1HRV1

Hrv14/sdz 35-682 complex
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
273
structure length
273
Chain Sequence
TVASISSGPKHTQKVPILTANETGATMPVLPSDSIETRTTYMHFNGSETDVECFLGRAACVHVTEIQNKDATGIDNHREAKLFNDWKINLSSLVQLRKKLELFTYVRFDSEYTILATASQPDSANYSSNLVVQAMYVPPGAPNPKEWDDYTWQSASNPSVFFKVGDTSRFSVPYVGLASAYNCFYDGYSHDDAETQYGITVLNHMGSMAFRIVNEHDEHKTLVKIRVYHRAKHVEAWIPRAPRALPYTSIGRTNYPKNTEPVIKKRKGDIKSY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title SDZ 35-682, a new picornavirus capsid-binding agent with potent antiviral activity.
pubmed doi rcsb
source organism Human rhinovirus 14
molecule tags Virus
molecule keywords HUMAN RHINOVIRUS 14 COAT PROTEIN (SUBUNIT VP1)
total genus 42
structure length 273
sequence length 273
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1995-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1hrv100
3VBOC 1NCRB 2RMU2 1VBE3 1RUG2 1RMU2 1R083 1RUJ1 2TBVA 1RUE2 1HRI2 1VRH2 5BNPC 5CFCB 1Z7S3 1RUH3 1AL22 2RS33 1H8TA 3ZXAC 1SMVA 4GMP1 4AEDA 2HWF3 1QJX1 1K5MC 5L7OC 5ACA3 1NOVA 2R061 1AUYA 4PDWA 4Q4Y1 5A32A 1HRV3 4CDUA 4RHV3 2WFF1 2FZ1A 2WS93 4PDWB 3TN92 1RUH1 2XPJA 4LLFA 1POV0 1VBB2 1AR91 1TMF2 1MEC2 5ABJA 1FPN2 1TME2 4FTBA 1BMV1 1CJDA 3VBOB 1BBT1 5ABJC 2WZR1 4BCUA 2PLV2 1AR72 2HWB3 1AR81 1AR61 4FTSA 5D8AA 2R073 1FOD2 2WS91 4Q4V1 4Y4YA 1PVC1 3VBHA 1QJY3 1FMD3 3NAPA 3CJIA 1PO23 3JBG2 3VBHC 4GMP0 4RQPB 1PO13 1QQP2 5AC92 4Q4X1 1ASJ2 1AYM1 2XBO3 2IZWA 2R042 1ZBE2 2RR12 3VBUA 4NWWA 1DDLA 3VDDB 1B35C 1OOPA 1RHI2 4Q4W3 4RHV2 1HXS2 2XBO2 4QPGC 1RUI1 2BFUS 3VBUC 1EV11 2R072 4N43B 3VBUB 5K0UA 3VDDA 1R1A3 1QJY2 3DPRC 2HWD3 1F2NA 1PO11 1RVF3 3DPRB 1D4M3 2HWC1 1VBE1 4YVSB 5JZGB 1VBA3 2HWB2 5C4WA 1TMF3 1VRH3 5J98B 4Q4W1 1RUG3 5L7OA 5D8AB 1RUD2 2HWF1 1VBC1 1PGW2 1BEV1 1HRV2 4IV3C 5C8CB 1B35B 1C8M1 1H8TC 3JD73 2R063 5CFDB 1NG0A 1C8M2 1HRV1 1AYN2 1PGW1 3ZFFC 1VBC2 4CEWB 1ZBA2 4Q4W2 1R1A2 1IHMA 2RR13 3JD72 1HX6A 4CDWA 2WZR3 1VBE2 5L7OB 1C8M3 1PIV3 5K0UB 1AL0G 1ZBE3 3JB8A 3ZFGA 4JGYC 1RMU3 4YVSA 1FOD3 2RS11 2R071 1EV12 3J8F3 2HWE1 1H8TB 4WM8A 1PVC3 4CDXB 1RUI2 5JZGA 1EAH1 3JBG3 4RHV1 4GH4B 1FMD1 1D4M2 4YVWA 4FTEA 2WFF3 3ZFFA 1ND3A 1NCRC 2RR11 4N53B 5FMOL 1AR93 1AYM2 1COV3 1NCRA 5BNNC 2DF7A 5AC91 2X5IB 1QJU3 2MEV2 5C9AB 1R093 3ZFFB 2WLPA 1HXS3 4YVWB 5J96B 1RUI3 1NA1C 1PVC2 4NWVA 2BPA2 4Q4V2 2WS92 1FOD1 2MEV1 5BNOC 5A33B 3ZFGC 1NA1A 1AR62 1EAH3 1VBB3 4RR3A 3ZFGB 3NAPB 1HQNA 4Q4V3 3VBHB 3VBOA 2PLV1 1D4M1 1FMD2 2HWC3 3CJIB 2WZR2 1EAH2 1ZBA3 4SBVA 1ND3B 5LK7B 2HWE2 1TME1 1BMV2 1FPN1 4JGZA 3VBSC 1ND3C 2RS12 1MEC1 1TMF1 1AYM3 1AR92 4CEYC 5DDJ3 4WM8C 1RUE3 5BNNB 2ZAHA 5ABJB 4Y5Z0 3JD71 4QPIC 4CDWB 2R062 1R1A1 2PLV3 4CDWC 1ZBA1 5CFDA 1MQTB 1TME3 1FPN3 1AYN1 3VBRA 1X36A 4CEWA 1AL21 4JGZB 3VBFC 5D8AC 1VRH1 1HRI1 1RUE1 1VB2A 1RUJ2 3VBRC 1RUG1 1BEV2 3CJIC 1F8VA 4RS5B 2RMU1 3DPRA 1RB8G 2HWF2 2VQ0A 1RUD1 5CFDC 5CFCA 4RR3B 3S6PA 2HWB1 5BNPB 1WCDJ 2ZZQA 2ZTNA 1AR83 1ASJ3 2HWC2 1RUJ3 1PO12 1AL23 1QQP3 2RS32 1NA1B 1Z7S1 1HRI3 1QJY1 1CD3G 3IDEA 1QJU2 2RMU3 4Q4X3 4RQPC 3NAPC 1PGL1 1R091 1OHFA 1QJX3 2XBO1 1HXS1 4RFT0 1RHI1 5FOJB 2RS53 1AR73 1RUC3 4JGZC 3VBFB 1ZBE1 2R041 3VBSA 4EJRA 1VAKA 4CDXC 1ASJ1 5C8CC 3VBRB 4Q4X2 5BNPA 1EV13 2HWE3 1QQP1 4RS5C 4CDXA 1VBD3 3JBG1 4IV3A 2Y26A 5DDJ2 3TN93 4RR3C 4CDQB 5CFCC 2HWD1 4RS5A 4N43C 4GB32 1MEC3 3JB4C 1COV1 1AR82 5AC93 1AR71 1POV3 1X33A 4IV1A 1V9U3 2R043 5BNNA 5JZGC 1VBD2 1BBT2 1BEV3 1NCQB 4IV1B 4JGYA 1VBB1 5GKAC 1PO21 1RUH2 3TN91 2WFF2 4QPIA 4IV3B 1OOPC 4CDQA 3FBMA 1W39A 1B35A 4Q4Y2 1POV1 4CDUB 1ND2C 4GMP3 4CDUC 1QJX2 4CEYA 3J8F2 2X5IA 5C9AA 2GH8A 5FMOS 1PIV1 2BFUL 2GSYA 4N43A 1MQTC 5K0UC 1M06G 1PIV2 4AEDC 3ZFEB 1VB4A 1RMU1 4GH4A 2RS13 3J8F1 1AYN3 1R081 3ZFEA 5ACA2 2BBVA 1OOPB 1A6CA 1VBC3 1BBT3 2WWSA 4N53C 4QPGB 4CEYB 2RS51 4WM8B 1RUD3 1RUC1 1PO22 4CEWC 4Z92B 1QJZA 4Q4Y3 1ND2A 4QPIB 1VBA2 1VBD1 2RM22 4YVSC 1RVF2 5BNOB 4WM7A 1NCQA 1RUF2 1COV2 4JGYB 1NCQC 3ZFEC 1MQTA 1C8NA 2BUKA 4GB31 2HWD2 5BNOA 5C8CA 1NY71 1V9U1 5A32B 5DDJ1 1RHI3 1E57A 4GH4C 1V9U2 1NY72 3VBFA 3VBSB 1AR63 1ND2B 1RUF1 2X5IC 4CDQC 5C9AC 3HAGA 2QQPA 1RVF1 5A33A 4YVWC 2RM21 4WM7B 1R092 1PGL2 1VBA1 3M8LA 4GB33 4FSJA 4WM7C 1QJU1 4QPGA 4AEDB 1RUC2 5C4WB 1K5MB 1Z7S2 2RS31 2MEV3 2RS52 5C4WC 4IV1C 1OPOA 4PDWC 1RUF3 3LOBA 4RQPA 5ACA1 2FZ2A 1R082 1K5MA 4N53A 2RM23 1GFF2 3VDDC
chains in the Genus database with same CATH superfamily
1MS4A 2WT0A 2AYHA 5BYNA 1MVEA 1J84A 5FO7B 1VBE3 2G19A 4URAA 4QGLA 1SPPB 2BNNA 4MGQA 4I02A 5F5IA 1X7NA 3B69A 4Y1VA 3VKNA 1CZTA 1RUE2 1VRH2 3NJYA 2HBTA 3U4XA 1RUH3 1F31A 4AVBA 5F1RA 2CYFA 4CCJA 3MPBA 5D2AA 1R1ZA 1T6BX 4GMP1 2XJSA 2ZHKA 1ZZ8A 3WSOA 2C26A 2J1EA 4Q1RA 4AGVA 3VUOA 4FI9A 1QJX1 4ORFA 5L7OC 3L2HA 3U78A 2WLQA 5FO8B 2VCBA 2WA3A 2ZX4A 5I0RA 1YFYA 2R061 4E2GA 3OUHA 4WVMA 5A32A 2RDRA 4EWAA 3RRDA 4ZKTB 4RHV3 1UXXX 4QX7A 5FQ0A 4BQ5A 4GKYA 3OYWA 2FZ1A 2VVDA 2GMMA 2ZKNA 1RUH1 2J42A 2WAAA 3PTRB 3TN92 3VZLA 3VZMA 3BB6A 3HQUA 3WDTA 2J1AA 2XJPA 5FAXA 1AR91 1TMF2 1MEC2 4LKSA 3B9CA 4BK4A 3LPFA 1RC6A 4MXWA 4XFAA 4NIHA 2I07B 4HZFA 2RDNA 3E5XA 3PVOA 2VE1A 1JZ5A 4KGGA 3SH4A 3KT1A 1AR72 3SH5A 2F6BA 4K3UA 4PIZA 2RDQA 4AI9A 3K75B 4XURA 1JODA 1LHWA 3ZPOA 4FTSA 4N8MA 5FP4A 5GM0A 3I54A 5GZFA 3IN9A 4MH0E 3WP6A 2BW8A 4QU2A 3AB0A 4FP2A 4XBQA 1YWKA 4XQWA 3VBHA 5KBFA 3CKHA 1QJY3 2UYBA 3NAPA 4FO9A 2ERFA 3INAA 1LB2A 4GMP0 2EIBA 2XHNA 4RQPB 2AGSA 4OI2A 2XWBB 3QH6A 4YG0A 4XUNA 1UY2A 3CMGA 3LA7A 2QUOA 3RG0A 2QQJA 4ZZ5A 4LNVA 4JRAA 5LA9A 4EQVA 5CEHA 5A3UA 3GDBA 1JZ7A 2BBAA 4RHV2 1OA4A 1OT5A 5F2SA 4FAHA 1O5UA 5B2GB 4ZU5A 2XG3A 2YU2A 1VP6A 2JDZA 2X53S 2VMEA 3D82A 4QKDA 3CNAA 1R1A3 3UV9A 2VAUA 2W87A 3H8UA 1RUOA 3IWZA 3N9MA 4O9EA 2VR4A 1VMHA 1YNAA 4LT5A 1XYPA 4JQRA 2ZEWA 4K7JA 1D4M3 3I3DA 3M1HA 4LULA 4MGSA 2WQZC 1VPHA 2VOTA 1GZ9A 1NXMA 2BNOA 2E53A 1LNSA 1VBA3 4LA2A 4AQTA 1TMF3 2Y64A 2VULA 4G3YC 4YFWA 4LPLA 1JYWA 1LOCA 3AP5A 4L8QA 3VHRA 4ASMB 3HMYA 1PZ7A 1JOPA 3H7JA 4XXPA 5D8AB 1OH4A 3T2PA 5A1FA 1AX1A 5DUWA 5CAZA 1VBC1 4AOCA 5E1RA 3RS6A 1HRV2 2RHPA 5C8CB 1C8M1 1H8TC 2D5HA 4XE9A 1J59A 3ES4A 4LBQB 3BOPA 3ZPYA 4E4SA 4LA3A 1SBEA 1F5JA 2P3JA 4JAAA 4BYYA 5LCWL 1UYZA 3VD7A 3ZFFC 2OZJA 3DF0A 1V6LA 4QWNA 4JTNA 4AAXA 1A78A 2ZMNA 3BGAA 1O59A 4O61A 3WZ1A 1W2OA 4LBQA 3BYWA 5FBJA 3VD9A 1VAMA 1SDWA 2WYFA 3JD72 3M70A 1H2LA 5HV4A 1G9AA 2VZQA 4H55A 3A22A 3ZDVA 1C8M3 4A6SA 1H9WA 1C3HA 3ZSEA 4QKNA 1W06A 5K0UB 1HV0A 3AXDA 5FWEA 1DBNA 2ZEZA 3KB5A 1RMU3 5F5CA 4I0BA 4K1ZA 3C7EA 2RS11 4KG8A 4XBNA 2LRPA 5IK7A 1PVC3 3LIGA 3JBG3 2K9ZA 2Y38A 1D4M2 4N9IA 1SCRA 3APBA 4URTA 1ULDA 1XNDA 3ZLIA 3PMEA 4UBHA 1CAXB 2WC2A 4AEKA 3ZFFA 1ND3A 1D7PM 1K3IA 4ASKA 3VZNA 3EYPA 5FMOL 1Y43B 3RDIA 3KQ4B 3B93A 1MVQA 3CJXA 4OHWA 4QPWA 5GZGA 5FIXA 5BNNC 2GN7A 5C71A 5C9AB 3R4UA 1CAXA 4CCOA 2A70A 1HXS3 2YU1A 3NV4A 4XBLA 2D40A 1S55A 2ZGMA 3RMXA 2YUEA 1RUI3 5IVJA 1CX4A 1LESA 3LFIA 5DZEA 4D6RA 1E5SA 2P17A 2D6LX 3S5QA 5A33B 3ZFGC 1RUNA 1BHGA 1NA1A 3VKFC 1VBB3 3NRUA 2Q8EA 3ZFGB 5DG1A 4OZXA 5GLWA 4F7ZA 2YB7A 4Q4V3 2VZRA 3N9PA 2UYAA 2WO7A 3ZSKA 3CJIB 1YFUA 4CP9B 1EAH2 3N4MA 1JUIA 3C7GA 4QX5A 4N9HA 4Q8KA 1BMV2 2Q8CA 2RS12 4ZXEA 3LEIA 4XFFA 1AYM3 2O0OA 1LKNA 3KVAA 4BIOA 1JYNA 2RV9A 2W92A 1PMIA 3ABZA 4WM8C 1WZXA 4QQOA 1DQ2A 2GNTA 1W2TA 3T1MA 2WBKA 2Z79A 3J9SA 3RZHA 1OQ1A 2QDRA 3H1WA 5FYTA 5DUUA 1ZNPA 4QXHA 3GZUC 3LDBA 3NW4A 3P3PA 4IEPA 5L36A 5JXHA 4L2NA 1UY0A 4ZONA 1JYTA 2ILMA 2W1UA 4YW1A 4XJWA 1Z78A 2VOVA 1Q8SA 2GALA 4KI5M 2XMLA 1MS0A 3N9NA 4UW3A 3WD5A 4CDWC 1MQTB 2JE7A 1VE0A 5BUVA 3BU0A 3LE0A 3RSJA 4ES9A 4AFBA 1MS9A 4JDOA 2JE8A 3TAYA 4CEWA 3AZXA 3EO6A 3IT8A 3ZSMA 2B5HA 2PMWB 4EE2A 4G9SB 3SISA 5FZ3A 1MACA 1PM4A 4XF0A 1RUJ2 3OGRA 3VBRC 4GXLA 3WX5A 1JN2P 3ZIXA 1RB8G 2HWF2 1AXZA 2DU0A 2VQ0A 3FWEA 4DRRA 4AG4A 4C90A 3ITQA 2D93A 3NNGA 1MS8A 2QFEA 2Y34A 2CNAA 2D43A 2RVAA 3KQRA 5CFCA 3BTZA 1UPSA 1ZRCA 1W8ZA 3T0BA 5FP7A 3C7HA 5KHHA 5FZHA 3WP3A 2DCYA 4BQ3A 1WA4A 2ZZQA 1YUDA 3ZYIB 3RJRA 5FPAA 1ASJ3 5JOWA 3SQOA 2PAEA 4KBZA 5EJ3A 1LECA 3DEMA 3OUJA 1FV3A 1IQAA 5F7UA 1H4GA 1OURA 1Q43A 1UU5A 5FREA 2B42B 3I59B 5A6ZA 2ZX3A 1VIWB 4PBPA 4XF3A 1R091 5JCTA 3K4DA 4RFT0 1PVXA 1RHI1 1VRBA 4COVA 2RS53 2JD4A 2B7YA 1KQRA 1AR73 3ZO0B 2AC1A 2R49A 5LATA 2P3IA 3JCIA 3ASIA 3KV6A 4JGZC 1ZBE1 2R041 3I2FA 4IE0A 2OYZA 4CSWA 2WKKA 1DGWX 1ASJ1 4CDXC 4AR2A 3VBRB 3KMHA 1REEA 4GWJA 2HWE3 3N9QA 1XE7A 2J22A 2DUPA 4RS5C 4CDXA 1E5IA 4DY5A 1YI9A 1OLRA 2JB4A 2Q1MA 1S2BA 1TEIA 5G05L 4IV3A 5DDJ2 4R9CA 4NMIA 3RYKA 3IDBB 2HWD1 1EPZA 3AJZA 3IDCB 2VCCA 2F17A 2ZGOA 4RS5A 3WNPA 3ZR5A 2ZMKA 4OQ9A 3JB4C 5GJ6A 3ZMNA 4LKDA 2B8MA 1AR82 3IAQA 4QB1A 3GZTB 2R0FA 4R9DA 1NZIA 5GLVA 1AR71 1CZVA 1POV3 3GZEA 3OBAA 4IV1A 1V9U3 2VZVA 4FPOB 3VD3A 2QQIA 2R043 1O5LA 3D4KA 4NAMA 1DYPA 1VBD2 4TLGA 1IS4A 2DV9A 1SBDA 4IEXA 3QH7A 4HPKB 1QIQA 1S0IA 4R4ZA 3LSDA 4BMBA 3AP6A 3S7EA 1OBNA 3LA2A 1PO21 4NIIA 2VW0A 5LBCA 4E2SA 5C3QA 1LGCA 3G6JB 3PU3A 5C3OA 4LO7A 3SEPA 3TBDA 1BCXA 3AMPA 4GZ9A 4OI0A 1LEMA 4PLOA 2O8OA 1AVBA 4IV3B 2ZMLA 4QPIA 3CZUA 5FUPA 1SLLA 2IXIA 3KLSA 5E89A 3QD6A 4Q0VA 5L9RA 1POV1 1XNCA 2AEYA 2VD7A 4AGRA 1SHWB 3ILFA 1ND2C 1DGLA 1QEXA 1ZX5A 4CDUB 3ZOIA 4BH9A 2VTFA 5F3CA 3F95A 4BJ0A 5C8WA 2X5IA 3K3NA 4CP9A 3H8XA 3K3OA 3VD4A 2ZGLA 1DIWA 1UU6A 2GH8A 4XCAA 4XJZA 4A42A 1XE0A 1PIV1 4IXLA 3V0BB 3WNXA 1WMFA 3IIIA 4FQZA 4XAAA 1XNKA 5T50A 1XQNA 4LBOA 1PIV2 1HIXA 5LBBA 3SKVA 2JICA 1VB4A 2NPIA 1CPMA 4E4HA 2LALA 4NUBA 4IEZA 2KR2A 2Y6GA 5GLUA 4BLJA 3J8F1 5KWRA 3LD8A 4CCMA 3WQ1A 2JG9C 2BVBA 2OUHA 2HEYF 4B3NA 4ZU7A 1QY4A 3JQWA 3T4VA 1R081 4HN1A 5T5PA 3MHZA 2EICA 3QACA 1W2AX 4YW6A 4LBMA 4JKKA 1A3KA 2C5DA 4NHKA 2BBVA 3I2GA 5HXMA 1REDA 1F9KA 2AZ5A 1BBT3 2QTWB 2WWSA 4FPGA 4CPBA 5A3NA 1TNFA 2VL4A 2G4IA 1CGPA 4BISA 5C5TA 4WBBA 1O3SA 4FFIA 3NKTA 1QOOA 4XIOA 1SLCA 1RUC1 3M3CA 3V65A 5C33A 1X9PA 2XJRA 3IB3A 4GQ7A 5LA2A 5KHJA 4AFAA 2OQ6A 3WHTA 4Z92B 1ND2A 3SCFA 1ZZ9A 3H3ZA 4NVPA 2ZGTA 4QX2A 1GKBA 1VBD1 2WNUA 1W3VA 1QDCA 4YVSC 5F6KA 5A1LA 3ST7A 2QQLA 1N47A 2VVFA 4YM0A 1VMJA 1YQ6A 1S2EA 2WWUA 3PUQA 3R05A 4I01A 1NCQA 4IGQA 1RUF2 4WM7A 3VGIA 1RITA 1UX6A 1QDOA 1XNBA 3ACLA 4MHRA 2J1UA 5FYIA 5IAVA 3N35A 4FOYA 4XJUA 1C8NA 4BHPA 2BUKA 2IFRA 4BDVB 3LOIA 4XC9A 3HQRA 2QNKA 3AKTA 4U2AA 1QMJA 1UIJA 1GQPA 4OUSA 5A32B 5SV8A 2YYOA 3OBRA 5DDJ1 4AYUA 3AXEA 2P6HA 5FZDA 4UW4A 5CKMA 4Q0SA 3FFZA 5FDBA 3KGZA 2RJLA 3AL6A 3FMGA 4YGDA 1SEFA 2LROA 3R4DB 1IKQA 3BPZA 3T30A 3ZXKA 1RUF1 3RVHA 4QDSA 2VMFA 4K9SA 3HAGA 4FPEA 1KD7A 4DUVA 2BERA 3GHNA 1RVF1 1BVP1 2VNOA 4W6WA 1IQDC 5HI0A 1M4WA 1LCLA 2VNGA 3ZXFA 4EZHA 2BJSA 2BQPA 4WM7B 1R092 2YC4A 3ILRA 4FSJA 2ET7A 5F9TA 4QPGA 4QMAA 2E6VA 1GSLA 3I2HA 1SBFA 2R0HA 2WFPA 4IE4A 4FXGB 1O7FA 1HW5A 2HBUA 4XJ9A 2WABA 4XQ4A 2MEV3 4DUXA 5C4WC 1ST8A 2IFWA 4BA6A 3WG4A 1JBCA 5DABA 3USSA 2JDMA 1ZM1A 1OPOA 1VALA 3GXUA 5EHDA 5EV7A 5FYBA 4AHZA 1W04A 1NKGA 3NQHA 5L73A 1RUF3 1U12A 1CESA 4CCDA 1MS1A 3M4FA 2PTMA 3WHUA 1R082 2FDFA 4N53A 3HNBM 4Z82A 2RMU2 3Q8AA 4K8FA 5FMDA 2WZPP 5FOBB 4YARA 1G6NA 5FZKA 2VGDA 1UZYA 1RMU2 5CG8A 1RUJ1 3IPVA 4PIYA 5I91A 3N7MA 3UGFA 3K4ZA 4CUCA 4EV0A 5BNPC 1OXCA 1OKQA 5B4NA 1AL22 1XBFA 1H8TA 1KGYA 3HEIA 3O1PA 5EQUA 3OB8A 2CU5A 4EN9B 2DVDA 2RJ2A 4AEDA 2E7AA 2HWF3 4DIQA 5F3GA 2KM2A 5J37A 1YJLA 1EP0A 4JKMA 1K5MC 5LASA 4FFHA 1US2A 1GOGA 3VL8A 5F5AA 5K7PA 1BZWA 3HBZA 4J25A 4Y5TA 2CV6A 4LMFA 2UY8A 2C24A 2UWAA 1LGBA 4AL9A 4CDUA 5FLHA 2VG9A 5A7SA 4C0BA 5K8SA 3DECA 3ZXLA 4DFSA 2JDUA 3ACFA 1OA2A 2R6QA 4HVRA 4LKEA 2FCVA 2WWJA 4PDWB 2VJXA 4Q0UA 2JB8A 2VZOA 2ZKLA 3I3QA 2VZSA 5FP3A 1SQ4A 1VBB2 2SLIA 5ABJA 1UY1A 3EHKA 2XL7A 1TME2 3BIWE 2OIIA 1CJDA 4I3GA 3DYPA 2XOMA 2Y6KA 4FPHA 2V09A 2CHHA 2WZR1 2FCTA 1NAEA 3BN6A 5A6YA 1MZ5A 5ABJC 1HN0A 1DP0A 2PLV2 4QX8A 5FZMA 4NRMA 4GKXA 1DYOA 3FLRA 2W46A 2EAAA 3MIEA 2HWB3 2IVJA 5FZLA 3AKSA 1H2NA 1ODNA 5FYZA 2J1TA 4IGPA 4FXKB 4YM2A 5A7OA 3AMHA 5ANQA 1Q8VA 2D3RA 1YO8A 4OHVA 1U5XA 2K46A 4H7LA 3OTFA 3KCYA 4N7IA 1JHNA 4WZCA 4COUA 3HIFA 3N36A 3U1XA 3AZWA 4YW2A 5LBEA 1FMD3 3CJIA 4P9JA 1UO9A 3JBG2 4CXXA 5C7GA 4R52A 3VBHC 3W5NA 3MV01 2RE9A 5AC92 3M3EA 4Q4X1 3PUSA 4MVTA 2Y8KA 4P9GA 1ULPA 2XBO3 1W6NB 3IAPA 3KGLA 4M01A 2JX9A 3T1LA 4IGOA 3LEMA 1W8HA 4NE9A 4NROA 3VBUA 3ZN4A 2A75A 3AKPA 2Q5TA 1JTZX 3OGVA 2R32A 4EN7B 1O3QA 4DQAA 1GZTA 2Q1FA 4XFBA 4AFDA 1HXS2 1W90A 3V0BA 2BFUS 1C5HA 4LXLA 1OF3A 2A5ZA 4XF4A 1EV11 2R072 4ISRA 4QHZA 3GHMA 1D2QA 4QM9A 3B01A 1GV9A 4PF1A 1W0NA 3TEXA 3I2IA 2YBPA 3FHAA 3WQBA 3M3OA 1F2NA 3R0RA 2BDRA 2HWC1 5DG2A 1VBE1 1OF4A 5A7WB 4YVSB 4D7SA 2K2SA 3D3AA 4MHUA 3HR9A 1PMJX 1UYYA 4DEVA 3KSCA 2HWB2 1U0AA 5C4WA 5LZ6A 2BOJA 2J1SA 1H4HA 2W91A 4GALA 4QPYA 4UFHA 3WG3A 1JU3A 3UJOA 5T5OA 3U4SA 2VU9A 2DFCA 2PHLA 3AFKA 3A4UA 4OULA 5BPXA 4AVTA 3C7OA 5L7OA 2BWCA 4LR4A 4M0NA 1RUD2 4UYBA 2ZHMA 1HB3A 2W2IA 4QHOA 4F3JA 1O8PA 1BEV1 2KA3A 2W1QA 3FUQA 4IV3C 1C4RA 2DCKA 2P34A 4M3CA 3X29B 4HKOA 4J6GA 2R063 4FQ4A 4I0AA 5CFDB 2UWBA 1QH6A 4MADA 4CUGA 1JYIA 4FOVA 4W4ZA 2ZEXA 4LHNA 4X6RB 1AYN2 5JPMB 1GLHA 3KF3A 5FKCA 1VBC2 2PFWA 2VO5A 1F15A 2ZACA 4CEWB 5JMCA 2AUYA 2GC1A 2YBSA 3PMSA 1YQ8A 3WW4A 1LU2A 4KNCA 3ZSJA 3SMHA 2DVFA 3ZVXA 3NVCA 2OKXA 1IHMA 3OBTA 5LRSA 3WUCA 2WAOA 3CEWA 1HLCA 3LWCA 5FZ7A 3NJVA 2V4VA 1C5IA 4N7UA 3CHXA 1UOFA 1C1LA 2V4AA 4XEZA 1OVSA 1VBE2 5L7OB 3H0OA 3H8RA 2VBPA 4P02B 3V64A 3WR0A 2QKDA 1AX2A 1W9FA 2W5FA 2XQXA 3EXUA 3UKNA 4WZFA 2D98A 4XMIA 3B94A 4JX0A 2BV4A 2J7MA 3JB8A 4JGYC 2ZS6B 2LW8A 5FMBA 1L7QA 4JDMA 4YVSA 1FOD3 1WD3A 1BK0A 3U10A 2FMYA 4AFMA 3ROUA 1OLMA 5JZGA 3E6BA 4RHV1 3SITA 2O8QA 5DQ0A 2JENA 2GN3A 2VW1A 4LIUA 1QHDA 2EF6A 3GBWA 4LJHA 4OCTA 1DGRN 1YRZA 1AR93 1COV3 3LGRA 1NCRA 3U11A 4G4FA 2DF7A 2B9UA 2HLEA 1YIFA 3KM5A 4META 5G04L 5AC91 1JZ2A 3P5BA 4A7YA 5DAXA 4YVWB 3OPWA 1WD4A 2CDOA 2QZ3A 2XHKA 1G9BA 4AHYA 1PVC2 4OLLA 4BPZA 2WS92 1FOD1 2P4EA 5KXDA 1YC61 2PXJA 4XHXA 2VECA 3DGTA 1DLCA 1OI6A 4WVZA 2PHUA 5IUQA 5IVYA 1PGSA 2OUJA 3NAPB 1HQNA 5A3OA 2I74A 3SNMA 3VBHB 3VBOA 1H0BA 2Q4SA 2PLV1 3VDBA 1D4M1 1U5IA 5FZGA 1J3PA 2O1QA 4SBVA 1BVVA 3AMQA 2QDNA 3U37A 2YHJA 5FUNA 2IWGB 3VBSC 1S0JA 1UKGA 4Q27A 1MEC1 1TMF1 2NMOA 1UL9A 4UFJA 4E2QA 4QB2A 3UNPA 1KFXL 2A6XA 4K20A 2E31A 3I97A 3WOGA 4F8AA 1YQ2A 2W3JA 5JXIA 1JW6A 2YFUA 4XUQA 1KITA 4LBJA 4GJZA 4D6QA 2E26A 3N7JA 4HONA 4TWTA 5CADA 2ZAHA 5FLJA 5T55A 5ABJB 5HCAA 3ME2A 4ZZ8A 1CWPA 4JHTA 4QPIC 2PHFA 1ENXA 5IVCA 3POYA 5AFBA 1UD1A 4M00A 2IXKA 4AI1A 1R1A1 2D3PA 2PLV3 4HL0A 4Y22B 3SCHA 1K42A 1WLTA 5JUVA 1F5FA 4YW3A 4AVSA 2DWRA 1L7LA 1W6OA 1H1MA 1JUHA 3ILNA 2C4XA 3PVEA 5CZKA 5A1AA 2H0VA 4MOAA 4P5HA 5FYCA 1AYN1 3AYDA 3C7FA 5F8PA 3ORJA 4TXWA 2C6SA 4H2AA 4YZ4A 2YC2A 4JGZB 4M3CF 2A6VA 4UFIA 5D8AC 1ZRFA 1HRI1 4MO3M 1HDKA 2AH2A 1VB2A 5CU1A 4DY3A 3OBZA 4LO6B 1JZ6A 1TNRA 4PF5A 4XFGA 1CAVA 4QQ2A 5I0TA 2PAMA 4RS5B 3E5QA 4TTGA 2ID4A 3DPRA 2C9KA 5FYYA 1W6PA 1RUD1 5CFDC 3MF9A 2YBKA 4P9IA 1Q8PA 5HBAA 4QQHA 3UKVA 3ZSLA 2AEZA 1WWYA 1J58A 1OUXA 1W6QA 1YQCA 2CY6A 3H9AA 3CLPA 3CO2A 3GJBA 5BNPB 5IATA 5A7NA 3VHNA 2X09A 3O1UA 2HH9A 3POFA 5IVBA 1AR83 5C3SA 4XUOA 3NV2A 5JR2A 4RGAA 1PO12 1QQP3 2WNVA 4B4QA 2HEWF 5LRRA 5E6HA 4HVQA 3DXTA 3WDVA 1HRI3 2YPDA 5LEJA 2ZA9A 2QVSB 4DO0A 1T2XA 1QXPA 3QOPA 4QKFA 3SKJE 1DG6A 3HVDA 1OFNA 1QJU2 4IE5A 5I0SA 2D6PA 1G9DA 1UQXA 3RI8A 1GNHA 3WP4A 4QQLA 4DMIA 4XJAA 2VXRA 1QJX3 1HXS1 3D5OA 2ZX2A 1L3JA 2VC9A 5FZOA 5J7MA 2NN8A 1ULEA 4RD7A 4HSLA 4XZPA 1UOJA 1F4AA 4HSJA 4RN5A 3IMMA 3K4AA 1W0PA 1VAKA 3PIJA 4CU8A 2G9ZA 1V6IA 4BE3A 5J1XA 3ZM8A 1LR5A 1WMXA 3JU9A 4D94A 1QQP1 2XDVA 5ISLA 1DHKB 5K9YA 2OT7A 1GOFA 2A3YA 2LS6A 1Y9GA 3AZZA 3JBG1 4JDNA 2FDKA 2CWSA 1LHVA 2HKXA 4RR3C 1K5JA 4CDQB 1ENSA 1ODMA 1UCXA 4FVVA 5CFCC 4N43C 5FZEA 4KU8A 2XLAA 3D0SA 4I30A 3S7IA 1O91A 1SLIA 3B3QE 4XMAA 5IT6A 4IEYA 4CCLA 5HXVA 1LHNA 2VZ1A 4NIGA 2ATFA 2QQVA 3KT7A 4KWKA 2W08A 2ZZJA 3TOJA 4XDOA 1BBT2 1RXGA 4KL1A 3DKQA 4P9XA 2E63A 3KT4A 1NCQB 4C1WA 1VBB1 1UXZA 3H50A 4LK6A 5GKAC 2IXCA 2W68A 3Q9OA 4CCNA 1OMIA 4PI0A 5FLIA 1CR7A 4J1XA 5LA0A 1GP5A 4CCEA 1HB4A 3O5SA 4JRLA 1EYBA 2WQ4A 5GZDA 3ZN6B 4RL7A 1QWRA 3PVNA 1XU2A 4B4RA 2ZGPA 3KCCA 3I2JA 4CDQA 1CAUB 2WZ8A 4LHKA 1V6MA 2DVAA 1QGLA 2QBXA 3NNJA 4Q4Y2 3ZMOA 1DLLA 1LEDA 3RMYA 2ORXA 3NMBA 4CDUC 2A6ZA 5K4LA 1QJX2 3PTYA 3OY8B 2ZPXA 1NLQA 1QU0A 4LORA 5I0DA 3HPNA 1GICA 5FPUA 5FPXA 5LBFA 2FDIA 4LO5B 3OF1A 1G9FA 5F37A 3RGBA 4N43A 1MQTC 3NNFA 5K0UC 1S2KA 4AEDC 3AP9A 2GC3A 1YIPA 1OLQA 1GP6A 1KEXA 4GH4A 2NQYA 1IPJA 3MFAA 5IAXA 3W58A 4U36A 2VW2A 3IPVB 4HLTA 3THDA 3CL1A 5FUIA 4DXSA 2JWPA 3HT1A 3MIGA 4Q8LA 3ZFEA 4X8NA 4AFCA 3W59A 4P9WA 3W5MA 2DTWA 4CUAA 1SLBA 1OOPB 3I7DA 2XKOA 4GULA 1VBC3 1CPNA 5FZFA 3TNPB 4N53C 4QPGB 4UW5A 4CEYB 3ES1A 4CCKA 3NL1A 3PIGA 2RS51 2A6YA 3FL7A 1PO22 1NT0A 3U75A 4JC1A 4CTEA 1V6KA 3AP7A 5DAWA 1SFNA 4BQ4A 5J09A 4Q4Y3 1JYVA 3FHIB 3K51A 4QPIB 5FZCA 4LO4B 1EUTA 3E97A 1LU1A 2R30A 3FLPA 3P3NA 4ISQA 4BQYA 5FY9A 4LITA 4BIFA 4AGGA 2P5BA 1OPMA 1KFUL 4I3PA 4KH9A 3THPA 4Y20B 3O12A 1COV2 1A8MA 4XF9A 5FPZA 1DQ4A 3BVCA 2EALA 2PHXA 4E4ZA 4BU2A 5I8YA 1YXWA 2DCTA 1A8DA 3WDXA 5BNOA 3B9IA 1V9U1 5A80A 5JOXA 1H2MA 1RHI3 1GQGA 1YYNA 3NJXA 4UI9L 2D44A 4XIKA 2ZGKA 1W8WA 3ZIWA 1S0EA 1W3XA 1NLRA 1WLWA 1O3RA 4S2FA 2DTYA 2YMZA 1AR63 1GWKA 4Y24A 3G7DA 1Q56A 3MICA 5I8TA 1RGSA 1W0OA 3HNYM 5C9AC 4DS0A 4UFKA 4EYUA 5AVPA 4YVWC 2BRTA 4OI4A 1JXNA 5F32A 3WG1A 4DXZA 1IZ3A 1LOBA 1DQ6A 1UKRA 3CDZB 4P5YA 3POBA 4FOQA 1PGL2 5GZEA 2GNMA 3ENRA 4WM7C 1S0FA 3LKJA 4YZ3A 3O0XA 2PQSA 1W05A 5EP9A 1RUC2 3T2QA 2RS31 2ZGUA 1OQDA 3OPTA 3N9LA 2JG8C 1PX3A 2E7QA 1W6QB 2YROA 4R4XA 1ULOA 4EWEA 2KXLA 4PDWC 1GQHA 2ZHNA 3DXUA 3LOBA 4QAWA 4R9BA 2VZUA 4Q0QA 1CONA 3HOBA 5FK7A 4A44A 1LULA 1GFF2 5H9QA 5D1IA 1OD5A 3VBOC 4YW5A 1QOTA 3M7AA 5FK8A 2Z42A 1GANA 2P6CA 4W8JA 1J1TA 4UWDA 4QXKA 1RUG2 3BIEA 1JH5A 1R083 2TBVA 2JDKA 4COZA 3BTXA 1Z0HA 1PK6A 1GZWA 1TZOA 2ES3A 4YLZA 3B7MA 1ULCA 2Q8OA 1Z7S3 1IG3A 5CFCB 4IL7A 1SZBA 2RS33 5FY5A 1T6GC 1SMVA 4IEVA 3ZYHA 1QF3A 2IXJA 3Q8EA 4OHZA 3S57A 4IW3A 1PMHX 2W0XA 4XQDA 3O1OA 3GCWA 2BTVC 3WDYA 3VN4A 1NOVA 5DN2A 4DOUA 2OW4A 4A41A 3AZVA 2WSVA 2ZJCA 3OSDA 4GIQA 4P08A 4PDWA 3WY6A 1VMFA 5JIAA 1GOHA 4INDA 4BQXA 1HRV3 3NV1A 5L19A 4X6QB 4IEQA 4AVVA 2WFF1 3BPSA 2JIGA 2WS93 2GP5A 2XWJB 2OPWA 4LTAA 1ZA7A 2W52A 1POV0 3IMNA 4Z2AA 2Q30A 3IIAA 2VCMA 2V72A 4PT6A 4L99A 4WVMB 4XFCA 1FNZA 3ZKYA 1IOAA 4FTBA 4L0PA 1YCIA 1BBT1 1LHOA 1GU3A 1MS3A 4UFMA 5DAPA 3VBOB 1JU4A 3VKLA 4PHZA 4BM8A 3M3QA 1V70A 3KV9A 1UZZA 2G9FA 4BMEA 2FDJA 2JDYA 5FPLA 3ELNA 4AQSA 3RWKX 4IETA 1RJ7A 3ETQA 3WF3A 4HXCA 4X8PA 1D2SA 2R073 4E8CA 4YRDA 1FOD2 2WS91 3MF6A 4S2DA 5LK5A 1FATA 4FPCA 5FXZA 5BY5A 3LQCA 1WGPA 4YYOA 1OA3A 3P1IA 2ZGQA 3GYDA 4NN0A 4C0HA 3HBKA 5CVRA 3BTYA 1W03A 2WZEA 3EB7A 3SH3A 2WINB 4LIVA 1R64A 1N1TA 4EN8B 4K21A 4JZRA 4QT6A 3S30A 5JWPA 1ZBE2 3C2UA 1JS9A 1OH3A 1UU4A 2RR12 3DL3A 4KMQA 5HCBA 5JI9A 3P6BA 2JDHA 2YV8A 1TQ5A 1FXZA 2WT2A 3RYRA 5JVVA 1OOPA 3VDDB 2VTXA 2VZPA 3E6DA 5KC5A 3RZLA 4A3XA 2XBO2 2YPJA 3ACIA 3I4IA 1UMIA 4QPGC 4XDPA 4Y3OA 1I5ZA 2B45X 4Z07A 2GNDA 5IFPA 4Z8BA 1I1EA 3TYJA 4KQ7A 4CE8A 4YZ5A 1I5PA 2EVXA 1DZTA 1CVNA 2YG0A 3VDDA 4DEQA 4A2UA 5KXBA 3J7HA 3MUY1 3DPRC 3IZOA 4FFGA 4NJ4A 4NIAA 1N1VA 2HWD3 1KDMA 1XOYA 1RVF3 1H1AA 5GLZA 5L9BA 1O4ZA 2TEPA 3POGA 2DBNA 4NPMA 3MLLA 1P8JA 5J3UA 4Z2WA 1HQLA 4QDRA 1UW8A 2C0ZA 4CU6A 4QX0A 5E88A 1VRH3 1I9RA 1JI6A 3H42B 1QNYA 1BLZA 2FCUA 4MGYE 5EJZB 1RUG3 3LCPA 4AEJA 3M3IA 1PNGA 3H1YA 1XB9A 1GP4A 1UZWA 3OEBA 4EZ4A 2D6MA 2HWF1 2ZBJA 4BQWA 5EWSA 5LB6A 4HT1T 4DPNA 1B35B 5DAQA 4Y22A 4BK5A 1C28A 3JD73 4YG6A 3F2ZA 4EWDA 5HV0A 5APAA 2PHWA 1NG0A 2Y60A 2HYKA 1G8WA 2E32A 1C8M2 3KZ4C 2WNUC 1BJQA 1XU1A 3OGGA 2MHFA 4NHMA 3RI9A 3PL0A 1KXGA 1LOGA 1V6JA 3MBWA 1W9TA 1HJGA 1O6UA 4QB6A 3BCWA 4W6YA 1MPXA 3SC7X 5FO9B 1ZZCA 5T52A 5IK5A 4B7EA 3WVJA 5A6XA 4GAZA 3MV11 1SFPA 4W50A 4BB3A 5IFTA 3I49A 4V2VA 3ACHA 4CDWA 4JQTA 2WZR3 2XVGA 4Y1ZA 2LTNA 1N3QA 2VBDA 4LE4A 1PIV3 2XGXA 4ONUA 4CP2A 1LENA 3WW1A 1ENQA 2JJ6A 2RDSA 5IK4A 3O1SA 2R16A 5C70A 3KD4A 3ZXGA 4LBNA 4YZ2A 2Y33A 3MW2A 2XLFA 4HANA 3N3HA 4NHXA 1EV12 3J8F3 1AX0A 2YGLA 1GZWB 1G9CA 1N1SA 1H8TB 1OSGA 4WM8A 1RUI2 1H8VA 4CXYA 4GH4B 4UOJA 1FMD1 1DGRA 5FZ9A 4PLMA 1FX5A 4NHYA 2JECA 3T2TA 4HETA 3T4HB 1NCRC 3FE5A 5CG9A 5FTTC 2ET1A 1L7RA 3K48A 1FV2A 1AYM2 1X8MA 2WR9A 2Z4FA 5FZOB 2DCJA 2X5IB 1QJU3 4B29A 1OUSA 2EXJA 2OS2A 4R8HA 4XABA 3UT0A 4GA9A 3RYPA 2KD7A 1UAIA 5J96B 1NA1C 2BPA2 1NUKA 1XYNA 2GC2A 4OQ8A 3BKZA 2K0GA 2XUEA 2YFZA 3TB0A 3GALA 2VUDA 2WA4A 1YFXA 1AR62 5LA1A 2XVLA 1URXA 2PYTA 2JD9A 4RR3A 3VV1A 3WINE 4ET7A 4AF9A 4PJYA 4QU1A 3AC0A 5IJRA 4YGEA 1Y3TA 1RJ8A 2A71A 1FMD2 2HWC3 2OX0A 2WZR2 4EROA 2BWAA 2XKPA 4HVOA 1ND3B 3I3BA 5LK7B 3MLKA 2HWE2 1TME1 2WN2A 3J4UH 3O0VA 1ND3C 1OKOA 4XXAA 4BXFA 5FYSA 1J83A 2ARCA 5T3NA 4CEYC 4IERA 5DDJ3 4LOTA 3KCXA 5L9VA 3BODA 2WNVC 4LQRA 1RUE3 3WF1A 4W65A 5DPNA 1NYWA 2BP6A 2Y6JA 4XTMA 3AVSA 1Y9QA 5BNNB 2PHTA 3H8OA 3SLIA 3EBRA 1W9SA 4LLOA 4Y5Z0 4LBLA 1TG7A 1MZ6A 4Q2FA 1YEWA 4I0WB 4TSVA 3J7NA 4MZUA 2YGMA 4LUMA 1U5ZA 3I2DA 1ULGA 5CFDA 4D3WA 1BKZA 1VJ2A 5FZ0A 3OD0A 1TME3 3VDAA 5DMYA 3O1VA 2Y0OA 3MIDA 1O8SA 3VLBB 2ZX0A 2JG8B 1KDKA 3UL2A 5JOYA 5FY8A 1AL21 2DVBA 2V73A 2VOKA 1RUE1 4RSUA 5FMCA 3ZDSA 5FZ4A 4QQPA 3T08A 1BEV2 4L9BA 4UFLA 1DFQA 1LGNA 3IM0A 2YY1A 3NNLA 3POIA 5FV3A 3FBYA 1W8NA 4NOTA 3U07A 2FD8A 1F8VA 2CGNA 3PDQA 4A7KA 4ZU4A 1QH7A 3DKWA 4RR3B 1ZRDA 1H9PA 1KRIA 2R1DA 3H7YA 2JIJA 1CJPA 4P9LA 1S0BA 1WCDJ 2E33A 5FZ8A 3IBMA 4D6SA 2HWC2 1RUJ3 1RINA 1PZ8A 1AL23 4MX3A 1I3HA 3EMRA 3SXWA 1JOBA 4TYSA 1QJY1 5IHRA 3IDEA 4ES8A 3OUIA 1XSQA 4B8EA 1W8TA 2EIEA 4AI8A 2DUOA 1H2KA 1EUUA 2WIIB 3PUAA 4RQPC 4KWLA 1PGL1 4WVVA 3DN7A 1OHFA 1VR3A 4YWAA 1SLAA 2GU9A 3CZJA 4C8DA 5DXDA 5FOJB 1CAUA 5FYVA 1XNTA 2VMCA 5FCCA 5CKNA 5SV5A 3VBFB 3VBSA 4EJRA 4UF0B 4XFIA 3R4SA 4H7MA 4Q1PA 4HKLA 5J36A 4ZS2A 4QM8A 5JXGA 2OPKA 5IVEA 5JPNB 4UBGA 3WF0A 2Y26A 5FKBA 1CIWA 3TN93 2LM3A 2PHDA 5FY7A 4XVHA 4QXCA 1IS5A 5FBZA 2B46X 2B4KA 1HV1A 4GB32 2GMPA 3HWJA 1MEC3 2F4LA 5A70A 1COV1 1SCSA 1C1FA 1X82A 3MEPA 5C5UA 4YPJA 4IESA 5AC93 2VY0A 2ZXQA 4XYXA 5I93A 1IS3A 1UIKA 3E5UA 1ZA4A 3ETPA 3LSEA 4IE7A 2PN5A 4RGGA 1AJOA 5JZGC 5T54A 4Y1YA 3I3MA 2B39A 4ZY9A 1WBFA 4CU7A 1JZ4A 4JGYA 4NIDA 1W9YA 2ZGNA 1NQJA 2VBBA 3OEAA 4KWUA 3THTA 1IPSA 1RUH2 2EXKA 3K77A 3TN91 5FY1A 2AENA 2RG4A 2NLRA 2TUNA 1FYUA 2XUMA 3RFRA 2WFF2 3V0AB 1E5HA 3FBMA 3OD4A 1W39A 1B35A 4XUPA 5ERLA 3W20A 3E6CC 1YI7A 3CU7A 4M3CB 1UF2C 5LEKA 2OZ6A 4YNIA 4I09A 5ANNA 2VMIA 2UY9A 3IKWA 1W8OA 2NZ9A 4XF1A 4ASLA 4GMP3 1UYXA 3PLQA 1QJEA 1J1LA 4LKFA 5D21A 1WLDA 4YSFA 4ZPIA 5F2WA 5C9AA 1FT9A 1W99A 3WP5A 1GZCA 4AW7A 4XOGA 4C91A 2L9LA 1CIYA 2VTXJ 4J1WA 2BU9A 3WLUA 2BFUL 4L97A 3WDUA 5FZAA 2GSYA 2DUQA 1NX9A 2A1XA 5EIYB 3ZFEB 4QGNA 1RMU1 1N3PA 1UMHA 1NE4A 3LIHA 2RS13 3LA3A 2CAUA 3AKQA 2E51A 4IQPA 3AZYA 1D4VB 1SPPA 4CP0A 1AYN3 5KHIA 2SBAA 3PVBB 3PJQA 1CAVB 5H9PA 4XJ8A 1A6CA 4AWDA 3OG2A 2C1FA 2UURA 5IWFA 3TRSB 4AEMA 5KC6A 1W28A 4Y4RA 2BGOA 1W6PB 5B4XA 1RUD3 3POEA 4HPKA 3GJAA 3PJYA 4F83A 4P14A 1Q8OA 3ZN5A 4YM3A 1JOJA 1XRUA 1DQ5A 2NYYA 3IDAA 3LEGA 2BGPA 2YC0A 3PURA 4CRQA 2VQAA 2YXSA 1O3TA 1H30A 1FNYA 1XC6A 3J26N 2XJVA 3GCXA 1RVF2 1GWLA 4LEJA 3HJRA 3R6SA 4DB5A 5BNOB 5FY4A 4H14A 1UZVA 4IEOA 4S2HA 1W6OB 4JGYB 1LJ7A 4NR1A 1NCQC 3ZFEC 1MQTA 3A0NA 3H3LA 3HN3A 3ON7A 3PNAA 4OUMA 3SCGA 2WNEA 2HWD2 3QLQA 4OI1A 1PX4A 1Y4WA 2FQPA 2QQUA 1UWWA 1NY71 1WKYA 2A6WA 3AP4A 3O0WA 5C8CA 5KHGA 3K46A 1E57A 4GH4C 1O4YA 4XUTA 1UN1A 1V9U2 1NY72 1WA6X 5BV6A 4N90A 4A4AA 2O14A 1UNBA 5I8SA 4CZSA 3AYEA 4HFSA 3MIBA 4BWOA 4MUVA 1IGOA 1ND2B 2Y6LA 4ATFA 3ZYFA 3ZYRA 4ARXA 2CAVA 2ARXA 2GDFA 5F3EA 4Y33A 3MUZ1 4CDQC 2MNGA 1XE8A 4Q26A 3RZJA 1QOSA 5DAVA 2FHRA 4EN0A 1LOFC 2JE9A 3NNMA 5C3RA 1DGWA 1PK6B 2X05A 2D6OX 1B09A 3L2YA 3T3YA 3WG2A 1OD3A 1VBA1 2EAKA 4C1XA 5FPVA 5FY0A 1ONAA 1LHUA 4AQ6A 2H6CA 1S0GA 4BOWA 3MFCA 3LDRA 5FXXA 1FI2A 4UF0A 3KHCA 1G7YA 1K5MB 1Z7S2 2VMGA 2XJUA 3HNMA 3KF5A 5DZFA 2VMHA 3WQ7A 4CU9A 2QCSB 5CKQA 3T2OA 4BXSV 1GMMA 2N7GA 2H0BA 4HBNA 1X9TA 4AAPA 4XAEA 2PAKA 1V00A 2CWMA 3FHQA 2JDAA 1H6YA 4NPRA 2UWCA 4RQPA 5ACA1 4UXAA 3AMMA 2Y0IA 5CB7A 1K5MA 5EJ1B 3WF2A 1VAVA 1UYPA 3PHMA 1NCRB 2A7AA 5A3WA 2WNVB 4HK8A 3CQOA 4TLFA 3VDCA 2CSGA 3GGLA 5FZ1A 2VM9A 3UK9A 3B5LB 4QX1A 2P3YA 1UOGA 1CAWA 1HRI2 2HJIA 1DQ0A 2VQUA 3AKRA 3I8TA 3PUHA 4M0HA 5F6LB 5IW0A 3VB9A 5FYHA 3ZXAC 1GUIA 2QQWA 2VNRA 3OGJA 5A3MA 4MG2A 4CYDA 1F35A 3OCPA 1LAJA 3A23A 2XL9A 3AX4A 3JQXA 4Y26A 1LRHA 3WNLA 2J1VA 3RZZA 5ACA3 2BVVA 5CYYA 3A21A 2WRAA 3USUB 4JKLA 1AUYA 1QXJA 1EPWA 5KHKA 3WW3A 4Q4Y1 1WW7A 3FN9A 4RGKA 1BXHA 4XZUG 3TWIA 5JLVA 5CNAA 2VZ3A 3H1MA 4UW6A 1ZZ7A 1W8UA 3H3UA 3RZKA 2XQRA 3W21A 2XPJA 1KJRA 4LLFA 2EIGA 2P2KA 2GC0A 4NRQA 4Y20A 4EN6B 5HPOA 1E5RA 3QCWA 4IEWA 4ZS3A 1FPN2 2ORZA 1BMV1 4OMDA 2HYXA 2A73B 3N7LA 1SDDB 4LO8A 3OJBA 5A6QA 5A3LA 4UT5A 4BCUA 4DXRA 3BI3A 4MGZE 4QGMA 5H9RA 4KG0A 1S4CA 1WW5A 1WCKA 3USUA 1AR81 2WDBA 2YDEA 1AR61 2VUCA 4IE6A 2BNMA 4CCCA 5D8AA 5FZBA 4OZOA 1WW6A 2FDHA 2A3XA 3RPQA 4Y4YA 4MV2A 1WUVA 4Q4V1 3WCSA 1PVC1 4CXWA 4FAGA 2PHRA 1SACA 2Y6HA 3D0JA 1K12A 5A7WA 1PO23 5I0UA 5H9SA 4COWA 2CTVA 3TNQA 1ZRIA 5DUVA 4AXOA 1PO13 1QQP2 2BZDA 4NO4A 1V6NA 1NE6A 2OXBA 1ASJ2 1AYM1 1D0GA 3WNOA 4DXTA 2AREA 4Z1VA 2IZWA 1PHMA 2R042 5T5LA 3DYOA 2ZX1A 2WJSA 4QDQA 4DUWA 3MIFA 4NWWA 3MW4A 1OQEA 3E1F1 3VZOA 1DDLA 3AMNA 1B35C 2GP3A 2V5DA 5FPBA 5IVFA 1CN1A 1G86A 1RHI2 3D8CA 4NHLA 1DZRA 2JDPA 1NQDA 2Q1ZB 4Q4W3 1HB2A 4AVAA 1RUI1 1J3QA 3VBUC 1YQ5A 2EA7A 1RIRA 5KXCA 2D5FA 3KHBA 4AVCA 4N43B 2WUHA 1Y9MA 5FZIA 3ATGA 3VBUB 2GMEA 2W94A 3AL5A 4PQQA 5K0UA 1W6NA 3FJSA 3GBGA 4M3CE 1DF0A 1JZ3A 4A6OA 3POSA 1ZVFA 1QJY2 3A0KA 4LUKA 1RL3A 2XH6A 3T09A 5CIRA 1PO11 4XW3A 3DPRB 2PELA 2Z69A 3JXSA 1UX7A 5J48A 3ZXJA 2FMDA 2WT1A 5JZGB 2R1BA 4FT8A 4PI2A 4D8MA 2IUWA 1W2NA 3KS7A 2IXHA 1ENRA 3UESA 2W1SA 5FP9A 5J98B 3WF4A 3WT3A 2NP0A 3BALA 3LB9A 1WCSA 3AYAA 4PCRA 4Q4W1 1W9WA 5FFOC 2JG9A 3HT2A 3ZN6A 1UY3A 5BNQA 3ZYGA 2D6KA 2CDPA 3DYMA 1UZ0A 1ZYBA 1POQA 2W95A 3BOWA 4FPYA 1PGW2 3VKOA 1HN1A 4E4DX 5KR7A 1S0CA 4PIXA 2NM1A 1S1AA 3WV6A 2VCAA 1AF9A 4AQ2A 3FFQA 4GD4A 4LE3A 3C8XA 5A7QA 2XJQA 1DZQA 1HRV1 3WUDA 1PGW1 3UGGA 2W1WA 3KV4A 4O9GA 3ZKUA 1DYKA 3GZAA 3TEYA 1S0DA 1CQ9A 3FX3A 3HD8B 1ZBA2 2JG8A 3AYCA 3Q8BA 4PLNA 5A7PA 4Q4W2 2PA7A 1R1A2 4YW7A 3OYWB 1WCQA 1IS6A 2QZ2A 3UGHA 3LPGA 1CZSA 4Y5SA 4WVWA 3VZKA 4ARYA 2RR13 4QKBA 1HJFA 2IXLA 3S0MA 1HX6A 4K6BA 5EFUA 3WNMA 1DQ1A 4MLOA 4LHLA 1ZREA 2BYVE 1AL0G 1ZBE3 3ZFGA 1O4TA 3M2MA 2JEMA 2TNFA 3OGSA 4PQ9A 4D69A 2R071 2HWE1 1X8EA 5FWJA 3VKMA 1TVGA 2B9VA 4OFGA 1EAH1 1APNA 4CDXB 4BQ1A 2DDUA 1X50A 4YW4A 4YVWA 1AJKA 1TE1B 2WFF3 2ADEA 2WO2A 4QXBA 1PZ9A 3I59A 2RR11 4N53B 4OHYA 1Q5OA 4FP3A 1XNAA 3PU8A 2DBIA 2QQMA 1WMEA 3MYXA 3LEKA 4L92A 5CA6A 5C3PA 1C57A 4TN7A 2MEV2 3AJYA 4QD2A 1R093 3ZFFB 2WLPA 3KVBA 4QX3A 1RTVA 4QHBA 5FYMA 5JSPA 3MLJA 4FFFA 4GJYA 1WMDA 4COYA 4NWVA 1DU3D 1AXYA 5F5QA 4Q4V2 3MI8A 5JAXA 2MEV1 5BNOC 2QQOA 4NAOA 4JCKA 4YG3A 4A45A 1OLME 4FPKA 2Q0AA 3GF6A 1EAH3 1OFSA 5FP8A 1Q8QA 5JR7B 4FPLA 1N1YA 5KXEA 4OUEA 4MXWB 4M4RA 5IYYA 1MZFA 2GZWA 4OMCA 5DUXA 2ZGSA 1ZBA3 4P00B 1VLNA 1RXFA 4ZHNA 2P3KA 4S2GA 4B1MA 1FPN1 4JGZA 4D7TA 4HMZA 2DVGA 4E27A 1WLCA 2VXJA 1AR92 1MS5A 3N7KA 5EYXA 4B7KA 3NSTA 1W8FA 1WBLA 2VUAA 2R7EB 4E8DA 3W9AA 1AZDA 1DCSA 2OA2A 1GYKA 4HK9A 4TZDA 5FXWA 1N3OA 1YJKA 3HQXA 3I2KA 4CUBA 3LZZA 2D97A 4XETA 4BLIA 1RYYA 4MGKE 3JD71 3ZX7A 3T0DA 3WDWA 2GNBA 1JZ8A 3AFGA 4Q0PA 4CDWB 2R062 3LF7A 4KU7A 1J3RA 1YHFA 3RNSA 3J7LA 2WL1A 2XB6C 1LTEA 1ZBA1 1F4HA 4YZ1A 1AHSA 3FC0A 4V1PA 1GNZA 2G9GA 1FPN3 2V5YA 2XONA 5IVVA 1SLTA 5JDBA 5JXJA 3O1MA 4Q5OA 1OVPA 1ULFA 4UAPA 3VBRA 3ZXDA 3BU7A 1GR3A 1ACCA 1X36A 3ZYJB 3T0AA 2ZEYA 2JG9B 2VOWA 2VQTA 3VBFC 2EXHA 4XDQA 2ZOEB 1VRH1 5JIUA 4PBOA 1JMUB 1RUG1 3ZXEA 5CBLA 3CJIC 4O7XA 4FOWA 4NRPA 3NV3A 2RMU1 4XHBA 2EXIA 5FRAA 2EIDA 1KS5A 1KS4A 2CL2A 2ZCWA 2BOIA 5TSWA 2WYSA 4AI3A 2IC1A 1XYOA 4HKWA 4YGBA 3S6PA 3PUIA 4YFZA 3AVRA 3WW2A 4LBKA 2LUWA 5IK8A 2HWB1 5FYUA 4IUGA 1XSRA 2WSUA 3B00A 3O14A 4JTOA 2WO3A 2ZTNA 5F39A 4A7ZA 1PK6C 2DURA 2IVIB 5HCFA 2X8KA 2YZ4A 1IPKA 3CBNA 2XXZA 2RS32 3O7OA 1QNWA 1NA1B 5JMOA 1WW4A 1ALYA 1Z7S1 1AXKA 2MPFA 3FUOA 4XACA 1CD3G 1EY2A 1U5YA 2XVKA 5JOZA 3ZYPA 2VPVA 1ZZ6A 1H6XA 4B4PA 2Y6FA 1JYCA 1LOAA 5DZGA 2RMU3 1XPWA 4CEWC 4Q4X3 3NAPC 3L9JT 1UOBA 3WCRA 2XBO1 1BK1A 2HEVF 2ARBA 4WV8A 2PQQA 2VVEA 4JVAA 4L11A 1STMA 3GBFA 3OY8A 1MZEA 1RUC3 2X29A 3MO4A 1K45A 1QXRA 2VNVA 2VZTA 3OOXA 4LBQD 4DZGA 3LAGA 1NLSA 4XPVA 3VHPA 2G1MA 1ZZBA 2ENRA 3U14A 3NJZA 5C8CC 4Q4X2 2D3SA 1EV13 5BNPA 1MR5A 1VBD3 3MDPA 3O1RA 2W39A 4HOOA 2JKXA 1V6OA 1XJAA 5HCHA 5EZWA 2QJVA 3DCQA 4GWNA 3TEWA 2NMNA 2AACA 2W9XA 3KV5A 3THCA 1XXNA 3ALQA 1W2UA 2X10A 4CP1A 4HN0A 3NO8A 3J7MA 4ZXKA 4CA9A 3D6EA 3N9OA 1W6MB 1X33A 3CF6E 4DINB 2FBEA 2JDNA 2XLGA 5AVAA 3B02A 3NKGA 4IDZA 5BNNA 3AK0A 2ETEA 3DV8A 3ECQA 5M0TA 1D0HA 3ZYBA 1PNFA 1SG3A 1UY4A 5GZCA 5FQ0B 4DNYA 2QE3A 1BEV3 4IV1B 1Q3EA 1W6MA 2VH9A 5FJKA 3RWNA 2WNOA 4AI2A 2WN3A 3WXPA 4Y1XA 1US3A 1BQPA 5EYYA 2VOXA 3UYJA 2P37A 2RJKA 4YM1A 1CX1A 3VL9A 3KWVA 2WNUB 3EJKA 1OOPC 1UPIA 2UU8A 3Q8FA 5T5JA 2JKBA 4GWIA 4B1LA 1GWMA 3RZGA 3OPZA 4BQ2A 3FLTA 3GNEA 3QBQA 3JZVA 1JYXA 3O1TA 3GM8A 3MZHA 5LW9A 2AR6A 4CEYA 1UMZA 2XJTA 3J8F2 1Y7BA 3MW3A 4K40A 3MGUA 4CPBD 1I6XA 4MSVA 3UKTA 4RA0A 1H1IA 2OQ7A 5FMOS 5A3TA 3POWA 2DCZA 1QKQA 3HN1A 4I2OA 1REFA 4IEUA 4P9YA 1M06G 5JSOA 5FXVA 1IG0A 4W6XA 1V0AA 3U0ZA 1CAWB 2I45A 4D7YA 2QQKA 2ZGRA 4K1YA 4D0QA 5E8AA 5LWBA 4E9KA 1LODA 2E7TA 2OVUA 3SHRA 4CVUA 5ACA2 4FPJA 2Z5WA 1YLLA 2ZABA 4JV4A 3UJQA 1KJLA 4FCAA 4GWMA 4XCBA 4OVEA 2Q8DA 4FTEA 4M4PA 5EPAA 2E9QA 4AE2A 1BYHA 3ZR6A 4WM8B 3NWKA 1NZCA 5BXXA 3WNKA 1ZRRA 2ZHLA 4OHXA 4RYDA 3CIHA 2BEOA 4KGQA 3V0AA 2CGPA 4XTPA 1IKPA 4XILA 4FPFA 2ADDA 1QJZA 2C9AA 3WNNA 4ATEA 5CISA 1PM7A 1VBA2 2DYCA 2VUJA 4H3WA 2ZAAA 5EXOA 3TEZA 2I2SA 2RM22 3I2OA 3BTAA 4MYEA 5GALA 2CGOA 4AI0A 3RZMA 2GH2A 3DUIA 3A7QA 1HKDA 4LHSA 3Q8CA 1SFYA 3C3VA 3LDKA 2JXAA 3ACGA 2DU1A 3RQ0A 3LFMA 4JHZA 4AHXA 5C6CA 2D7FA 1LOFA 1WCUA 4O65A 4GB31 3V56A 3S5AA 3EQEA 4NPLA 4LOSA 1HB1A 2ARAA 2GAUA 2XR4A 4MXVA 3URFA 3RJ2X 1NXD1 3I3EA 4Y1UA 2BGCA 4BZ4A 4RFRB 4XFHA 5JSRA 3VBFA 4ITCA 3VBSB 2P1BA 2FDGA 3VHOA 1QJFA 2A3WA 3MPPG 4FBFA 1A34A 5E16A 3BUCA 2WO1A 4DRVA 1LOEA 1HQWA 4KBBA 4KWJA 2DFBA 2QQNA 2WQ8A 2D6NA 2X5IC 2QQPA 4AK3A 4Q29A 5A33A 2Z2SB 5JI7A 1GNYA 2RM21 5LY2A 3AM2A 4MGIE 4SLIA 3FZ3A 2W47A 3M8LA 4GB33 3K2OA 4A3ZA 1QJU1 3VZJA 4YGCA 4R9AA 5AFEA 3POJA 4AEDB 5FZ6A 5LY1A 2J1RA 3JUUA 5GLTA 5C4WB 4LK7A 4K8RB 1YFWA 3WQ0A 2VMDA 4MGTA 3SEEA 2F4PA 2RS52 3WEZA 4AHWA 1FAYA 2H6BA 5FR3A 1GBGA 4IV1C 1OC1A 5A3PA 3MIHA 4AZZA 4V2WA 3VD5A 1JHJA 5F3IA 3UETA 5FJHA 4HG6B 2FZ2A 2RM23 3VDDC 4OYUA
chains in the Genus database with same CATH topology
1MS4A 2WT0A 2AYHA 5BYNA 1MVEA 5FO7B 1VBE3 4QGLA 2BNNA 4I02A 1X7NA 3B69A 4Y1VA 3VKNA 1RUE2 1VRH2 3U4XA 1RUH3 1F31A 4AVBA 5F1RA 2CYFA 3MPBA 1R1ZA 4GMP1 2XJSA 2ZHKA 1ZZ8A 4Q1RA 4AGVA 3VUOA 1QJX1 4ORFA 5L7OC 3L2HA 2WLQA 5FO8B 2WA3A 2ZX4A 5I0RA 1YFYA 2R061 4E2GA 4WVMA 5A32A 4EWAA 3RRDA 4ZKTB 4RHV3 5FQ0A 4GKYA 3OYWA 2FZ1A 2VVDA 2GMMA 2ZKNA 1RUH1 3TN92 3VZLA 3WDTA 3VZMA 3BB6A 2XJPA 5FAXA 1AR91 1TMF2 1MEC2 3B9CA 1RC6A 4MXWA 4XFAA 2I07B 4HZFA 3E5XA 3PVOA 4KGGA 3SH4A 3KT1A 1AR72 3SH5A 2F6BA 4K3UA 4PIZA 1LHWA 4FTSA 5GZFA 5GM0A 3I54A 3IN9A 4MH0E 3WP6A 2BW8A 4QU2A 3AB0A 4FP2A 4XBQA 1YWKA 4XQWA 3VBHA 5KBFA 1QJY3 2UYBA 3NAPA 4FO9A 2ERFA 3INAA 1LB2A 4GMP0 4RQPB 2AGSA 4OI2A 2XWBB 3QH6A 4YG0A 3LA7A 2QUOA 3RG0A 4LNVA 4JRAA 4RHV2 1OA4A 4FAHA 5B2GB 1O5UA 4ZU5A 2XG3A 1VP6A 2JDZA 2X53S 3D82A 3CNAA 1R1A3 3UV9A 1RUOA 3H8UA 3IWZA 4O9EA 1YNAA 4LT5A 1XYPA 4JQRA 4K7JA 1D4M3 3M1HA 4LULA 2WQZC 1GZ9A 1NXMA 2BNOA 2E53A 4LA2A 1VBA3 4AQTA 1TMF3 2VULA 4G3YC 4YFWA 1LOCA 3AP5A 4L8QA 3VHRA 4ASMB 3HMYA 1PZ7A 3H7JA 4XXPA 5D8AB 5CAZA 1AX1A 5DUWA 1VBC1 5E1RA 3RS6A 1HRV2 2RHPA 5C8CB 1C8M1 1H8TC 2D5HA 4XE9A 3ES4A 4LBQB 3BOPA 3ZPYA 4E4SA 4LA3A 1SBEA 1F5JA 2P3JA 4JAAA 4BYYA 3ZFFC 2OZJA 3DF0A 1V6LA 4JTNA 1A78A 2ZMNA 3WZ1A 4LBQA 1VAMA 1SDWA 3M70A 3JD72 1G9AA 1H2LA 4H55A 1C8M3 1H9WA 1C3HA 3ZSEA 5K0UB 1HV0A 3AXDA 1DBNA 3KB5A 1RMU3 4I0BA 4K1ZA 2RS11 4KG8A 4XBNA 5IK7A 1PVC3 3JBG3 2K9ZA 2Y38A 1D4M2 4N9IA 3APBA 1SCRA 4URTA 1ULDA 1XNDA 4AEKA 3PMEA 4UBHA 1CAXB 2WC2A 4FTEA 3ZFFA 1ND3A 3VZNA 5FMOL 1Y43B 3RDIA 3B93A 1MVQA 3CJXA 4OHWA 5GZGA 5BNNC 2GN7A 5C9AB 3R4UA 1CAXA 2A70A 1HXS3 3NV4A 4XBLA 2D40A 1S55A 2ZGMA 3RMXA 2YUEA 1RUI3 1CX4A 1LESA 5DZEA 2P17A 2D6LX 5A33B 1RUNA 3ZFGC 1NA1A 3VKFC 1VBB3 3ZFGB 5DG1A 4OZXA 5GLWA 4F7ZA 4Q4V3 2UYAA 3ZSKA 3CJIB 1YFUA 1EAH2 3N4MA 1JUIA 4QX5A 4N9HA 4Q8KA 1BMV2 2RS12 4XFFA 1AYM3 2O0OA 1LKNA 4BIOA 1PMIA 4WM8C 4QQOA 1DQ2A 2GNTA 3T1MA 2Z79A 3J9SA 1OQ1A 2QDRA 3H1WA 5DUUA 1ZNPA 3GZUC 3NW4A 3P3PA 5L36A 4IEPA 4L2NA 2ILMA 4YW1A 4XJWA 1Z78A 2VOVA 1Q8SA 2GALA 4UW3A 4CDWC 1MS0A 3WD5A 1MQTB 2JE7A 5BUVA 4ES9A 3RSJA 4AFBA 1MS9A 4JDOA 3TAYA 4CEWA 3AZXA 3EO6A 3IT8A 3ZSMA 2B5HA 4G9SB 3SISA 1MACA 4XF0A 1RUJ2 3VBRC 4GXLA 3WX5A 1JN2P 3ZIXA 1RB8G 2HWF2 1AXZA 2DU0A 2VQ0A 3FWEA 4DRRA 4AG4A 4C90A 2D93A 5CFCA 1MS8A 2QFEA 3KQRA 2CNAA 2D43A 1J59A 1ZRCA 1UPSA 5KHHA 3WP3A 2DCYA 1WA4A 2ZZQA 1YUDA 3ZYIB 3RJRA 5JOWA 1ASJ3 2PAEA 5EJ3A 1LECA 1FV3A 1IQAA 1H4GA 1Q43A 1UU5A 5FREA 2B42B 3I59B 2ZX3A 1VIWB 4PBPA 4XF3A 1R091 5JCTA 4RFT0 1PVXA 1RHI1 4COVA 2RS53 2JD4A 2B7YA 1KQRA 1AR73 3ZO0B 2R49A 2P3IA 3JCIA 3ASIA 4JGZC 1ZBE1 2R041 2OYZA 2WKKA 1DGWX 1ASJ1 4CDXC 3VBRB 3KMHA 1REEA 2HWE3 1XE7A 4RS5C 2DUPA 4CDXA 4DY5A 1YI9A 1OLRA 2Q1MA 1S2BA 1TEIA 4IV3A 5DDJ2 4R9CA 3RYKA 3IDBB 2HWD1 1EPZA 3AJZA 3IDCB 4RS5A 2ZGOA 2ZMKA 3JB4C 5GJ6A 3ZMNA 2B8MA 1AR82 3GZTB 2R0FA 4R9DA 5GLVA 1AR71 1POV3 4IV1A 1V9U3 4FPOB 2R043 1O5LA 3D4KA 1DYPA 1VBD2 1IS4A 2DV9A 1SBDA 4IEXA 3QH7A 4HPKB 1S0IA 4R4ZA 3LSDA 4BMBA 3AP6A 3S7EA 3LA2A 1PO21 4E2SA 2VW0A 1LGCA 3G6JB 4LO7A 3TBDA 1BCXA 3AMPA 4OI0A 1LEMA 4PLOA 2O8OA 1AVBA 4IV3B 2ZMLA 4QPIA 1SLLA 2IXIA 3KLSA 5E89A 3QD6A 4Q0VA 1POV1 1XNCA 4AGRA 4CDUB 3ILFA 1ND2C 1DGLA 1ZX5A 4BH9A 5C8WA 2X5IA 2ZGLA 1DIWA 1UU6A 2GH8A 4XJZA 4IXLA 1PIV1 3V0BB 3WNXA 1WMFA 4FQZA 5T50A 1XNKA 1XQNA 4LBOA 1PIV2 1HIXA 1VB4A 2JICA 2NPIA 1CPMA 2LALA 4IEZA 4BLJA 5GLUA 3J8F1 5KWRA 3WQ1A 2JG9C 2BVBA 2OUHA 2HEYF 4B3NA 4ZU7A 1QY4A 3JQWA 1R081 4HN1A 5T5PA 3QACA 4LBMA 1A3KA 2C5DA 4NHKA 2BBVA 1REDA 1F9KA 2AZ5A 1BBT3 2WWSA 4FPGA 1TNFA 2G4IA 1CGPA 4WBBA 1O3SA 3NKTA 1QOOA 4XIOA 1SLCA 1RUC1 3M3CA 3V65A 5C33A 2XJRA 4GQ7A 5KHJA 4AFAA 3WHTA 4Z92B 1ND2A 3SCFA 1ZZ9A 3H3ZA 4NVPA 2ZGTA 1GKBA 1VBD1 2WNUA 4YVSC 1QDCA 5F6KA 3ST7A 4YM0A 1N47A 2VVFA 3R05A 4I01A 4WM7A 1NCQA 1RUF2 3VGIA 1RITA 1UX6A 1QDOA 1XNBA 3ACLA 3N35A 4FOYA 4XJUA 1C8NA 4BHPA 2BUKA 2IFRA 3LOIA 2QNKA 3AKTA 4U2AA 1QMJA 1UIJA 5A32B 4OUSA 5SV8A 2YYOA 3OBRA 5DDJ1 4AYUA 3AXEA 4UW4A 4Q0SA 3FFZA 5FDBA 3KGZA 2RJLA 3FMGA 4YGDA 1SEFA 3R4DB 1IKQA 3BPZA 3ZXKA 1RUF1 4K9SA 3HAGA 4FPEA 1KD7A 3GHNA 1RVF1 1BVP1 2VNOA 4W6WA 5HI0A 1M4WA 1LCLA 2VNGA 3ZXFA 4WM7B 2BQPA 1R092 3ILRA 4FSJA 2ET7A 5F9TA 4QPGA 4QMAA 2E6VA 1GSLA 1SBFA 2R0HA 2WFPA 4FXGB 1O7FA 1HW5A 4XJ9A 4XQ4A 2MEV3 5C4WC 2IFWA 4BA6A 3WG4A 1JBCA 3USSA 5EV7A 1ZM1A 1OPOA 1VALA 4AHZA 5L73A 1RUF3 1U12A 1CESA 1MS1A 3M4FA 2PTMA 3WHUA 1R082 4N53A 4Z82A 2RMU2 4K8FA 2WZPP 5FOBB 4YARA 1G6NA 2VGDA 1UZYA 1RMU2 5CG8A 1RUJ1 3IPVA 4PIYA 5I91A 3N7MA 4EV0A 5BNPC 1OKQA 1AL22 1H8TA 4EN9B 2DVDA 4AEDA 2E7AA 2HWF3 2KM2A 5J37A 1YJLA 1EP0A 1K5MC 3VL8A 5K7PA 1BZWA 3HBZA 2CV6A 2UY8A 2UWAA 1LGBA 4CDUA 5FLHA 2VG9A 4C0BA 5K8SA 4DFSA 1OA2A 2R6QA 4HVRA 4PDWB 4Q0UA 2ZKLA 1SQ4A 1VBB2 2SLIA 5ABJA 3EHKA 2XL7A 1TME2 3BIWE 2OIIA 1CJDA 4I3GA 4FPHA 2V09A 5ABJC 2WZR1 5AFEA 1MZ5A 2PLV2 4GKXA 3FLRA 2EAAA 3MIEA 2HWB3 3AKSA 1H2NA 4FXKB 4YM2A 3AMHA 1Q8VA 2D3RA 1YO8A 4OHVA 1U5XA 4H7LA 3OTFA 3KCYA 4N7IA 1JHNA 4WZCA 4COUA 3HIFA 3N36A 3AZWA 4YW2A 1FMD3 3CJIA 4P9JA 3JBG2 4R52A 3VBHC 2RE9A 5AC92 3M3EA 4Q4X1 4MVTA 4P9GA 2XBO3 1W6NB 3KGLA 4M01A 3T1LA 2JX9A 3ZN4A 3VBUA 2A75A 3AKPA 2Q5TA 1JTZX 2R32A 4EN7B 1O3QA 4DQAA 4XFBA 4AFDA 1HXS2 3V0BA 2BFUS 1C5HA 2A5ZA 4XF4A 1EV11 2R072 4ISRA 3GHMA 1D2QA 4QM9A 3B01A 1GV9A 3M3OA 1F2NA 3R0RA 2HWC1 5DG2A 1VBE1 4YVSB 4D7SA 2K2SA 3HR9A 3KSCA 2HWB2 1U0AA 5C4WA 4GALA 4QPYA 1H4HA 3WG3A 3UJOA 5T5OA 4AVTA 2VU9A 2DFCA 2PHLA 3AFKA 3A4UA 4OULA 5BPXA 5L7OA 2BWCA 4LR4A 4M0NA 1RUD2 2ZHMA 4F3JA 4M3CA 1BEV1 2KA3A 3FUQA 4IV3C 3X29B 1C4RA 2DCKA 2P34A 4HKOA 4J6GA 2R063 4FQ4A 4I0AA 5CFDB 2UWBA 1QH6A 1JYIA 4FOVA 4LHNA 4X6RB 1AYN2 5JPMB 1GLHA 1VBC2 2PFWA 2ZACA 4CEWB 5JMCA 2AUYA 2GC1A 3PMSA 3WW4A 1LU2A 4KNCA 3ZSJA 3SMHA 2DVFA 3ZVXA 3NVCA 1IHMA 3OBTA 5LRSA 3WUCA 3CEWA 1HLCA 3LWCA 1C5IA 4N7UA 1C1LA 4XEZA 1VBE2 5L7OB 3H0OA 3V64A 3WR0A 2QKDA 1AX2A 3EXUA 3UKNA 4WZFA 2D98A 4XMIA 3B94A 3JB8A 4JGYC 2ZS6B 4JDMA 4YVSA 1FOD3 1WD3A 3U10A 2FMYA 4AFMA 3ROUA 5JZGA 3E6BA 4RHV1 3SITA 2O8QA 2JENA 2GN3A 2VW1A 1QHDA 2EF6A 3GBWA 1DGRN 1YRZA 1AR93 1COV3 3LGRA 1NCRA 3U11A 4G4FA 2DF7A 2B9UA 4META 1YIFA 3KM5A 5AC91 4A7YA 4YVWB 1WD4A 2QZ3A 2XHKA 1G9BA 4AHYA 1PVC2 4OLLA 4BPZA 2WS92 1FOD1 5KXDA 4XHXA 2VECA 3DGTA 1OI6A 4WVZA 2PHUA 5IUQA 1PGSA 2OUJA 3NAPB 1HQNA 2I74A 3SNMA 3VBHB 3VBOA 1H0BA 2Q4SA 2PLV1 1D4M1 1U5IA 1J3PA 2O1QA 4SBVA 1BVVA 3AMQA 2QDNA 2YHJA 2IWGB 3VBSC 1S0JA 1UKGA 4Q27A 1MEC1 1TMF1 2NMOA 1UL9A 4E2QA 1KFXL 2A6XA 4K20A 3WOGA 4F8AA 1JW6A 1KITA 4LBJA 3N7JA 4TWTA 5CADA 2ZAHA 5FLJA 5T55A 5ABJB 5HCAA 3ME2A 4QPIC 2PHFA 1ENXA 3POYA 5AFBA 1UD1A 4M00A 2IXKA 4AI1A 1R1A1 2D3PA 2PLV3 4HL0A 4Y22B 3SCHA 1WLTA 1F5FA 4YW3A 4AVSA 2DWRA 1W6OA 1H1MA 1JUHA 3ILNA 3PVEA 2H0VA 4P5HA 1AYN1 3AYDA 4YZ4A 4JGZB 4M3CF 2A6VA 5D8AC 1ZRFA 1HRI1 1HDKA 2AH2A 1VB2A 5CU1A 4DY3A 4LO6B 1TNRA 4PF5A 4XFGA 1CAVA 4QQ2A 5I0TA 2PAMA 4RS5B 3E5QA 3DPRA 1W6PA 1RUD1 5CFDC 3MF9A 4P9IA 1Q8PA 5HBAA 4QQHA 3UKVA 3ZSLA 1J58A 1W6QA 2CY6A 3H9AA 3CLPA 3CO2A 5BNPB 3VHNA 1AR83 3NV2A 4RGAA 1PO12 1QQP3 2WNVA 4B4QA 2HEWF 5LRRA 4HVQA 3WDVA 1HRI3 5LEJA 2ZA9A 2QVSB 1QXPA 3QOPA 1DG6A 1OFNA 1QJU2 5I0SA 1G9DA 2D6PA 3RI8A 1GNHA 3WP4A 4QQLA 4DMIA 4XJAA 2VXRA 1QJX3 1HXS1 3D5OA 2ZX2A 1L3JA 5J7MA 2NN8A 1ULEA 4RD7A 4HSLA 4XZPA 4HSJA 1W0PA 1VAKA 1V6IA 4BE3A 1LR5A 3JU9A 4D94A 1QQP1 1DHKB 5K9YA 3AZZA 2A3YA 3JBG1 4JDNA 2CWSA 1LHVA 2HKXA 4RR3C 4CDQB 1ENSA 1UCXA 4FVVA 5CFCC 4N43C 4KU8A 2XLAA 3D0SA 4I30A 3S7IA 1O91A 1SLIA 3B3QE 4XMAA 5IT6A 4IEYA 5HXVA 1LHNA 2ATFA 3KT7A 4KWKA 2W08A 2ZZJA 3TOJA 1BBT2 4KL1A 4P9XA 2E63A 3KT4A 1NCQB 4C1WA 1VBB1 3H50A 5GKAC 2IXCA 2W68A 3Q9OA 1OMIA 5FLIA 1CR7A 4J1XA 3O5SA 4JRLA 5GZDA 1EYBA 2WQ4A 3ZN6B 4RL7A 1QWRA 3PVNA 1XU2A 4B4RA 2ZGPA 3KCCA 4CDQA 1CAUB 4LHKA 1V6MA 2DVAA 1QGLA 4Q4Y2 3ZMOA 1DLLA 1LEDA 3RMYA 4CDUC 2A6ZA 1QJX2 3PTYA 3OY8B 2ZPXA 1QU0A 1GICA 5FPXA 4LO5B 3OF1A 1G9FA 4N43A 1MQTC 5K0UC 1S2KA 4AEDC 3AP9A 2GC3A 1YIPA 1OLQA 4GH4A 2NQYA 1IPJA 3MFAA 3W58A 4U36A 2VW2A 3IPVB 4HLTA 3CL1A 3HT1A 3MIGA 4Q8LA 3ZFEA 4X8NA 4AFCA 3W59A 4P9WA 2DTWA 1SLBA 1OOPB 3I7DA 2XKOA 4GULA 1VBC3 1CPNA 3TNPB 4N53C 4QPGB 4UW5A 4CEYB 3ES1A 3NL1A 2RS51 2A6YA 1PO22 4JC1A 4CTEA 1V6KA 3AP7A 5J09A 1SFNA 4Q4Y3 3FHIB 3K51A 4QPIB 4LO4B 3E97A 1LU1A 2R30A 3FLPA 3P3NA 4ISQA 4BIFA 4AGGA 1OPMA 1KFUL 4I3PA 3THPA 4KH9A 4Y20B 3O12A 1COV2 1A8MA 4XF9A 5FPZA 1DQ4A 2EALA 2PHXA 4E4ZA 5I8YA 1YXWA 2DCTA 1A8DA 3WDXA 5BNOA 3B9IA 1V9U1 5JOXA 1H2MA 1RHI3 1GQGA 1YYNA 2D44A 4XIKA 2ZGKA 3ZIWA 1S0EA 1NLRA 1WLWA 1O3RA 4S2FA 2DTYA 2YMZA 1AR63 4Y24A 3G7DA 1Q56A 3MICA 5I8TA 1RGSA 1W0OA 5C9AC 4DS0A 5AVPA 4YVWC 4OI4A 3WG1A 1JXNA 4DXZA 1LOBA 1IZ3A 1DQ6A 1UKRA 4FOQA 1PGL2 5GZEA 2GNMA 3ENRA 4WM7C 1S0FA 3LKJA 4YZ3A 3O0XA 1RUC2 2RS31 2ZGUA 1OQDA 2JG8C 2E7QA 1W6QB 2YROA 4R4XA 4EWEA 2KXLA 4PDWC 1GQHA 2ZHNA 3LOBA 4R9BA 4Q0QA 1CONA 1LULA 1GFF2 5H9QA 5D1IA 1OD5A 3VBOC 4YW5A 1QOTA 3M7AA 2Z42A 1GANA 1J1TA 4QXKA 1RUG2 1JH5A 1R083 2TBVA 4COZA 1Z0HA 1PK6A 1GZWA 2ES3A 4YLZA 2Q8OA 3B7MA 1ULCA 5CFCB 1Z7S3 4IL7A 2RS33 1T6GC 1SMVA 4IEVA 1QF3A 2IXJA 4OHZA 2W0XA 4XQDA 2BTVC 3WDYA 3VN4A 1NOVA 4DOUA 2OW4A 3AZVA 2WSVA 2ZJCA 4GIQA 4PDWA 3WY6A 5JIAA 4INDA 1HRV3 3NV1A 5L19A 4X6QB 4IEQA 4AVVA 2WFF1 2WS93 2XWJB 4LTAA 2W52A 1POV0 3IMNA 2Q30A 3IIAA 4L99A 4WVMB 4XFCA 1FNZA 1IOAA 4FTBA 1YCIA 1BBT1 1LHOA 1MS3A 3VBOB 3VKLA 4BM8A 3M3QA 1V70A 1UZZA 2G9FA 4BMEA 3ELNA 4AQSA 4IETA 1RJ7A 3ETQA 4X8PA 1D2SA 2R073 4YRDA 1FOD2 2WS91 3MF6A 4S2DA 5LK5A 1FATA 4FPCA 5BY5A 1WGPA 4YYOA 1OA3A 2ZGQA 3GYDA 4NN0A 4C0HA 5CVRA 3SH3A 2WINB 1N1TA 4EN8B 4K21A 4QT6A 3S30A 5JWPA 1ZBE2 3C2UA 1UU4A 2RR12 3DL3A 5HCBA 5JI9A 2YV8A 3VDDB 1TQ5A 1FXZA 2WT2A 3RYRA 5JVVA 1OOPA 3E6DA 5KC5A 4A3XA 2XBO2 2YPJA 3I4IA 4QPGC 4Z07A 1I5ZA 2B45X 1I1EA 2GNDA 4Z8BA 3TYJA 4KQ7A 4YZ5A 2EVXA 1DZTA 1CVNA 3VDDA 4A2UA 5KXBA 3DPRC 1N1VA 2HWD3 1KDMA 5GLZA 1RVF3 1H1AA 1O4ZA 2TEPA 3MLLA 5J3UA 4Z2WA 1HQLA 1UW8A 2C0ZA 5E88A 1VRH3 1I9RA 4MGYE 1QNYA 1RUG3 3LCPA 4AEJA 3M3IA 1PNGA 3H1YA 2D6MA 2HWF1 2ZBJA 5EWSA 4HT1T 4DPNA 1B35B 4Y22A 1C28A 3JD73 4YG6A 4EWDA 2PHWA 1NG0A 2HYKA 1G8WA 1C8M2 3KZ4C 2WNUC 1BJQA 1XU1A 3OGGA 2MHFA 4NHMA 3RI9A 1KXGA 1LOGA 1V6JA 3BCWA 4W6YA 5FO9B 1ZZCA 5T52A 5IK5A 4B7EA 3WVJA 4CDWA 2WZR3 2XVGA 4Y1ZA 2LTNA 1N3QA 4LE4A 1PIV3 2XGXA 4ONUA 4CP2A 1LENA 3WW1A 1ENQA 2JJ6A 5IK4A 2R16A 3KD4A 3ZXGA 4LBNA 4YZ2A 3MW2A