 2ZMKA 3NNLA 2VOKA 2WS91 1V0AA 5BNNA 5LY2A 2CY6A 3PJQA 4LJHA 4FAHA 1JZ7A 1CAWA 1S2EA 2AENA 1Y3TA 2BGOA 1PMHX 2DTWA 3VBSB 1GICA 2P17A 1W2UA 1VLNA 5LBBA 4D6QA 5IATA 3VHNA 1XSQA 4G9SB 4GJYA 3URFA 3KM5A 2DCZA 2VMEA 4WVMA 3N9MA 4U36A 4AI2A 4ISRA 1OC1A 2YGMA 4N9IA 4RHV3 4O65A 3V0AB 3VBFC 1V6KA 4SLIA 1J83A 4YFWA 3RZHA 1ENRA 3RG0A 3AP5A 4FQZA 1EAH2 2PFWA 3HOBA 4QDSA 3N3HA 1US2A 2UWBA 4MH0E 4YZ4A 2Y60A 3CJXA 3LDRA 4DXRA 3LZZA 5A3LA 1ZRFA 2HEYF 4QX7A 3AJYA 2W2IA 5GALA 2JG9A 1LHOA 1JYWA 5J98B 4HK9A 3ZPOA 5K8SA 2P34A 4DINB 1CX1A 3GYDA 4YLZA 1SCSA 5C33A 3MZHA 3B3QE 4NIAA 3OTFA 2P5BA 2RJKA 2QQPA 5JSPA 1UAIA 5EV7A 3S7IA 3I59B 4LO5B 4AEJA 3OBZA 1VBE1 1ND3C 3MFAA 1W9YA 3OPTA 3HIFA 2HKXA 3HWJA 2OUJA 4MO3M 1PIV3 1N1YA 5FQ0B 1BBT3 5F7UA 3TOJA 1GQPA 3OUHA 4CDUB 3FUQA 5FK7A 4XFGA 2JDZA 2XVKA 5KBFA 3WQ0A 3V0BA 2NYYA 4IGOA 4EYUA 4ATEA 5ABJC 5JXIA 4HN0A 3DV8A 2DBNA 4JTNA 2HYXA 1F31A 2VTXJ 2WSVA 3K4DA 4FCAA 1DYKA 4S2FA 1JYIA 1N3OA 5FXXA 5IVFA 3RZKA 1SEFA 4B29A 2WNEA 1QQP3 5FPXA 3VD7A 1QJU3 1PO22 1PVC1 3M8LA 2FDFA 2A71A 3AFKA 4LBQB 1R64A 4GA9A 1R093 5I8SA 2K0GA 1VBE2 3NL1A 1QJY3 2VMFA 3J26N 4S2GA 1V6MA 2B5HA 3DXTA 4A3XA 4MHUA 4NJ4A 1RUG3 3OD0A 3P5BA 4LIVA 4EWEA 1CAVA 5C9AC 3LF7A 1H9WA 3ZFGC 1ZRCA 1LOEA 2ADEA 2WT1A 4XUQA 1I1EA 2WZPP 1DCSA 2XQRA 3WV6A 5L19A 4BXSV 4GD4A 3LEMA 2DCTA 1F5JA 3R4SA 2XJRA 1S2BA 2WQZC 4I02A 4NR1A 5FYCA 3PVEA 5BNOC 3O1TA 4I3PA 5FXZA 1W6NA 4WBBA 1GNHA 1WA4A 2ZABA 1JOPA 4XFHA 4SBVA 1JZ6A 3POIA 2PYTA 4AVAA 1CPMA 4MXWA 1ZM1A 3H1MA 4XZPA 4CEWA 4GALA 4CPBD 2TBVA 2W95A 2XXZA 3Q8EA 4FPEA 4NROA 4DUWA 4QXKA 2WQ4A 4LOSA 3ZOIA 3B9CA 1F8VA 1CX4A 3ACHA 2QDRA 2VH9A 1S55A 2WLPA 1DQ5A 3GZEA 1BHGA 2WDBA 1LGBA 3CL1A 2XLAA 4XOGA 2OQ7A 1MZ5A 4LBLA 3L9JT 5DAQA 5KR7A 1N1TA 3N7KA 5D8AC 3BOWA 3BB6A 1C8M2 1DGLA 4DXSA 2VQ0A 1OVSA 3NAPC 1UZWA 4I0AA 5A6XA 3TEZA 3I3EA 3ZDVA 4DFSA 4JDOA 2VTFA 3SLIA 5FYUA 5FPZA 1GZWB 1G86A 2R32A 3VKMA 3JD71 1IKQA 4BQYA 3PUSA 3E5UA 5H9RA 3ZDSA 5KC5A 4YZ3A 3BIEA 1YIPA 3IB3A 2GMEA 3PUQA 3P3NA 3ST7A 3ZKUA 3CLPA 4CTEA 1PZ7A 1IS4A 3ZSKA 1W8WA 1E5IA 4BPZA 2JEMA 1PO21 1VRH3 3VGIA 4NAOA 1JYXA 1APNA 4Y1ZA 3SEEA 1PVXA 4A2UA 1XNAA 2NPIA 1AR93 3AP7A 1BMV2 2OUHA 5E16A 3HQUA 3PHMA 1DF0A 2Z42A 1JW6A 1OKQA 1UNBA 1W8TA 1FMD1 2PN5A 4AK3A 3IT8A 4Q4W2 2DUQA 1QQP2 1FOD3 3T2PA 2W92A 5D1IA 4FXKB 3HNMA 3O1OA 3H3LA 1C8M1 2TNFA 4XXAA 2J1UA 3CZUA 1NE6A 4LKFA 1OLQA 3N35A 3J7MA 3K51A 4N53B 4FBFA 2Z5WA 4UAPA 3NMBA 4AVSA 5DAPA 5CNAA 3NNJA 2RJLA 3QCWA 3WNPA 1SLLA 1DGWA 2W1QA 2JIJA 4MGZE 2ETEA 3H7JA 4ASLA 3KCCA 5FPBA 2VO5A 3FN9A 4KWKA 5FP3A 1OQDA 1SBDA 4Y26A 1C1LA 3CF6E 5FFOC 4INDA 1HJFA 3MV11 2GNTA 4E9KA 4XBQA 4NUBA 5BNOB 3ZVXA 2QZ2A 4HK8A 5A3MA 4IEPA 5FYTA 3PU3A 2WC2A 5LK7B 2A7AA 4Z07A 3MLJA 3NJZA 3EO6A 3O0XA 3CKHA 3VD5A 5JMOA 1MQTC 3OGVA 2ZX1A 4UOJA 3PTRB 3ZFFC 4IW3A 4XMAA 4KBBA 4FPOB 2VZVA 3ACFA 1H2NA 4DNYA 5A1LA 5ACA3 4GWNA 4HZFA 3RYRA 2BWCA 3OD4A 1KQRA 2EF6A 1RUH3 1XYNA 2DFCA 4ZY9A 3VBUB 2VNGA 2EIGA 2D3PA 2VGDA 1GOFA 2AEZA 2WUHA 2J1EA 5FZ6A 5GLVA 2E26A 3CHXA 5FO9B 4MGIE 3VBUA 2YBSA 2VD7A 4E4SA 2CHHA 3C2UA 2HWD1 5B2GB 3RNSA 2P3JA 2PELA 1PVC2 2ZHLA 1HV1A 5FMOL 4YVSA 3B7MA 1LB2A 1V6IA 4IE0A 1ND3B 1QJZA 4CUGA 2EXJA 1ENSA 2F6BA 4DO0A 1NA1B 3AK0A 1ALYA 2B42B 1CWPA 1D2SA 5JIAA 4BB3A 1XE7A 3H7YA 2VU9A 4NN0A 4AI9A 5DMYA 5J36A 5T55A 2DCJA 1ZRDA 3TRSB 1W3XA 4L0PA 4EZHA 1QQP1 2G9GA 3KQ4B 4XEZA 1LKNA 1XE0A 3FLPA 4N43B 5JCTA 5C8CB 1YI9A 1WBLA 2YU1A 4AOCA 1UKRA 1B35C 1YFWA 2WJSA 5LA0A 5LEKA 1N3PA 1ULFA 3NJVA 1VBC1 4URTA 4XJWA 3DEMA 5FYIA 3FHIB 1JHJA 4MGKE 4AL9A 1JZ4A 2FCUA 1DYOA 2ZHMA 4E4HA 4WM7A 2VVDA 4Q4W3 5C8WA 3T08A 2Q1ZB 2RMU3 2MEV3 5ANNA 1OHFA 4XIOA 3HBZA 4HVOA 4CCJA 4YFZA 2J42A 3UKNA 4AGGA 2HWB2 1RVF2 2X5IB 4PDWC 2ZAAA 5LW9A 1UZ0A 1W05A 4FFGA 3SH3A 4Z8BA 1NUKA 1LHWA 2YU2A 1SDWA 1OUXA 1PZ9A 1W0PA 2KM2A 5F3CA 1CN1A 2BUKA 1CAXB 4OUEA 1LJ7A 2Q4SA 4UXAA 1C57A 2VQAA 3JB4C 1BEV2 3NJYA 1GV9A 1PMIA 1UU6A 2QJVA 3GCXA 4M3CE 4E2SA 1DGRN 4QXBA 5JOYA 4XFCA 4IEOA 2D3SA 4AI8A 4MVTA 1VP6A 3TN93 4Q8LA 1UY3A 2OA2A 5ABJA 3AJZA 3IM0A 5BV6A 1HRV2 5KXBA 1GZCA 4ES9A 4FFHA 2JKXA 1IKPA 3T4HB 1G9BA 1ZRIA 2BEOA 2NMOA 3KV4A 1AX0A 3U4SA 2OIIA 3N36A 5JXGA 4DQAA 4D7TA 2JE8A 5C4WB 2FD8A 1WKYA 4BOWA 4XF1A 2VMCA 3AL5A 1REFA 5IVJA 1JBCA 1RHI3 3P6BA 3NVCA 3I2HA 4MOAA 2FHRA 2L9LA 4UFIA 3I2JA 1MEC3 1NAEA 1VBD3 3RMYA 4AEKA 1AR71 4R9BA 2VMHA 4FPJA 3SNMA 5FP8A 4D7SA 5EJ3A 4OUSA 2W87A 4IL7A 3RZZA 2X09A 4WVZA 2JD9A 3H8OA 2VCCA 4IXLA 5J37A 3K3OA 2Y26A 4QX5A 4M01A 3ZR6A 2IFWA 5HCBA 5F3EA 1Q3EA 4BDVB 3MYXA 5GM0A 1UOJA 4P02B 1RUI2 1AR73 1OA2A 1TNRA 4GKYA 3WF1A 3MLKA 4YSFA 3OBAA 3WF0A 1RUJ3 4DRVA 5IK7A 2HWC2 2Y33A 3O1SA 4Q4X2 2CAVA 1YWKA 1HB4A 1SLCA 2VXJA 3VBFA 1NG0A 2OYZA 4RFT0 2XONA 3ORJA 2JDAA 3O5SA 2R073 2X29A 4K1YA 3O12A 2VY0A 5APAA 1PIV1 4N7UA 4NPRA 3O1MA 2R16A 4CYDA 2UY8A 4AAPA 4M4PA 3I3DA 3S30A 4BU2A 3DKQA 3VD3A 5LATA 5FZLA 5A33B 1O5UA 1E5RA 1O3TA 1SHWB 2LALA 3ZR5A 2AZ5A 1LTEA 1SG3A 1REEA 1UX6A 4NIIA 2Z79A 3VB9A 1ULEA 1MS8A 4FFIA 3VZLA 5JR2A 2P37A 3KV9A 5LZ6A 5EYYA 5A7NA 1LAJA 1H0BA 2E31A 1UY0A 3ILNA 1UMZA 4X6RB 1TME3 1W9SA 5T5JA 2C9AA 2GNBA 2YMZA 2AACA 4X6QB 5C3RA 3K77A 5IW0A 2DVFA 2QBXA 3N4MA 5FBJA 2WZR2 3WNOA 5F5QA 5CFDC 4QQHA 1EUUA 2MNGA 2IUWA 4QQ2A 1AYN2 4QX2A 1BEV3 3MHZA 5DG2A 2XWBB 1TMF2 3TWIA 1GMMA 1L7QA 1I9RA 3FLTA 1POV3 3B69A 1NQDA 3WR0A 3AXEA 1NXMA 1ENQA 2DWRA 1SZBA 3PTYA 2PHFA 5H9QA 3AVSA 3JBG2 5CFCA 2HYKA 2WSUA 2V73A 5F2WA 1Z7S2 2IVIB 4BLIA 4MV2A 4QPGB 2QKDA 2WABA 3RJRA 1OF3A 1EPZA 4BH9A 1ST8A 2CWSA 5C70A 1RUOA 1DYPA 3N7JA 4S2DA 1GR3A 4LR4A 5I8TA 4O7XA 1LESA 1ONAA 1XYOA 1R1A3 2WYFA 4C1WA 2XJSA 2J1AA 1RUD3 4EN0A 2VNRA 4QPYA 2IXHA 4DS0A 2EIBA 5FMOS 5F5CA 1XU2A 5FYVA 4FTSA 4QPWA 2XBO1 4IV1B 3WDVA 4YVSC 2CAUA 1POV1 1A8DA 1UN1A 1UKGA 4OHVA 4MXVA 3POBA 2Q30A 5E89A 3ZXKA 4Y1UA 5GLZA 1LU2A 5T3NA 2Y6JA 4MGSA 2ZEXA 1QXRA 1ULOA 1RUJ2 1LOAA 1GKBA 4E8DA 5CB7A 2YY1A 3RJ2X 4CU9A 1A3KA 1KS5A 1O6UA 3T4VA 5F3GA 3QD6A 5CIRA 4EV0A 3ZFFA 4M3CF 4JCKA 1XNTA 2UYAA 3M3OA 4GMP0 4LUKA 1GANA 2W94A 3RYPA 1N3QA 2FMDA 4RR3B 3FFQA 2HLEA 1YYNA 1HX6A 4OYUA 1E5HA 3NKGA 1SFNA
chains in the Genus database with same CATH topology
3BU7A 4KG0A 2TEPA 1VBC2 1TQ5A 1RMU2 1RUC2 4JRLA 1UD1A 4BA6A 4WM7C 2ZX4A 1IZ3A 4Y20A 2XVGA 2LTNA 3L2YA 2D98A 4MLOA 5KHGA 4FPLA 1H2KA 2PHRA 2V09A 1AL22 1GSLA 4XTPA 4Y1VA 1DQ2A 4B8EA 1QDOA 1LOFA 4OHWA 3LCPA 4Q4V3 3W9AA 1MZ6A 3WQ7A 2HWF2 2BNNA 5BNNB 1ZRDA 4X8PA 5K0UA 1AX2A 5CA6A 1O3RA 3FBYA 4QMAA 4K7JA 5GZEA 2XJQA 3FFZA 4KG8A 1MEC1 1AX1A 5T52A 1O7FA 1FI2A 1DLLA 3SISA 4MYEA 3POWA 1FPN3 4K6BA 1RHI1 3H1WA 2DV9A 1ZBE1 2TUNA 3V0AA 1BVVA 1WW5A 4JGYC 2WLQA 4KNCA 1ZZCA 1HRI2 3D0SA 3ME2A 1AYN1 3OYWA 2JXAA 2ZX3A 3DN7A 1RUF3 1LGCA 5H9PA 3VBHA 3NAPA 4IV1A 5GLTA 1A6CA 3MF9A 4E4DX 5KWRA 2GNMA 2ZACA 3VBOC 3GALA 2C5DA 4YM0A 1W6PA 2GN3A 4HSLA 5JPMB 2GSYA 1UCXA 3CJIC 4YZ1A 3WVJA 2R062 4R4XA 4Z82A 1LU1A 2ET7A 3GZTB 1GQGA 3FZ3A 3SCHA 4FP3A 2P2KA 4FPFA 4L9BA 3TB0A 2A6ZA 3NW4A 2MEV1 1LGNA 4M3CA 4ATFA 1FMD2 1ASJ3 1KXGA 5BPXA 1ZBA2 1QH6A 5JR7B 1I3HA 2E53A 3WZ1A 1BMV1 4GKXA 4UW6A 4EN7B 1E57A 5SV8A 4BM8A 3R4DB 4KGGA 5F6KA 1N1SA 4DZGA 3ES1A 4AFBA 1MS5A 3JCIA 3OBRA 2EAKA 3JD72 3INAA 2VULA 4IQPA 3ECQA 1RUG1 3H3ZA 3ES4A 1H1AA 4H7LA 3AKRA 3NKTA 5BUVA 5HBAA 1H9PA 2EALA 3KCXA 1GFF2 3WCRA 4E4ZA 3AZXA 1OQ1A 1BBT2 5JDBA 2JG8A 1VBA3 4EN6B 4JDNA 4OZXA 4OFGA 4DY5A 1B35B 2R043 4J6GA 4RHV2 5DG1A 1FPN2 1RUH1 5T5LA 1HRV1 2PHTA 5JZGA 1OD5A 2VW1A 1LHNA 2R6QA 4OUMA 1L3JA 5LK5A 3ZN6A 2WIIB 1FV3A 1DZTA 1VBB3 1QJU2 1BEV1 1QNWA 4H7MA 4CRQA 3FMGA 3USUB 2PA7A 2XB6C 3MEPA 2WNVC 4UBGA 2Z2SB 3ZFGA 5FDBA 1Q8SA 4B3NA 1BXHA 5AC93 2ZTNA 5CFDA 3FUOA 3U4XA 2IWGB 4NHKA 1RVF1 1DIWA 3MI8A 4YG3A 1W6OA 1HXS3 2O8QA 3VBSC 2R041 3D82A 4AF9A 2XLGA 4PLMA 2X8KA 1X50A 1C5IA 1OI6A 1W6PB 3IN9A 5FQ0A 2O1QA 2CGOA 3ZYJB 4YGEA 1SQ4A 2YZ4A 1DZQA 4M0NA 5F9TA 4GB32 4LO8A 4OI0A 4RSUA 1OSGA 1DQ6A 1SFYA 2FBEA 3KT1A 4P14A 2EXIA 5FBZA 5I0RA 4XJ9A 4L99A 4HKLA 4W6YA 5BXXA 2IXIA 4R9CA 3WP6A 3AFGA 1QJY2 3MW4A 4QU2A 1WUVA 5KHIA 1C8M3 2CTVA 3E5XA 5DUWA 2D6NA 2D93A 4L2NA 2FZ1A 4RQPB 5BNPA 3P3PA 3EQEA 1H2LA 2AYHA 3IIAA 3AZWA 1ZZ8A 2VVFA 4MX3A 3IPVB 3V0BB 1IHMA 2C0ZA 2RS51 1VBA2 3HD8B 4XMIA 3ZXFA 2ZZJA 3KT7A 4G3YC 1LOGA 4IV3A 4QPIB 1H8TA 4XQ4A 4AVTA 1IS5A 3J8F1 3MFCA 4OULA 4FPHA 4XXPA 1QOSA 4LBQA 4Y20B 2QDNA 4QPIA 4YZ5A 1PGL1 3JUUA 3A0NA 4FO9A 2XJVA 3GHNA 4BQ1A 2WL1A 2Y38A 1NCRC 3GF6A 3WG3A 1ND2B 2DU0A 4GWMA 1BVP1 4YW4A 2JECA 3UKVA 1AYM1 2WS92 5CFDB 1ZZBA 1OQEA 1SLBA 1RUE3 1W6NB 1UIKA 3RRDA 2N7GA 2AH2A 1Q56A 4EROA 1LR5A 3SCGA 1VALA 5E8AA 2DCYA 1BKZA 1SCRA 1J3QA 1G7YA 4YGCA 3WW3A 1YRZA 4YVWB 1V70A 2KA3A 4N43A 4GB33 3M3EA 1AR92 1VB4A 3TYJA 1EV12 4XFBA 1TE1B 4YVWA 2XLFA 5ACA2 2D3RA 4AI0A 3E6DA 4JGYA 1N47A 4AQTA 2UY9A 4FPYA 5JSRA 4C0HA 3NAPB 4Q27A 3B93A 1H2MA 2Q0AA 3BCWA 1FYUA 2C1FA 4IV1C 2GAUA 5J7MA 2YROA 1D4M3 4FSJA 1PVC3 4Z2WA 5GZFA 5CAZA 1UZYA 1C1FA 4QD2A 1S0BA 3D6EA 3ACLA 5GZDA 4IEWA 1LOBA 2RM23 1ULCA 4AFMA 3KCYA 1CAUA 4XF9A 3ZSMA 1HQNA 3VKNA 2IXKA 5C6CA 2XH6A 1H30A 2MPFA 3EBRA 1UU5A 5CBLA 3EHKA 2AGSA 4AHXA 1Q8OA 2R1DA 1VIWB 1J3RA 2ZGMA 5I93A 2PQQA 2CGPA 1FATA 2ILMA 4JDMA 1JH5A 4WM8A 4CEYA 3MPBA 2DUOA 3LA7A 1UPSA 1QGLA 3ZIXA 5J48A 3H8UA 1DU3D 1D0GA 3KS7A 1G9DA 4YM3A 5TSWA 4IEYA 4P9IA 3OGJA 3U0ZA 1YXWA 3QOPA 5AFEA 1COV2 1YFUA 4WZCA 2JE9A 1KDMA 2RR11 4BIFA 4UBHA 3LGRA 3AP9A 1NY72 1DBNA 1NLSA 3PMSA 1QJX1 4LNVA 5L7OC 1DGRA 2QCSB 3TBDA 4YGBA 3ASIA 3TN92 3HMYA 2RS32 4FP2A 5JI7A 4LLFA 2YPJA 2D97A 4YW5A 5IK8A 1R1A1 1QY4A 4COWA 1CD3G 1W6QB 3VBUC 4HETA 5LEJA 4K21A 3UJOA 4HSJA 1QH7A 2ZGUA 1AYM2 1V9U3 1REDA 2HWB3 5A33A 4YZ2A 3RS6A 4CDXC 2ZGNA 1VBD2 5AVPA 1ND3A 3VL9A 3GBFA 1SLTA 3GBGA 4GH4A 5CADA 1R082 5JOZA 3PJYA 3GZUC 1XXNA 4FTBA 1VBB1 1D4M1 3G7DA 3I59A 2R49A 2R1BA 3APBA 3M3CA 4WZFA 1AXYA 2GC3A 2YV8A 2ES3A 1HDKA 4ZU4A 4Q4X3 3S0MA 1EAH1 4PIYA 3T1LA 4W6XA 1GZ9A 2HEVF 4Z92B 4PQ9A 3SMHA 2R072 5CG8A 3RWNA 5FLHA 4OHYA 3PVOA 5JI9A 3GZAA 5FLIA 4XILA 2NQYA 2QZ3A 4YNIA 4OI1A 1VBA1 5JPNB 2RS52 2YUEA 1WMDA 1QDCA 3E5QA 4H3WA 1NLRA 2B8MA 4PBOA 1TEIA 2PAKA 2ARXA 4XFAA 1S0DA 4RGAA 2ZGPA 2E9QA 2X5IC 1W39A 2QVSB 3O0VA 1CR7A 1DGWX 2R30A 1AR62 1RUE1 1CAXA 4ZKTB 5BYNA 1ENXA 1MZEA 3NO8A 3ZXJA 4D3WA 3LWCA 2BWAA 5GKAC 5BNNC 3NV2A 2V5YA 2GC2A 1LOFC 4N7IA 3MIHA 1TMF3 2D6OX 3B02A 2RS31 5I8YA 3MICA 1DQ1A 3WOGA 3ZSEA 1ASJ1 2VOXA 2Q8OA 3FWEA 4XBLA 1H8TC 1AZDA 2DTYA 1Z7S3 4YGDA 3WQ1A 4XF3A 3ZIWA 3I7DA 1LENA 4CEYC 3NV4A 1O91A 4IERA 1EAH3 4IV3C 5JWPA 2Y0IA 3POSA 1EYBA 1H1IA 2OW4A 1J59A 4RGGA 1AXZA 4RR3A 4AG4A 3U10A 2WNVA 2X53S 1ZZ7A 4JQRA 4XTMA 3SH4A 2VUAA 3VL8A 3ELNA 4WM8C 4COYA 4CDXB 2RMU1 5DUUA 2XHKA 1FNYA 3QH6A 4EN8B 1QU0A 1V9U1 4AHZA 1WBFA 1DHKB 3D0JA 4PBPA 4DPNA 4LUMA 3ZYRA 4META 3WT3A 4AEDB 3PMEA 2HEWF 1CGPA 5CFCC 1MS4A 2ZCWA 1C5HA 1ZBE3 1KITA 3CNAA 4AEDA 3PVNA 2JE7A 2ZBJA 1QF3A 3B00A 1KS4A 3U07A 1QJX3 4CP2A 4EWDA 3LAGA 4B4RA 1ZVFA 5IK5A 4LBNA 4RR3C 4I30A 2CL2A 4QM8A 2JD4A 2R0FA 4XJUA 1R092 4TWTA 4F83A 1RUG2 3ZX7A 2BNOA 5AVAA 4JGZA 3ZXEA 2WWSA 1LOCA 1MVEA 5E1RA 2XBO3 5DDJ2 1K5MB 1YNAA 3VDDB 1J1LA 5L7OB 2GNDA 4ONUA 1Y7BA 4GMP3 1X7NA 1YUDA 3VLBB 1H8VA 4QPGA 2WFF3 1O3QA 3WW4A 2DURA 1C4RA 2ZMNA 2GDFA 4CEYB 3DF0A 1NZCA 4NWWA 2R061 1Y9QA 4KH9A 5JZGC 2XL9A 2ZX0A 3E6BA 3LB9A 4Q8KA 4BCUA 1NCRA 5KC6A 2JG9C 1U0AA 4XIKA 2ZS6B 2WKKA 2Z69A 2F4PA 2WNVB 5DXDA 2E63A 4V1PA 3LA3A 4JVAA 4Y1XA 1FOD1 3LSEA 1RUF2 4PIZA 2PHWA 3I54A 3VZJA 4JTOA 2WNUC 4YRDA 1QXPA 3TNPB 4LO7A 1EP0A 4AVVA 2VMIA 1POV0 4O9EA 3CEWA 4P9WA 2ERFA 1HRI1 4Q1PA 3IKWA 1D4VB 1LULA 4NHMA 5BNPC 4Q4V2 2B39A 4PCRA 4DOUA 2IC1A 5FRAA 5JOWA 4K9SA 1XU1A 2D6KA 2HWE2 1ZBE2 1RTVA 2ZGRA 5EWSA 4B4QA 3MF6A 2ZMLA 2DCKA 5GJ6A 4B4PA 1AJKA 2JG8B 5JVVA 1UZZA 4QGNA 1RGSA 5T5OA 4ITCA 3GHMA 1I5ZA 2DVBA 1C8NA 4HPKB 1QOOA 2HWF1 4PDWA 2DVDA 3AKQA 4WM7B 1HRI3 1JUHA 5EXOA 4GH4B 2D6PA 3AMPA 4PLOA 5IT6A 1WGPA 4XE9A 2FZ2A 3UK9A 3MIBA 3NSTA 1MS0A 1QKQA 1AUYA 5DUVA 2BNMA 4GXLA 2D5FA 3USUA 4CDWA 1X82A 2W08A 1PK6A 5DDJ3 4XDQA 1RUC1 5HCFA 1PO12 5DZFA 2FQPA 4CP0A 1RUF1 3VKFC 2H0VA 2ZGLA 2DF7A 1QHDA 1TNFA 5C8CC 3AMMA 4RD7A 4CDUC 5L7OA 1S0GA 2ZGQA 3FX3A 2WFF2 1W6MA 1G6NA 2XJPA 5EZWA 2PLV1 4C1XA 5ABJB 1PO11 1RL3A 1S0FA 2R042 3ZYPA 2GU9A 1GLHA 2O8OA 4HMZA 3VV1A 3FBMA 1ASJ2 4IEZA 2RE9A 2VOWA 5FOBB 1IOAA 1FT9A 4PIXA 2CNAA 3ILFA 1NCRB 3WLUA 3RPQA 1QJU1 3HT2A 1VAKA 1YJLA 4LHKA 2D44A 4AGVA 1S0IA 4AFAA 2PHDA 2NZ9A 4I3GA 4YW3A 1JXNA 2P3IA 4AEDC 2XJUA 1B09A 1GQHA 4MSVA 4LHNA 2QUOA 4KGQA 4XW3A 5DZGA 3UKTA 4RQPA 2MHFA 5BNPB 5FO7B 2HJIA 5EYXA 4U2AA 1KDKA 4S2HA 1SLAA 1NCQA 1BBT1 3AM2A 4Q1RA 3MIDA 3VBFB 2BVBA 1UF2C 3RMXA 4LT5A 1R091 1U5IA 2VPVA 1WLWA 1PHMA 3AXDA 3QACA 1DFQA 1KFUL 5KXDA 1VRH2 4I09A 3JBG1 2PTMA 1A78A 1G9AA 3AP4A 2XWJB 1FOD2 3E97A 4RS5B 3OBTA 4F7ZA 3BODA 1VBB2 3WUCA 1MACA 5JMCA 3ZN5A 4KWJA 2WZR1 1VB2A 4MZUA 4FPCA 1O5LA 1YFXA 4CDQB 3CJIA 5AC92 4HL0A 5FO8B 4AVBA 5K0UB 4IEVA 4Q0SA 1HXS2 4AEMA 1PO13 1OOPB 1Q5OA 2DYCA 3MW3A 3BIWE 2RS12 5I0UA 4FVVA 4KU7A 3ZSLA 2OZJA 1HRV3 1BYHA 3T2TA 3ZXLA 3UJQA 5KXCA 1V00A 1OFSA 2QFEA 1VAMA 2OZ6A 2VMGA 1NYWA 2DU1A 5FCCA 4AYUA 2WFF1 1Q8VA 3CU7A 4H55A 4QPIC 4F3JA 2XPJA 1KRIA 1Q8QA 1H4HA 1YJKA 4K20A 2WNUA 2JX9A 5LRRA 1J3PA 1RUI1 1MVQA 1UPIA 3RSJA 1FNZA 3IDCB 5C9AB 2WNUB 3AB0A 1C3HA 3AZZA 2IXJA 4Q26A 4D7YA 1RIRA 1GZWA 4QT6A 1YIFA 4LTAA 1WW7A 2WA4A 4YG6A 2WS93 3Q9OA 1TME1 4XFFA 3WCSA 1GNZA 5SV5A 4Y22B 3VBRA 1CQ9A 1WLTA 1MQTA 3SH5A 3WP4A 3OJBA 1WCSA 3N7MA 4QPGC 3VBRB 1MQTB 4HLTA 2YYOA 3ZFFB 4O9GA 2LUWA 2W0XA 5JIUA 4IV3B 4TLFA 2Q1MA 5HI0A 4NVPA 2HWE1 3D8CA 3A0KA 2R071 2RMU2 2JJ6A 4HANA 4M00A 3VZKA 1OLRA 2ZHNA 3HT1A 4ORFA 4P9JA 4M0HA 3SXWA 1JHNA 4XJAA 1RMU1 1ULDA 1WCKA 3DGTA 4E2GA 3AP6A 4RQPC 3ILRA 4UW5A 3VHPA 4HVQA 1D4M2 1AYN3 2HWB1 3KSCA 3VBOA 1V6NA 1NE4A 3H9AA 4XBNA 5BNOA 1NCQC 1ULGA 4PJYA 1R081 2VG9A 2VXRA 5I0SA 3MIEA 2BBVA 4AQ6A 3H1YA 1LECA 1B35A 1LEDA 3VBHC 3ETQA 1OOPA 1GYKA 4WV8A 2E6VA 2SBAA 4LBJA 1DDLA 1ZYBA 1RUJ1 1XE8A 1PGW1 1Y43B 1EV13 1YO8A 2YGLA 2XG3A 1JTZX 1PGW2 4LBQD 4KU8A 1XQNA 2XGXA 3W59A 1AR61 5I91A 3KLSA 2GC1A 2ZA9A 1QNYA 4B7EA 2H6BA 1ND2A 2I07B 2WA3A 3WG2A 3ZFEB 4XHBA 3WY6A 2YDEA 3B9IA 3D4KA 4LULA 4YW1A 3VHRA 1CAWB 1PZ8A 2PAMA 2RM22 2ZKNA 4XF4A 3B94A 3KQRA 4CDWC 3VDDC 1RUI3 2VVEA 1CONA 5C8CA 5GZGA 2WFPA 1QWRA 2ZKLA 4CEWC 3B01A 5AFBA 3J8F2 4TYSA 2WT0A 3VN4A 3DPRA 4AFCA 1EPWA 3MIFA 2KXLA 4BHPA 5CU1A 4EJRA 4P9XA 1BZWA 3M3QA 1N1VA 1T6GC 1NQJA 2XUMA 4YARA 4Y24A 5J09A 2PHUA 1U5YA 3KZ4C 1PNGA 2GMPA 4JGYB 3AMHA 4IEQA 4LE4A 1IS3A 4WM8B 5J96B 2CYFA 3BALA 4DB5A 5KHJA 1J1TA 2A3XA 1NA1C 3UL2A 1AL23 1MZFA 1TME2 4TSVA 4ES8A 1AF9A 1G9FA 2XJTA 1QJY1 4BMBA 1JN2P 3HAGA 1CAUB 4NO4A 3ZN4A 4YG0A 1YFYA 1NCQB 2UYBA 1PIV2 1WD3A 4AHWA 2NMNA 4KWLA 4AI3A 1WLDA 2UU8A 1OPOA 4GB31 4Y4YA 3JBG3 2ZGOA 3WDUA 4N90A 1O4ZA 5LRSA 1V6JA 2RR12 1WLCA 3OCPA 4P5HA 1QOTA 4CZSA 1RINA 2B9UA 1COV1 3O14A 2BQPA 2YXSA 4HKOA 3WINE 4OHXA 1G9CA 4I01A 5GLUA 4GH4C 1AYM3 1VBE3 5F1RA 5D8AB 1BK1A 2EAAA 4AQSA 4Q0VA 4BWOA 5T54A 3WD5A 4Q0QA 1K5MC 3LA2A 5D8AA 1WW4A 3JU9A 2BGCA 3IDBB 3I2DA 4LLOA 4AW7A 2Q5TA 3E6CC 3AZYA 5AC91 3N7LA 1W0OA 5DZEA 3WX5A 5A32B 4L8QA 4EN9B 3S7EA 4FXGB 3IWZA 3ZMNA 3J8F3 4CEWB 1R1ZA 4LHLA 1AL0G 4R9DA 2A5ZA 1WW6A 5C4WC 4MUVA 2DVAA 4XQWA 3DPRB 1PGL2 1NOVA 2ET1A 1FMD3 3O0WA 4A7KA 1ZZ9A 3WHTA 2CV6A 2JG9B 4OLLA 2W68A 1KFXL 1PO23 1VRH1 2I45A 4BLJA 3EJKA 4R52A 1LCLA 2A70A 1OA4A 3O7OA 1RUC3 3ATGA 4LBOA 4AGRA 2RM21 5IUQA 3JZVA 4FQ4A 1CVNA 1U5XA 2P3KA 4JV4A 1CPNA 3JB8A 2BTVC 5BY5A 3MDPA 1VBD1 2ZGSA 2FMYA 2VW0A 4JGZB 2B45X 2D43A 1ND2C 1SBEA 3POYA 1CIWA 1AR91 4OI4A 2A3WA 1S0CA 2R0HA 3DUIA 4QQOA 2W39A 2HWF3 2PHLA 3J9SA 5T5PA 1ZREA 3HQXA 1ZBA1 2EVXA 3J4UH 2IFRA 2JG8C 2A75A 4F8AA 2WT2A 4FOYA 4G4FA 2WINB 4OI2A 2BFUS 3WNXA 2RR13 3FLRA 2GMMA 1XNDA 3LOIA 4JC1A 2SLIA 3TN91 1RITA 2BYVE 3WG1A 1QJX2 4XQDA 5EFUA 1V6LA 4QHBA 1BQPA 2DFBA 1Q8PA 3OY8A 4AGGA 1FX5A 3KT4A 4PLNA 2PLV2 3VKOA 4N53A 2A6VA 4BIOA 3LOBA 1CAVB 1D0HA 4YM1A 4ZXKA 1JOJA 3UV9A 1PNFA 4UW4A 1PM7A 3OY8B 2QE3A 1HKDA 2NLRA 2RHPA 4W6WA 4CDXA 3W58A 4CDQC 2D40A 1M4WA 3C3VA 2ARBA 1J58A 5K0UC 3RI9A 1NA1A 3WHUA 3THTA 4MXWB 4K8FA 3WP5A 3H3UA 1BJQA 4Q4Y3 3M4FA 5FAXA 2R063 1SBFA 4CP1A 4Z1VA 2EXHA 5GZCA 5H9SA 4J1WA 3TAYA 1PGSA 1W6QA 1U12A 2O0OA 1KJLA 2AREA 2YC0A 2ZX2A 3WDYA 1OPMA 4A7ZA 3H0OA 1F2NA 4I2OA 1C28A 1FPN1 1RUH2 2A6XA 2E51A 2LM3A 4QQLA 4AE2A 1DQ0A 2K9ZA 3AKTA 4IETA 3M3IA 3LKJA 4GIQA 1WMEA 4WVWA 1YCIA 5FTTC 1HIXA 4YVSB 3WXPA 1RJ8A 2JKBA 2GALA 4Q4V1 3VKLA 3AKSA 5DUXA 2X5IA 4BMEA 3AYAA 4AWDA 3M1HA 1IQAA 1Z0HA 3LSDA 4K3UA 4QGLA 3AZVA 2ZPXA 5KHKA 3G6JB </