1HRV2

Hrv14/sdz 35-682 complex
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
255
structure length
255
Chain Sequence
b'GYSDRVQQITLGNSTITTQEAANAVVCYAEWPEYLPDVDASDVNKTSKPDTSVCRFYTLDSKTWTTGSKGWCWKLPDALKDMGVFGQNMFFHSLGRSGYTVHVQCNATKFHSGCLLVVVIPEHQLASHEGGNVSVKYTFTHPGERGIDLSSANEVGGPVKDVLYNMNGTLLGNLLIFPHQFINLRTNNTATIVIPYINSVPIDSMTRHNNVSLMVIPIAPLTVPTGATPSLPITVTIAPMCTEFSGIRSKSIVPQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN RHINOVIRUS 14 COAT PROTEIN (SUBUNIT VP1)
publication title SDZ 35-682, a new picornavirus capsid-binding agent with potent antiviral activity.
pubmed doi rcsb
source organism Human rhinovirus 14
molecule tags Virus
total genus 47
structure length 255
sequence length 255
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1995-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1hrv200
1AR82 3CJIC 4GB31 4WM7C 3DPRC 4N43B 1NCQB 5AC91 1MQTB 5J96B 3JD73 4CDWC 5ABJB 1FPN1 5BNNA 1HRI2 4RS5C 4QPGB 1VRH3 4AEDB 3NAPA 2HWB2 1K5MA 2RM21 1RUF1 1RUH3 2ZAHA 2HWE1 1NA1B 1MQTA 1ND2A 2MEV3 1VBE3 1VBD3 4GH4C 1D4M1 4CDXA 1VRH2 1H8TC 3ZFEB 4CEWC 3VDDC 3VBOC 4NWWA 4Q4W3 1RUH2 1TMF3 2RS31 4IV3C 1NCRB 3VBUA 4GMP1 2MEV2 2X5IB 1TME2 1NY72 3ZFGC 1AR63 4QPIA 3CJIB 4WM7B 1VAKA 1V9U3 5A32B 3DPRB 3JB4C 2BUKA 5BNOC 1HXS1 4CDWB 2HWC3 4RR3C 4RS5B 5C4WA 1PO22 3VBRA 4CEYC 2GSYA 4RHV2 1TMF2 3ZXAC 1ZBE2 1HRV1 1AL21 1RVF3 2DF7A 5CFDA 3TN92 1V9U2 5CFCA 1RUE1 2RMU3 5LK7B 1F8VA 1AYN2 4JGZA 5D8AA 4GH4B 2WS91 2RR11 4Q4Y3 3ZFFA 1H8TB 2HWD2 2RS53 4CEWB 4Y4YA 1R091 4CDQA 4Q4X2 1RVF2 3VBOB 1FOD1 1PIV1 1COV2 4RQPC 1MEC2 2RMU2 5K0UC 1AYM3 3VBSC 3ZFGB 1RUI2 1POV1 1VBC3 1K5MC 4Q4Y2 1QJU1 5BNOB 1HRI1 2R043 4RR3B 4N53A 5FMOL 2HWB1 1EV11 2PLV3 4CEYB 1QJY3 1RUG2 4PDWC 1BEV3 2BFUS 2R073 1PO13 3VBFC 1AYM2 1ZBA3 1C8M3 2XPJA 5J98B 4RFT0 2RS13 2R042 1RHI2 5JZGC 1VRH1 5BNPC 1NOVA 5FOJB 2PLV2 2R072 4CDUC 3FBMA 1PVC3 1ZBA2 1X33A 1IHMA 1RUJ2 4RQPB 2MEV1 4IV1C 1TME1 1NY71 4YVWC 5K0UB 3VBSB 4EJRA 4JGYC 5C9AB 1QQP3 1RUC3 1VBC2 1PO21 1SMVA 5C8CC 2FZ1A 4RHV1 1PVC2 1AR91 1A6CA 1ND3C 1NCQA 1VBA3 4N43A 3JD72 1BMV2 2R063 1OOPC 1ZBE1 4Q4V3 5D8AC 5ABJA 1RMU3 1QJX1 1R083 3TN91 3VBFB 5L7OB 2GH8A 3LOBA 4QPGA 2XBO3 2WZR3 2VQ0A 1Z7S3 1AYN1 1VB4A 1AR71 5DDJ3 4AEDA 1RUC2 1FMD1 1ASJ3 4FTBA 3JBG3 4GB33 5JZGB 5BNPB 2HWD1 5AC93 1RUD3 2FZ2A 2R062 4WM8C 1NA1A 4FSJA 4Q4V2 1VBE2 1M06G 1FPN3 1VBD2 1VBB1 1CD3G 4Q4X1 3M8LA 1R082 1COV1 2TBVA 1MEC1 2RMU1 2XBO2 1Z7S2 4YVSC 5DDJ2 3ZFEA 1ASJ2 4IV1B 4YVWB 1W39A 1RUI1 2WFF1 1RUF3 4JGYB 4Q4W2 4Q4Y1 1EAH3 2HWF1 1PGL1 1R1A1 5AC92 1RUD2 1NCRA 4BCUA 2HWE3 4LLFA 2X5IA 1AR62 4SBVA 5C8CB 1HQNA 1D4M3 3CJIA 1RUG1 4WM7A 5A33B 5A32A 3DPRA 1AL0G 1ND3B 1B35C 4FTEA 1OOPB 2HWC2 3VBHC 4CDWA 1NG0A 4RS5A 2RS33 1EAH2 2R041 2WLPA 1RHI1 4GMP3 3VDDB 2QQPA 1D4M2 3HAGA 4IV3B 5BNNC 1AR81 4WM8B 1HXS3 3NAPC 4Y5Z0 1RUJ1 4GH4A 2RS52 1H8TA 2RS32 4YVSB 4CEWA 1HRV3 1AL23 4N43C 1MQTC 1ND2C 2ZZQA 1VBC1 3VBOA 1RUE3 4IV3A 4CDXC 1PGW2 1PVC1 3ZFGA 3JD71 3J8F3 2WS93 2RR13 1B35B 5BNOA 3VBHB 2Y26A 1R093 4RR3A 3VBUC 1AL22 1QJY2 1FOD3 4CEYA 1BEV2 4QPIC 1RUE2 1PO12 1BBT3 1RUH1 3S6PA 1C8M2 1POV3 3J8F2 2WS92 4Q4V1 5BNNB 2RR12 1VBE1 2RS12 1VBD1 5C4WC 3VBRC 1QJU3 5GKAC 1HRI3 1GFF2 1R092 3NAPB 1Z7S1 1K5MB 1EV13 1FOD2 5ACA3 5CFCC 5CFDC 4Q4W1 1BBT2 1TMF1 1VB2A 4JGZC 1ND2B 1RUD1 4PDWB 4RQPA 1AR61 2WWSA 4CDXB 1QJU2 1V9U1 5K0UA 3ZFFC 3VBSA 5C9AA 1QQP2 2HWC1 1EV12 4CDQC 5ACA2 1OHFA 1RB8G 1QJZA 1EAH1 3VBUB 1VBA2 2BFUL 4QPIB 1TME3 4PDWA 1RMU2 1RVF1 4CDUB 3VBFA 5L7OA 2WZR2 4N53C 3JBG2 5C4WB 3VBRB 2RM23 1PO23 4GB32 5FMOS 5JZGA 2RS51 4RHV3 5BNPA 1AR93 1ZBE3 1FPN2 5CFCB 5CFDB 1QJX3 3TN93 4CDUA 4JGZB 2ZTNA 1AYN3 1AR73 5D8AB 1AYM1 1FMD3 1PGW1 4IV1A 1OPOA 4YVWA 2RM22 3ZFFB 1RUF2 4JGYA 2HWD3 1HX6A 1AR92 2HWE2 4CDQB 4NWVA 1CJDA 1VBB3 2PLV1 4Q4X3 2BBVA 1QJY1 5C8CA 1QJX2 1COV3 1BEV1 5A33A 2R071 1MEC3 1PO11 4Z92B 1ND3A 4GMP0 1AR72 1DDLA 1FMD2 1ZBA1 1OOPA 1F2NA 1C8M1 4FTSA 1RUI3 2BPA2 3J8F1 2WFF3 2RS11 1C8NA 2HWF3 1X36A 1R1A3 4N53B 1NCQC 1AUYA 3VDDA 1VBB2 1RUG3 5ABJC 3IDEA 1HXS2 1BBT1 4WM8A 4QPGC 5C9AC 1BMV1 1WCDJ 4AEDC 2IZWA 2WFF2 1PGL2 2HWF2 1R1A2 1RHI3 4YVSA 1HRV2 3JB8A 1QQP1 1RUC1 1E57A 1NA1C 1PIV3 5ACA1 1AR83 5L7OC 1VBA1 2R061 3ZFEC 1RUJ3 1RMU1 1R081 1B35A 2XBO1 2WZR1 3VBHA 1POV0 1NCRC 2HWB3 5DDJ1 1ASJ1 3JBG1 1PIV2 2X5IC
chains in the Genus database with same CATH superfamily
3OBZA 2JE8A 1IZ3A 3IMNA 1QNYA 3CJIC 3KV6A 3P3NA 4XF3A 3BPSA 5LA9A 4D94A 4UI9L 4CU6A 2D5FA 4N43B 3VN4A 5AC91 2DVDA 5EQUA 3ELNA 1UXXX 4IE7A 2ZX4A 3AMMA 3MDPA 2K46A 3H1YA 2Q8DA 3WG2A 5BNNA 4RS5C 2VNVA 4BM8A 3UKVA 4BHPA 4KWJA 5A7NA 2FDGA 3HPNA 2AGSA 4AR2A 4DNYA 1HV0A 3ECQA 3WINE 5LCWL 5DZFA 3KLSA 1BHGA 2G9GA 1SCRA 1CAUB 4QGMA 2X8KA 5HCAA 2BTVC 3TEYA 2WT2A 3PU3A 3ZX7A 2B4KA 4DY5A 1GUIA 3I59A 5F2SA 4GH4C 1D4M1 1WLTA 1AX0A 1VRH2 3ALQA 4KWUA 3S7IA 4Q8LA 1MS1A 2W46A 3AP7A 2NP0A 1W3VA 1YQ6A 5HBAA 2BVVA 4CEWC 1Q8PA 1DFQA 2WQ8A 1G9DA 4YM2A 4JVAA 4S2DA 2Y6JA 3VBOC 5LWBA 4NWWA 3N7JA 1RUH2 1ENQA 2WDBA 3HT1A 1OA4A 1EPWA 1NY72 1O4YA 2XUEA 2WA4A 1W8WA 4YZ1A 2YFUA 1VAKA 2YYOA 5FZ4A 3BTYA 2YUEA 3H0OA 4JHTA 5A32B 2AEYA 3AKTA 1XC6A 2ZACA 3PHMA 4ZXKA 3POYA 5IHRA 1M4WA 2OPWA 4XIKA 4CDWB 3LF7A 1Y3TA 4QXHA 5IVCA 4QX8A 4DEVA 4Z2AA 1QY4A 1QOTA 3MF6A 4RHV2 4RFRB 3ETPA 1F4HA 2Q8OA 5FP8A 3AM2A 1MPXA 4CP9A 4YG0A 3ITQA 3HQUA 3D82A 4RSUA 2D3RA 4W65A 3WHUA 1YI9A 4E4ZA 1G9CA 1LU2A 1O5LA 1UX6A 3HR9A 4IE4A 4V1PA 5DG2A 4KI5M 4D0QA 1V9U2 2EAAA 3AZYA 5L36A 2RMU3 3POGA 2R0FA 4FQZA 2R1BA 4JGZA 1TZOA 4YW4A 1H2MA 5FRAA 3OEBA 2VTFA 4Q0VA 1FYUA 5DXDA 5A3MA 4AVBA 3MIEA 5A6ZA 3QH7A 2FCVA 4W4ZA 1LKNA 1VAMA 5A6QA 3K77A 2RR11 4Y20B 1H8TB 2ARXA 4GZ9A 3WSOA 3LAGA 2WAAA 3EXUA 3C3VA 2H0VA 4Y4YA 5IT6A 5FFOC 1W6NA 3SH5A 1QXJA 1WW5A 4IEYA 2WAOA 1JZ8A 4AG4A 5CAZA 2DVBA 2R32A 3R6SA 4HMZA 2AUYA 5K0UC 1ZZ7A 2PHFA 3CZJA 2FDFA 4OYUA 4HANA 1RUI2 1POV1 2ZEXA 3GHMA 4JQTA 3D0JA 1J3RA 1K5MC 3MO4A 5BNOB 1WLWA 3K4AA 5FIXA 4N53A 2XVGA 2ETEA 1U5XA 3U14A 4CU8A 2PLV3 1QJY3 1RUG2 4LKSA 4ONUA 5A1LA 2WLQA 2IXLA 2R073 2XJVA 3M1HA 1QOOA 3MUZ1 1DQ1A 2OQ6A 3ZKYA 1PO13 3VDCA 4LO5B 1O59A 1AXYA 1AYM2 3THTA 1Q3EA 1T2XA 1HB3A 3IT8A 4E2SA 4DOUA 2XPJA 1IOAA 2FHRA 5C5TA 3I2IA 1IS4A 1Y9GA 4AF9A 4L99A 3I2OA 4XJAA 2R042 2ORZA 2DCKA 1CZSA 3DUIA 3H8UA 5JZGC 2UWBA 2ARAA 5E1RA 4NN0A 3USUA 3UV9A 4FOVA 3RDIA 1Y9QA 5LA1A 1MS4A 2DUPA 4R8HA 4OMCA 1CAWA 1KXGA 5FPBA 5T5OA 2LALA 1PVXA 3WW2A 3J7LA 1SLBA 4CDUC 2GC3A 4EZ4A 1UOFA 4M4PA 1OD3A 1SDDB 4YFZA 2CAUA 1RUJ2 2MEV1 4ZU7A 1FNYA 4WZFA 4V2WA 4YVWC 1QWRA 2LUWA 4UWDA 5I0UA 4UBHA 3UETA 2ZOEB 1IPKA 3BIEA 3L2HA 5L9VA 1LNSA 1AXKA 5FYMA 1ZA7A 4MGYE 2JG9A 5IK7A 3T09A 3X29B 3DF0A 4WVMB 4CCKA 4PI2A 4PIYA 1KFXL 1SLLA 4PLMA 5JDBA 1S0CA 3K4DA 2ADEA 1X7NA 5A7WB 3UL2A 2FZ1A 1FV2A 1APNA 1ZREA 2XHNA 1AR91 1A6CA 1VBA3 2WNUC 3NKGA 1BMV2 3M70A 1LHVA 3AP6A 1OOPC 4LORA 2ZHMA 3ZYIB 5ABJA 1OBNA 2WO7A 5LY2A 1VPHA 3VBFB 4BK4A 3WR0A 2JDAA 2GH8A 2VZ1A 1JMUB 3W20A 4ATFA 1AYN1 2Z4FA 4XDOA 3RG0A 4KNCA 1FMD1 4CCMA 2OUJA 1LOCA 4GULA 3GM8A 5F5IA 1BK1A 4K6BA 3SLIA 5GZGA 3WG3A 4GB33 1OD5A 5BNPB 1OA2A 4KBBA 5A7WA 3NJZA 4CSWA 2F17A 3I2DA 2VE1A 2R062 4WM8C 1RUOA 4Q4V2 1TE1B 3IIIA 4PBPA 1M06G 1VBD2 1VBB1 3RZGA 3N3HA 5FZKA 2E53A 4MHUA 1PMIA 4M0HA 2VAUA 4LBMA 4YVSC 1D0HA 2XWJB 4IE6A 2VGDA 1ASJ2 4DXRA 5JWPA 1JZ2A 4K1YA 1F9KA 1HN1A 1SEFA 2FMYA 5E88A 3KB5A 4JGYB 4AK3A 4Q4Y1 5LZ6A 2ZGKA 5FUPA 5FYIA 1R1A1 4H7MA 4A2UA 1UYZA 2VBDA 4ES9A 1NCRA 1H4HA 3MLKA 4GWJA 4I01A 2X5IA 2VM9A 5FPAA 1HQNA 4AFCA 2K0GA 4JRAA 5F5AA 2ET7A 1GOGA 1UAIA 1XSRA 2RDRA 2WR9A 1QGLA 1AL0G 3DPRA 4JKMA 1ND3B 4AVTA 4EN6B 4FTEA 2HWC2 5E89A 4S2GA 2DCYA 2O8QA 2Y0IA 4OUMA 3PUSA 2JB8A 4UF0A 1W9FA 2UY8A 2FD8A 3RJ2X 4UYBA 2K9ZA 5F32A 1U12A 3CQOA 3N9OA 5CKQA 5HCBA 1PMJX 2AACA 1BJQA 3MHZA 5KC5A 1JU3A 2VR4A 3I49A 1JOBA 1MZFA 3TNQA 2QFEA 4IV3B 1CESA 5T50A 5GLTA 3THPA 3S57A 4JCKA 3UESA 5BNNC 1PNGA 1ZRRA 3BKZA 1BKZA 2CAVA 3ZYHA 3H7YA 5FDBA 4NHKA 4FPJA 3KQ4B 4G3YC 4KGGA 3ZPYA 1KITA 1G6NA 1W3XA 5F5QA 2HH9A 2E32A 3DV8A 2RS52 3POSA 3VKLA 4C8DA 2RS32 3IPVB 4A42A 4LHLA 3NRUA 5HCFA 4FI9A 2IXJA 3WDYA 3BPZA 2VNOA 4FPKA 4Y33A 4QX2A 3UNPA 1AL23 4N43C 1GP6A 4E2GA 1WMFA 1VP6A 2PTMA 1S2EA 4K9SA 1RUE3 4AI1A 4IV3A 4FOQA 3MW4A 3AKQA 5F3EA 5LRSA 3L2YA 3ZYBA 1PGW2 3BVCA 3I3MA 1QU0A 3IDBB 4AVAA 4MXWB 3LOIA 1QXRA 5HCHA 3J8F3 3ZM8A 2C9KA 1A34A 4RA0A 5FV3A 2ZGLA 2JKBA 2NZ9A 3IBMA 1B35B 1CZVA 1XYOA 1KS4A 1OLQA 2QQIA 5C70A 3PTYA 1NYWA 2Y26A 1R093 1UKGA 1O5UA 3W21A 1ZRDA 4JRLA 1XNKA 2W95A 5L19A 1P8JA 1GSLA 4CEYA 1V0AA 1BEV2 1ST8A 4D6RA 1WA6X 2W1QA 3A0NA 4FPOB 1RUH1 2GNTA 2W87A 1C8M2 1KJLA 2B8MA 2X05A 5A7SA 3JZVA 4P9GA 3GHNA 1CZTA 2IXCA 4AGRA 1DZRA 2LW8A 2WS92 5GALA 1VBE1 1UZVA 3NJYA 4XFAA 5FPLA 3MFAA 4OLLA 3NV1A 4N9HA 4BB3A 3NAPB 3WNMA 2MHFA 4NRQA 4OHVA 5FLIA 2Z79A 1V6JA 4COYA 2YC2A 4L2NA 4LOTA 2ZBJA 3KHBA 3FFQA 3B9IA 4JGZC 4QU1A 4OQ9A 1RUD1 1EUUA 1YYNA 4AOCA 4HK9A 5EYXA 3OGGA 3LDKA 3M2MA 2PHUA 4P9IA 2JENA 1CIYA 1ZRIA 1MZEA 1QJU2 1V9U1 3SKJE 3UK9A 4A44A 3WNLA 3VBSA 5FJKA 4W6WA 2Y8KA 1Y7BA 3NNLA 5A3OA 2BJSA 2HLEA 3POFA 2QQMA 3WW3A 3VD5A 4EN0A 1DYKA 5ACA2 3RMXA 3B94A 1F31A 1DP0A 1QJZA 4K1ZA 1EAH1 4X8NA 3VBUB 5I93A 1FT9A 2BFUL 3GNEA 4NIDA 4MV2A 4LKDA 4Z8BA 2W39A 1RMU2 1WMEA 3WQBA 5FR3A 2OZ6A 5DUVA 4AFDA 2YG0A 5B4NA 1UOJA 1V00A 3OTFA 4N53C 2XXZA 1JBCA 5DUUA 1Q5OA 1UYYA 5IVYA 4JKKA 3SCFA 1ULPA 4QQPA 3D4KA 5LEJA 2PHWA 4RHV3 4DUWA 3OYWB 1WD4A 1YQCA 4HN0A 3WX5A 5EP9A 4IDZA 3RZKA 3LGRA 3LCPA 2OYZA 1YQ2A 5C3PA 5CFCB 3B5LB 3S0MA 3AVRA 1QJX3 1XNDA 3KV5A 5KXBA 2AEZA 4H2AA 4RGAA 1ACCA 4LBQB 2DVGA 3VGIA 3GALA 5I0SA 4BK5A 1CGPA 1AYM1 1N3OA 2A7AA 5SV8A 2ZZJA 3NO8A 1GQHA 1J83A 1W8NA 2Y64A 3H9AA 3PDQA 1NLSA 1NX9A 2XKOA 5FZIA 1D0GA 1GWMA 4HL0A 5KWRA 1XJAA 1ZA4A 2O1QA 1JYIA 2ZKNA 1CJDA 2HEWF 3M3CA 4AAPA 1GLHA 2XJUA 4Q27A 5EJ3A 4BQ3A 4QX0A 4OZOA 1WCUA 4BQWA 5FXWA 1Z0HA 2Z42A 1AR72 4GMP0 4C0BA 3H7JA 1W6PA 2VY0A 2JG9C 1KJRA 4IEWA 1RUI3 4C1WA 4W6YA 4R9CA 1G9AA 2RS11 1C8NA 3IM0A 4AQSA 3T1MA 4GAZA 1UWWA 4EV0A 4F83A 4AQTA 1C1FA 2BQPA 3HEIA 3LEMA 2WT1A 4HKOA 4HN1A 4K20A 3B02A 2BOJA 4L0PA 1QXPA 1RUG3 4KWKA 1W9YA 3IDEA 4FPCA 4XXPA 3KT1A 5FK7A 2AH2A 2BNMA 3WG1A 2DCJA 1UW8A 3NQHA 4XF4A 1WMDA 1W6MA 5A6XA 2VW2A 3AZVA 2J1AA 2GN3A 2DBIA 5HI0A 1BMV1 2J42A 2IZWA 2VULA 1PMHX 5FXXA 2C4XA 2JEMA 3VLBB 2WFF2 1NLQA 4M3CF 3ZSKA 3O1VA 1GWLA 3QOPA 3WHTA 5EZWA 4CVUA 3HBKA 3V0AB 1W0NA 2JDKA 4XCAA 4YW1A 3K75B 3PLQA 1TVGA 3WW1A 5FPXA 3JB8A 1QQP1 4ZU5A 2JDZA 2ZHLA 1ULDA 5A3LA 1NKGA 2DBNA 3AMNA 5JOZA 3K2OA 2YC0A 3ZKUA 3GZUC 1ZRCA 3ZLIA 4Z07A 2P17A 4O7XA 2VMHA 2R061 5T5PA 3V64A 5C8WA 1JOJA 1RUJ3 2JIJA 1GYKA 3AZXA 1PIV2 1RXFA 5DPNA 3V0AA 4XQWA 4Y1XA 2WZR1 3VBHA 3WVJA 2HWB3 1NCRC 2GDFA 5FXVA 1ASJ1 5A7QA 2X5IC 5T55A 4BWOA 4OHYA 2WQ4A 1AR82 2CV6A 3HNBM 3RYKA 5JCTA 3DPRC 5J96B 2QKDA 3E97A 1GQGA 2BERA 5GZCA 4BYYA 1LHWA 3AXEA 4CP2A 1FPN1 5FZLA 3RI8A 1DCSA 1GICA 3I2KA 4N7UA 3KF3A 4AEDB 1JZ4A 2JG8B 2A6ZA 4KGQA 1O8SA 1K5MA 2W47A 5DAVA 2CDPA 4YGCA 3SNMA 3LE0A 4PLNA 2VZVA 2AC1A 3NSTA 1WW7A 4OQ8A 1OXCA 2HEVF 2JIGA 2ZEZA 1RUF1 4IETA 3AP4A 2CDOA 5GZEA 5C3QA 2EICA 3R05A 2KM2A 4Z1VA 3IAQA 4BQXA 2CWMA 2ZAHA 5HXVA 1K12A 4XTMA 4A6SA 2VCAA 2VBPA 5FYCA 2VPVA 2W92A 4HXCA 1VBD3 1CAXA 4AVCA 1L7LA 3EO6A 3BOPA 5EWSA 3ZXDA 5CU1A 3O1UA 5DUXA 3ZFEB 1SPPB 1NZIA 2BGCA 4Y22A 4A6OA 4OVEA 4NJ4A 5I8SA 2QQWA 4H55A 4HBNA 2N7GA 4BPZA 3SCHA 1W8TA 1S0JA 2RS31 4IV3C 3AK0A 3J7MA 4IEQA 1PK6A 3ACLA 2R1DA 4GMP1 2MEV2 3WDTA 3ZDVA 1O3SA 4PIXA 1DQ4A 4QPIA 2WIIB 4GJZA 1L3JA 4WM7B 4BZ4A 5T5JA 5CIRA 1GU3A 4I02A 2DCZA 3DEMA 2A71A 1JTZX 4IEPA 4Q26A 4CYDA 3PIGA 1HXS1 1NT0A 3HBZA 3HT2A 4IL7A 2WT0A 2HWC3 3O12A 4XUTA 2D6LX 4MZUA 2Y60A 1FI2A 3Q8CA 5IAVA 3VBRA 4JAAA 4CEYC 2GSYA 3QACA 4E8DA 5JXIA 2PXJA 1OMIA 1TMF2 1ULOA 1G86A 2AENA 2WNVA 1XE8A 4IE5A 2DWRA 4KQ7A 5FZGA 2LROA 2WO2A 4BLIA 2DF7A 2Y6HA 5CFDA 2BBAA 1RC6A 3TWIA 3PJQA 5FY7A 1JZ3A 1ZZ8A 5JOWA 1AYN2 3ZXEA 2PELA 3RSJA 1HDKA 1VJ2A 2ZS6B 4UT5A 3MZHA 5M0TA 2WS91 5H9PA 3OGRA 5SV5A 3TAYA 3ZFFA 1VALA 1WUVA 3VHPA 2RS53 4AEMA 2EIEA 1VIWB 2ZMLA 4A4AA 3N36A 2VTXJ 2D6NA 5CEHA 1XNAA 4XFHA 3WF4A 4MXVA 2IFWA 4OMDA 4P02B 2JJ6A 1UIJA 1W2AX 2RVAA 1RVF2 1YCIA 4P9LA 4COWA 4MVTA 4XBNA 1WW6A 3ACIA 5DN2A 5IK8A 2P37A 5FMDA 4E4SA 3VBSC 3ZFGB 2CHHA 3AYEA 1E5HA 2VNGA 5APAA 5FZHA 3RJRA 4Q4Y2 4C0HA 3H42B 5A3UA 3C2UA 1QJU1 1CWPA 2J22A 2OZJA 4Q0UA 3WF2A 1YJLA 2UU8A 4RR3B 2CY6A 3OGSA 4K21A 3IDAA 2LRPA 5IW0A 3N35A 5FMOL 3D6EA 4Q1RA 2C6SA 3VKOA 3KCCA 5FREA 5J09A 1FV3A 1BEV3 4LKFA 1I1EA 4LO4B 1I5PA 1UYPA 4CZSA 3BB6A 2F6BA 3JQXA 5AFBA 3U10A 1C8M3 5FZ3A 4FAGA 4QQOA 3SISA 5L73A 5DAPA 1V70A 3N9PA 4XTPA 2TEPA 3VDAA 4FPEA 3T08A 1W8UA 4XQ4A 1HKDA 2HBUA 2W1SA 5FYBA 4TLGA 1JZ7A 1YUDA 1OVPA 2ZGQA 2VOWA 3BI3A 4QHOA 1G8WA 2B5HA 2R7EB 3WQ7A 1W8HA 1ZZCA 2D44A 4MX3A 1JYXA 3DYMA 3DL3A 1XNCA 1UXZA 4QXCA 4TLFA 1BZWA 5T52A 3H3UA 1JU4A 3AMPA 3FBMA 3A4UA 1PVC3 1ZBA2 2WWUA 4LA2A 4PHZA 2Q8EA 2WBKA 3NNJA 4RQPB 1UX7A 2WN2A 1OQDA 2A1XA 1NE4A 1TME1 3GZAA 2BVBA 1C4RA 3SHRA 1REEA 3OY8B 1UZWA 3KV9A 2YU2A 5DABA 4UFHA 1CAVB 4URTA 2NMNA 3B01A 4IEUA 1UMIA 2VZRA 5BXXA 1A8MA 3NV4A 2WNOA 4HONA 4IGQA 1UPSA 4IUGA 4DFSA 1ULGA 3POBA 3PURA 4JHZA 3AFGA 2WSVA 3ATGA 4N43A 1OQ1A 3SH3A 1H8VA 2QCSB 2W08A 3JXSA 4CCCA 4KU8A 4Y5TA 1RMU3 2VZTA 4LXLA 4NAMA 4MH0E 5F39A 4E27A 3I7DA 4O9GA 5JXJA 2QDRA 3VL8A 3LOBA 1CVNA 2XBO3 3A22A 4ZKTB 1Z7S3 1VB4A 3GZTB 1AR71 1V6OA 1NXD1 2VO5A 1RUC2 2ZXQA 5DDJ3 3U11A 4B4PA 2BGPA 3SC7X 2IC1A 1K3IA 1Q8QA 2WABA 3HNYM 1CAUA 4UW4A 4YWAA 2J1RA 2OQ7A 3SQOA 3KVBA 1YEWA 4NHXA 5AC93 5FBJA 4CE8A 4MGSA 4AVSA 3WNXA 4W50A 2I2SA 2XL7A 5LATA 4KBZA 4Q0QA 1VBE2 1LOFA 2ZX2A 4W8JA 3WXPA 4Q4X1 4XFCA 2OKXA 1R082 3NW4A 4OI1A 5G05L 2RMU1 4XACA 1IS6A 1ENSA 2PAMA 4IV1B 3I2FA 3IDCB 1OVSA 2WFF1 3U4SA 1UN1A 3HMYA 3CLPA 3RYPA 5A70A 2JXAA 4TYSA 4LULA 4UOJA 5DQ0A 4XFFA 1RUD2 2Q30A 4LITA 3OUIA 4BQ5A 4LLFA 3CF6E 4ATEA 2WZ8A 4DY3A 5C8CB 2ZGNA 1D4M3 1IPSA 2WQZC 5A32A 4MO3M 4QAWA 5FY5A 1MS8A 4X6QB 5CKMA 1OQEA 1WMXA 2JX9A 1L7RA 4LBJA 1SCSA 3VBHC 4CDWA 1AVBA 5BYNA 1O3TA 2EXIA 2PYTA 2D6MA 1NG0A 1GMMA 3BIWE 2QQUA 1IS5A 1AJOA 1EAH2 1D7PM 3HVDA 1OC1A 1RHI1 1UOBA 4JQRA 5IVVA 3S30A 4H3WA 1GWKA 2FCUA 4AFBA 1VE0A 5A1FA 4CXYA 2J1TA 5FPVA 4YM3A 4DIQA 4JDOA 1WA4A 5IVEA 4DXSA 1C28A 2IWGB 2VVFA 1AR81 1BYHA 2VCMA 4KWLA 1IG3A 2YMZA 5EPAA 2PHXA 1E5RA 3CIHA 4XETA 5JAXA 2VXJA 2GN7A 1QOSA 3LA7A 3ES4A 4Y20A 1H8TA 5CKNA 1A78A 4Q0PA 3MIGA 4HETA 3RZLA 5DMYA 2VECA 3J7NA 2OVUA 4IE0A 2ZZQA 4JDNA 3F95A 2DFCA 3AFKA 4F7ZA 1LAJA 2YBSA 4LBNA 1S0FA 2Q5TA 1DF0A 5IVJA 1H2KA 3JD71 3HOBA 1V6NA 2RR13 1O3QA 2W5FA 3TEZA 1YFUA 3MI8A 3I3QA 4IGPA 1IQDC 3HD8B 4CUBA 2XJSA 3WY6A 5BNOA 3I2JA 4DUXA 1NQDA 1OKQA 2E31A 3T2PA 5GLVA 1PK6C 4EWAA 1W6OB 3SEPA 3G7DA 3ACFA 4QPIC 5T54A 2D40A 3BTAA 1HJFA 2E7TA 3S5QA 1GZWB 4I3PA 1BBT3 3DYOA 3T0BA 3S6PA 5LW9A 4S2FA 3SCGA 1POV3 4M4RA 2ZGUA 1YRZA 3ME2A 2RS12 3QLQA 3VBRC 4PF5A 5FK8A 4DRVA 1GFF2 4LBKA 4AQ6A 3VD7A 5HXMA 1DIWA 4IGOA 5F3CA 4XC9A 3GZEA 2WNVC 2RE9A 3GJBA 1SDWA 1FOD2 2V4AA 1W6OA 4I2OA 4AI8A 1HJGA 2YY1A 1JZ5A 1K45A 5CFDC 2C9AA 2EVXA 2XQRA 5FKBA 4Q4W1 5JR2A 3TEWA 4TTGA 1TMF1 1N3QA 1O8PA 4JTOA 3KV4A 1JHJA 3OGVA 1ND2B 2HEYF 2Y38A 1YWKA 3P6BA 4PDWB 4BU2A 4P9WA 1AR61 3M3OA 4QU2A 4CDXB 4AAXA 1H9PA 3ZFFC 2JD9A 4HLTA 5JXHA 3I8TA 1JYVA 1XRUA 3I3EA 1QQP2 5EIYB 4YG3A 1EV12 4XEZA 4WVMA 4EE2A 2C26A 3MV11 3NL1A 1H1MA 1OHFA 1X50A 4A45A 3AVSA 2P5BA 3ENRA 3WDVA 3VKMA 3WT3A 5FZ9A 2RJKA 2ZMNA 1UZYA 2DTYA 4DEQA 5B2GB 3LDBA 1VMFA 3QCWA 4PDWA 1RVF1 2Y34A 3DCQA 4B7EA 4LBOA 2ET1A 2W1WA 2ZGOA 1LULA 3VBFA 2WZR2 3PVNA 1I9RA 2ID4A 3T1LA 4FAHA 2FMDA 2EIDA 1LOBA 1HV1A 4XFBA 5JOXA 5LA2A 2ZEWA 3T30A 4CXXA 1PX3A 5C4WB 1ULFA 2RM23 4Y1VA 3MUY1 1S1AA 2A3YA 3PMEA 4PQ9A 2W52A 5FZCA 5BNPA 1AR93 2QQJA 1LCLA 3VZOA 2Y6LA 4LO6B 1J3PA 4FO9A 1QH7A 1FPN2 1JYWA 3WDWA 2XVLA 1OUSA 1MZ5A 4CCDA 5T3NA 1CX1A 4QM9A 3MFCA 3MLJA 4FFFA 1AYN3 2RV9A 5D8AB 1RYYA 3Q8BA 1FMD3 1OFNA 3U0ZA 2OXBA 1TNFA 4URAA 4M0NA 4EWDA 2BV4A 2VD7A 3KVAA 4HZFA 1RUF2 4LLOA 1AXZA 3ZYJB 3POEA 4JGYA 2EIBA 4KMQA 3KCXA 2NYYA 4L8QA 5K7PA 2WKKA 4CDQB 1J59A 3I2HA 4NWVA 4AFMA 1VBB3 4J25A 3VD9A 4OFGA 2YC4A 2W9XA 4XF0A 1ND3A 1STMA 3M3EA 4Y26A 1DDLA 1ZBA1 1F2NA 4PQQA 3KD4A 2YROA 1D2SA 3OJBA 4NUBA 3EMRA 3KSCA 3RQ0A 3J8F1 5CVRA 3PVOA 4OI2A 3SXWA 3FWEA 1X36A 1EYBA 1R1A3 1GZCA 2YU1A 4FPLA 4HVRA 4TN7A 4DS0A 1WGPA 1V6KA 2VH9A 1TQ5A 4XZUG 3MLLA 3VDBA 4WV8A 1O4TA 1H4GA 4ARYA 2RJLA 4QKBA 4XFIA 1HXS2 4NR1A 2KXLA 1V6MA 3DN7A 1NAEA 3A7QA 4INDA 4XCBA 4YLZA 5L9BA 4YW5A 5K8SA 1DG6A 4JV4A 5FPZA 3B00A 5FYZA 3E5UA 2ZA9A 4UFLA 3B7MA 3KS7A 1XSQA 1H2LA 1YIPA 3WUCA 4WZCA 1PGL2 2HWF2 3B69A 2VZUA 4QD2A 3IPVA 4IXLA 1VRBA 2QJVA 3MW2A 1NZCA 4WBBA 3UGFA 3HQXA 1RUC1 2ES3A 4LE4A 4CA9A 4JKLA 1PIV3 3PUIA 5EYYA 1IPJA 1LOFC 1T6GC 1ULEA 2D5HA 3LDRA 5JUVA 2VMEA 1JUHA 4WVZA 4MXWA 3ZXFA 4Z82A 1O4ZA 5BPXA 4BMEA 1I5ZA 2UWCA 3KGLA 5DAWA 1H30A 1R081 1B35A 2UYBA 5IAXA 1AZDA 2YBKA 5FZ1A 4NIIA 4XMIA 5LA0A 5DG1A 1LJ7A 1H1IA 1PM7A 4W6XA 4BXFA 4LMFA 4B3NA 3JBG1 4JC1A 4QM8A 4RGGA 1DU3D 5LBCA 4B29A 2YGLA 2CYFA 1LB2A 3O0VA 1VLNA 4AI9A 4YW2A 1S0EA 2H6CA 5FYVA 2C0ZA 3CL1A 3ZN5A 1NCQB 1MQTB 4NPRA 5LRRA 3H1MA 4ZXEA 5FZAA 3WV6A 3O1TA 3ZN4A 2CU5A 4CDWC 1ZRFA 3PTRB 1AF9A 3GYDA 1W6QB 3NWKA 4LJHA 1MVEA 4D3WA 5LEKA 4QPGB 1VRH3 5H9SA 1IS3A 1N1VA 1GOFA 4XJZA 3NAPA 2VW0A 5A1AA 2YXSA 1KGYA 4BH9A 5LY1A 4GXLA 4NROA 5FYTA 3IMMA 3O1OA 1H6XA 4FFIA 1RUH3 4OI0A 4TXWA 4DXZA 4YM1A 1SLCA 2YB7A 2Z69A 4AHYA 2C5DA 2P2KA 2HWE1 1NA1B 1MQTA 4QPYA 5FO7B 4A7KA 1N1TA 5I8TA 1KS5A 1VBE3 3KWVA 2P3IA 5EXOA 4XJWA 1LENA 2D7FA 4XHBA 5GLUA 2VMIA 3ZYFA 1K5JA 1H8TC 2JDYA 4KG0A 1OURA 2D3PA 1QH6A 3J4UH 1AX2A 4IEXA 4LIVA 5IYYA 1O3RA 4LBQD 3U78A 3HNMA 3O1RA 2D93A 5EJ1B 4QKDA 5ANQA 5FJHA 1LESA 1EY2A 4XF1A 5H9QA 1FXZA 2GALA 2GP3A 3VBUA 1VAVA 3K3NA 1JODA 5J1XA 1TME2 4YGBA 3FHIB 4HKWA 4LHNA 3CJIB 1S0GA 2I45A 3OBTA 5FTTC 1V9U3 1BVVA 1DGWA 3PVBB 2OPKA 4GKYA 3JQWA 4GWIA 5IJRA 4BDVB 5IVBA 4Y5SA 2BUKA 5BNOC 4LBLA 3URFA 2OS2A 2DUOA 4D6QA 4I0WB 2PHRA 4K8FA 4EYUA 2QQLA 4LHKA 1MS3A 2P6CA 5JMCA 2ZGTA 2SBAA 3HWJA 4RS5B 5KC6A 1UU4A 5F9TA 2ZPXA 1PZ7A 3LD8A 3ZN6B 4E2QA 3OYWA 4D7YA 5A7OA 4L92A 1DYPA 2OIIA 3WEZA 4GALA 2JDPA 2OUHA 1HRV1 3AMQA 2PHDA 4UW6A 4XURA 2Y0OA 5CFCA 4LOSA 1LOEA 4QQ2A 2NQYA 2VOXA 5LBEA 2HKXA 5FMCA 5JIUA 5DZEA 1UMHA 3C7EA 4HG6B 4LBQA 4NHLA 3D5OA 3DECA 1JN2P 3O1MA 4GH4B 4BLJA 1RJ8A 2VQUA 5JMOA 1W8FA 5F6LB 1N47A 3H3LA 3I2GA 3BUCA 4CEWB 3APBA 3WF3A 3NV2A 4COZA 4CXWA 4DB5A 1XPWA 4Q4X2 4YZ4A 3VBOB 1FOD1 4DQAA 2HYXA 3E5XA 1X8MA 1N1YA 3PL0A 2RMU2 4YPJA 1SFYA 4X6RB 4CUCA 1UMZA 2D6OX 5KHIA 3MF9A 2A5ZA 5JSOA 2Y6KA 3AB0A 1AYM3 3BTXA 5ERLA 3VB9A 3HN1A 2VNRA 1AHSA 5D21A 2R49A 2D97A 4YRDA 3VZMA 3WP6A 4N7IA 4OZXA 2VCCA 1LOAA 1IQAA 1KDMA 3SH4A 1HRI1 1UD1A 1YLLA 2R043 2ZJCA 3C7GA 1NLRA 2RDNA 4GWNA 5DAQA 2NMOA 4TSVA 3WNNA 2VU9A 3M4FA 3ROUA 1WBFA 2HWB1 4QXKA 5CYYA 1EV11 3HN3A 3ZSLA 4ITCA 1IG0A 4E4HA 3W9AA 4M3CB 4PDWC 4M00A 2DVFA 4IEOA 4C90A 1XE0A 3POIA 3LQCA 3VBFC 4BISA 4NAOA 2FDJA 1VR3A 3N9LA 1SBFA 1Q43A 4HK8A 5F3IA 2RHPA 3VHOA 4AXOA 4MADA 3RYRA 5FXZA 1YO8A 1ZVFA 4OHXA 1XBFA 3EB7A 4LTAA 4UFIA 1PHMA 5J98B 2A6WA 2RS13 3KMHA 3VL9A 4LT5A 2BW8A 3MPBA 1RHI2 1W06A 1GKBA 3AYAA 1HQWA 2BNNA 5BNPC 1NOVA 1O6UA 2DDUA 4XE9A 1H2NA 5FOJB 5KHHA 1R64A 4QB1A 2PLV2 1BLZA 1UPIA 2W1UA 4QQHA 1QNWA 2R072 3ON7A 3Q8EA 3SKVA 1Z78A 2P3KA 3V0BB 4FFGA 1X33A 4PCRA 3BCWA 1UF2C 4OUEA 3RZHA 3B93A 4XUNA 2GNMA 3M3QA 4X8PA 3ILNA 4B1LA 5K0UB 5CG9A 4QHZA 4EJRA 4E4DX 3HIFA 4JGYC 5C9AB 5IK4A 3D8CA 1QQP3 3E1F1 4ZHNA 1G9FA 2A75A 1JYCA 3D3AA 2YHJA 3IZOA 2FDKA 4I30A 1PO21 2ADDA 1DYOA 3PUAA 1GNYA 2Z2SB 4WVWA 5J7MA 2XJQA 4AHXA 4XUPA 4JZRA 3GBGA 3U4XA 1ND3C 5A3NA 2CWSA 3JD72 2R063 3V0BA 1ZBE1 4Q4V3 5D8AC 1DQ5A 1WKYA 4CCLA 2FDHA 3VZKA 3OEAA 2NM1A 3BTZA 2W2IA 1UCXA 5DUWA 3SITA 3TN91 5L7OB 1W9WA 1ULCA 2UURA 2WZR3 4HPKB 1DGWX 2VQ0A 3K48A 1CPMA 4FPFA 5AFEA 4AEDA 3JUUA 5GZDA 1ASJ3 2JG8A 1ZZ6A 2ZGMA 1F15A 2PHTA 4QB2A 3NJVA 5GM0A 4XQDA 3AL6A 3ASIA 4Y3OA 5DAXA 5JZGB 1OKOA 2HWD1 3CBNA 1I6XA 3RWNA 3MIFA 2FZ2A 1PNFA 1GZ9A 5FY8A 4LO8A 1G7YA 2E63A 4XDPA 4FSJA 2JD4A 4FVVA 2VZOA 1FPN3 1CD3G 3T3YA 1Q56A 4BXSV 5FZOB 3GBFA 4LK6A 1COV1 4FCAA 1W8OA 4CPBD 2ZABA 4MOAA 1MEC1 3WZ1A 2ZHNA 3M3IA 4QDQA 3WF1A 3ZFEA 3ZYGA 1SPPA 1HB1A 4YVWB 2PAEA 2F4PA 3VZNA 1BVP1 1YFWA 3IWZA 4O9EA 2JDMA 2JB4A 1OT5A 1RUF3 4Q4W2 2PHLA 1PGL1 1CJPA 2HWF1 4XF9A 2VZPA 4BCUA 1PZ8A 4RD7A 1SLIA 2QNKA 2VUJA 3QBQA 3NNFA 3LIHA 4QQLA 3ZDSA 5KBFA 1AR62 2V5DA 3R4UA 3RI9A 4SBVA 5T5LA 1A3KA 4WM7A 5A33B 3D0SA 1A8DA 1W8ZA 2FCTA 2QDNA 3DXUA 3O7OA 3OOXA 3EQEA 5FZOA 2WNUB 1LGBA 1B35C 1YFXA 3GXUA 2YDEA 1OOPB 2QZ2A 4U36A 2CSGA 1BCXA 2BRTA 4FXKB 5FP7A 2VZQA 4FOWA 4META 4QXBA 2FBEA 5FQ0B 4IESA 1YQ8A 5CZKA 1S0BA 2QQOA 3Q8AA 1R1ZA 5HV0A 5HV4A 2RS33 3VV1A 4CUGA 3OD0A 5EFUA 4GMP3 4D69A 4YZ5A 1UY0A 4ET7A 3VDDB 2RG4A 3AZZA 2NLRA 3OGJA 4CPBA 1TEIA 2QZ3A 1KD7A 5FY1A 2X29A 4A41A 1X82A 4QB6A 2P4EA 3I4IA 3FLTA 4EWEA 4WM8B 1HXS3 4YG6A 4D7TA 2D6KA 3MIHA 3O0WA 3NAPC 4IEZA 2VXRA 1C5HA 3FE5A 4YM0A 5FZEA 2G9FA 3VKFC 2WYSA 4Y1UA 4AEJA 5FO8B 2WWJA 1RITA 4YVSB 4ZS3A 5JIAA 1JH5A 5FY9A 2VVDA 3T2TA 2P3JA 4K7JA 5EHDA 1JW6A 5FKCA 1TG7A 4V2VA 1LEDA 2XQXA 1MQTC 4XW3A 2AZ5A 5CB7A 4MGIE 3IKWA 4DMIA 1YJKA 2LS6A 1VBC1 1OF4A 4OCTA 4EN9B 5CBLA 3TBDA 3NVCA 1CPNA 3U37A 1U0AA 3GDBA 1PVC1 3K3OA 4I3GA 1XXNA 3ZFGA 3IAPA 1H6YA 5LB6A 4COVA 4CRQA 2WS93 4DPNA 3T2OA 4G4FA 4YYOA 3P1IA 5BNQA 4Q1PA 2ARBA 3A21A 4BE3A 4QKFA 4QGLA 1SHWB 2A73B 1LR5A 4RR3A 3RZZA 3K4ZA 4K3UA 4A3XA 1W2TA 3VBUC 1AL22 4H14A 4BQYA 1RUE2 3LSEA 3OG2A 4OHWA 3S7EA 2WUHA 5FZ6A 5L9RA 2VQTA 2Z5WA 1C1LA 3J8F2 2VOTA 3Q8FA 5BNNB 3H8OA 1WZXA 1ZYBA 1OSGA 1QJU3 5GKAC 2PQQA 3L9JT 4Q2FA 2BDRA 2WC2A 1R092 4Y24A 2YPDA 1Z7S1 4A7YA 3AYCA 1YQ5A 1UY3A 3USSA 4NPLA 5ACA3 2OW4A 4AI3A 3J26N 5IUQA 4D8MA 5CFCC 2R16A 3E6BA 1XB9A 2XDVA 2D98A 4QGNA 4YW3A 4D7SA 4Q0SA 4FPHA 5F8PA 1JUIA 2EALA 3V56A 4YFWA 2VJXA 3V65A 1BXHA 3W59A 1U5ZA 2VUCA 3GBWA 3O1SA 4RQPA 3LFIA 3I59B 4LKEA 4XXAA 2QQVA 2VOKA 3UT0A 1UOGA 2Q1MA 3MPPG 3LEGA 4CP1A 4MGZE 3OY8A 3POWA 4FPGA 1CAVA 1UL9A 2VZSA 3ABZA 5FYHA 5J3UA 4R9BA 2GC2A 4ZS2A 3AP5A 1XU2A 3OPWA 1CN1A 3LA3A 1N3PA 4TZDA 2DV9A 4MGQA 2BWAA 2I07B 3MW3A 1QJFA 5TSWA 3W5MA 3ZO0B 4ISRA 3UKTA 1TME3 2ZCWA 1XOYA 4P5YA 1ENRA 2Y6GA 5CA6A 2EXHA 2B45X 1ALYA 3CU7A 3CMGA 5H9RA 3T2QA 2R0HA 4XUQA 3U75A 5FMBA 1Y4WA 2CGNA 1WCSA 2BWCA 1LGNA 3JBG2 3OF1A 1WLDA 1RJ7A 5I0RA 2FDIA 5GZFA 2P3YA 2XLGA 4HFSA 1W9TA 5JPNB 2PA7A 4CP9B 1YC61 5IATA 3UGHA 5FP4A 1D2QA 1PZ9A 2J7MA 1AJKA 3DGTA 3LPFA 2R6QA 3T4VA 2UY9A 3AKRA 5FWJA 3QH6A 3WNKA 2SLIA 1US3A 4ASMB 2Y6FA 1EPZA 4WVVA 4JGZB 2P1BA 5EV7A 2ZTNA 3BOWA 1AR73 4MLOA 3T4HB 2E33A 1DQ0A 1KQRA 4XJUA 3WCSA 4IV1A 4UW3A 2XR4A 5I0TA 2X10A 3A0KA 3NJXA 5C3RA 4XFGA 2L9LA 2XL9A 2XWBB 1HX6A 3NNGA 4I0BA 4E9KA 1W6NB 2HWE2 2WA3A 1W99A 4LUMA 1I3HA 1HW5A 1S55A 3ZSEA 4NO4A 5IVFA 5IFTA 3WP5A 2QUOA 2PLV1 4Q4X3 1QJY1 5C8CA 1QJX2 2V73A 5KXEA 1MS0A 2GNDA 2A3XA 2JECA 2V72A 2R071 3ZVXA 1J1TA 4AI2A 1PO11 2ERFA 2CNAA 3RMYA 5C3OA 4FTSA 2ZMKA 4ZZ5A 1OA3A 2WFF3 2ZAAA 3FUQA 4OHZA 1QMJA 1Q8OA 3PUHA 4N53B 4SLIA 4GIQA 3FLRA 3ACHA 5CISA 4BQ1A 3ACGA 4MGKE 1AUYA 1YIFA 4XJ9A 2WL1A 3MBWA 4LPLA 1JYTA 1XE7A 2BNOA 5FOBB 3LIGA 4YW6A 4P08A 3OSDA 4CU7A 1BBT1 1B09A 2ZKLA 3MIDA 5C9AC 2VQAA 1JHNA 2B9UA 4AEDC 4Z2WA 2A70A 2JG8C 1UY2A 1W2UA 4P9XA 4XBQA 2DFBA 2V4VA 3AP9A 2X09A 4NOTA 3UGGA 4YSFA 4R9DA 2GMMA 1DLCA 4FBFA 1U5IA 1RHI3 2EA7A 1US2A 2IVIB 4IW3A 3USUB 5B4XA 1HRV2 2KR2A 1E57A 4XOGA 1CAWB 5F7UA 3KQRA 2Q8CA 4QPWA 1AR83 4KH9A 3UJQA 4L11A 4NVPA 5J36A 4S2HA 2Q0AA 3N7LA 4LE3A 5L7OC 1VBA1 3J9SA 1F5JA 3ZFEC 4AYUA 2E26A 1YHFA 5KXDA 2YFZA 3O1PA 3DXTA 1DHKB 4ZPIA 1WBLA 3CO2A 2G4IA 4IERA 1UQXA 4EZHA 2JG9B 1QJEA 4F8AA 3KGZA 1S0IA 4PF1A 2EXKA 1MS9A 3PU8A 3OPTA 1LTEA 3UYJA 3ZYPA 2J1SA 5JR7B 1ZZBA 4GB31 4WM7C 1REFA 3C7OA 1GZWA 5FO9B 2VL4A 1Y43B 3BGAA 4AZZA 3NMBA 5FZ7A 2VMCA 3JD73 4P14A 3DKWA 2XUMA 5ABJB 2YGMA 1GNZA 4HVQA 4LK7A 2B39A 3LEIA 1HRI2 3N7KA 3EYPA 2E51A 2HWB2 3WNPA 4NHYA 2HBTA 2O8OA 4HKLA 4BIFA 4RN5A 2RM21 3ZXKA 4QX3A 1W04A 1W90A 1X9TA 1DQ6A 2VW1A 2DUQA 1ND2A 2MEV3 2TNFA 4N9IA 2MNGA 1QIQA 2A6XA 3EBRA 3PUQA 1JOPA 4UFKA 4IEVA 4UFJA 4NE9A 5FUIA 2XLFA 3FJSA 4PLOA 3ZXJA 4PJYA 4CDXA 1J58A 1LHOA 3OUHA 4MYEA 2DCTA 5F2WA 3WF0A 3N9QA 1W0PA 5JSPA 3RZMA 2XHKA 3TEXA 4JDMA 1RTVA 1YFYA 5G04L 4H7LA 2ZX0A 3VDDC 2VUAA 2O0OA 1XYPA 1UY4A 4Q4W3 1ENXA 1TMF3 3FUOA 1W28A 1NCRB 5AVPA 1UU6A 3SMHA 3WOGA 1JZ6A 1SACA 4NMIA 3FN9A 2A3WA 5A3WA 2BEOA 2VMDA 2X5IB 4R4XA 2WNEA 1PM4A 2XJTA 3CEWA 5FYYA 1AR63 2LTNA 2P34A 3G6JB 3ZFGC 5C6CA 3MYXA 3FFZA 1KDKA 3DPRB 3JB4C 2WYFA 4YW7A 4XPVA 1D4VB 5FWEA 1GR3A 1GOHA 4NRPA 4XJ8A 1VMJA 4R4ZA 5FZFA 4XMAA 4K8RB 4RR3C 3GCXA 3WUDA 5IWFA 3BN6A 3JU9A 1JXNA 1PO22 2BYVE 3HJRA 4UF0B 5JVVA 5C4WA 4AWDA 2E9QA 4NIGA 3CHXA 4BQ2A 4CCEA 5JXGA 3BU0A 4KL1A 3ZXAC 4YZ2A 3LEKA 1ZBE2 5FZBA 3OBRA 2QQKA 5LK5A 3BODA 1Y9MA 1AL21 3RVHA 4CCOA 3ZOIA 1RVF3 3W5NA 3N7MA 1TNRA 3AJYA 3TN92 3AJZA 1E5IA 2XONA 1RUE1 3R4SA 5FUNA 5LK7B 1F8VA 4P9JA 1ZX5A 4NIAA 1E5SA 1RGSA 5FP9A 4ARXA 5D8AA 1DGRA 4LR4A 3MICA 3PMSA 5JOYA 2H6BA 2G1MA 5HPOA 2Q1FA 3H1WA 1FATA 1DGRN 2JDNA 4B1MA 4Q4Y3 3RGBA 2HWD2 3AC0A 3I97A 1DZTA 1WW4A 2XJRA 3K46A 3GCWA 2A6VA 3VZJA 5FYSA 1R091 2VG9A 5F3GA 2VZ3A 2EIGA 4CDQA 5C71A 2IFRA 4B7KA 5D1IA 5A3PA 4O61A 4Y1YA 2ENRA 3J7HA 5F6KA 4FFHA 1PIV1 1COV2 2IXKA 4RQPC 4GJYA 4XIOA 4KU7A 4XABA 1MEC2 2EXJA 1SG3A 3ZR5A 4ASKA 3LWCA 2O14A 2OA2A 1W2OA 4GWMA 2VC9A 4QMAA 1UY1A 1GP4A 4R9AA 2DURA 1LHNA 1LECA 4ORFA 3MIBA 2WJSA 4EQVA 4PI0A 2W91A 3TRSB 3ZYRA 3BALA 5ANNA 2J1VA 1MACA 5CNAA 4CEYB 2IVJA 5F37A 5FY4A 1RIRA 4XHXA 2BFUS 1SBEA 2B7YA 4ZY9A 1QKQA 3EJKA 4LIUA 3GJAA 1W03A 3I54A 1ZBA3 2W94A 4O65A 4AGVA 3A23A 5FZDA 1WCKA 3AX4A 2QTWB 1KFUL 1IKPA 4RFT0 1NE6A 5C3SA 1FX5A 2VCBA 3WDUA 1VRH1 4P5HA 1BK0A 4Y4RA 2ATFA 4EROA 3ST7A 1LEMA 4AGGA 2DVAA 1ODNA 4NRMA 3H8RA 3OUJA 1OI6A 1HB4A 3AMHA 1OLMA 4PT6A 1JS9A 4BMBA 2BU9A 4B4RA 2ZX1A 2UWAA 4XVHA 3ZIWA 3IIAA 4AL9A 5I0DA 3TYJA 4D6SA 4N8MA 2F4LA 1KEXA 3FLPA 2W3JA 2CGOA 3DYPA 5CG8A 1IHMA 4IV1C 1JI6A 2W0XA 1NY71 1UU5A 2XVKA 5FZ8A 3PIJA 3VBSB 1QDOA 2TUNA 3N9NA 2BOIA 3RNSA 2ZGPA 3CJXA 1CX4A 2RDSA 3UKNA 4AFAA 1GZTA 1RUC3 5KXCA 1VBC2 2WO1A 1PX4A 4RL7A 1SMVA 1OFSA 1FAYA 3FL7A 4AVVA 4A7ZA 5C8CC 5IFPA 3ZR6A 2C24A 3EHKA 3O0XA 4RHV1 4XILA 4CTEA 1PVC2 2GMEA 5C7GA 3TB0A 4ASLA 1NCQA 5LASA 4LQRA 1L7QA 2WZPP 4QDRA 3THCA 3VKNA 2QQNA 2R30A 3I3DA 2ZGRA 2BZDA 4FPYA 4J1XA 2XOMA 3BYWA 3RRDA 1QJX1 1R083 5ISLA 1W6QA 2ZEYA 4QPGA 3FC0A 3E6CC 4GD4A 5FZ0A 3RPQA 2WFPA 2JE9A 4MG2A 4FTBA 4GA9A 4LHSA 3JBG3 4FQ4A 4LUKA 1REDA 4OI4A 4HVOA 4QT6A 1DZQA 4TWTA 3WQ0A 4CP0A 3AZWA 1LU1A 4YARA 1RUD3 3R4DB 4P00B 1SLTA 2B9VA 1NA1A 4GKXA 5A7PA 1RL3A 4I09A 4I0AA 4DUVA 4L97A 1OLME 2GMPA 5I91A 3M8LA 3IN9A 3MGUA 2TBVA 3AKPA 5K4LA 4CCNA 5BUVA 2GH2A 2JE7A 2XBO2 3VUOA 3TOJA 1Z7S2 3LB9A 1KRIA 1MR5A 5DDJ2 2GC1A 4CUAA 5FZMA 1U5YA 1W39A 1GBGA 2V09A 3HQRA 1RUI1 2J1UA 4UW5A 5CADA 2VMGA 4AI0A 3W58A 3THDA 1K42A 3NV3A 2RDQA 1EAH3 2AR6A 4LEJA 5AC92 2QVSB 5AVAA 5KR7A 3LSDA 2BGOA 2HWE3 4RYDA 1HQLA 4AQ2A 3RZJA 2Q4SA 1OH3A 3AKSA 3CJIA 2XKPA 1RUG1 2B46X 4MUVA 4FXGB 2JDUA 1ZNPA 2AYHA 2PQSA 1WLCA 2CL2A 3H50A 1W6PB 2QBXA 3R0RA 3ZXLA 4G9SB 4RS5A 3SEEA 2KD7A 4CCJA 1OLRA 3FX3A 1W2NA 2GAUA 3ZN6A 2E6VA 2R041 2WLPA 4IQPA 1F35A 4QKNA 1O7FA 3N9MA 3O5SA 1WCQA 4HOOA 3WNOA 4GQ7A 2QQPA 1X8EA 3DKQA 3ZMOA 1H0BA 3FBYA 3O14A 1Q8VA 3KF5A 1D4M2 3HAGA 2RJ2A 3P5BA 5FY0A 1V6IA 4Q29A 1W6MB 2WZEA 1LRHA 2AREA 3ZPOA 2ARCA 3QD6A 2XB6C 1ZM1A 4COUA 4A3ZA 4DZGA 2DU0A 3AYDA 3K51A 3ETQA 4UAPA 5FLHA 2PAKA 5I8YA 4Y5Z0 1RUJ1 5A3TA 4GH4A 4NIHA 1LODA 1YI7A 5E8AA 1CR7A 1RUNA 2DTWA 3NKTA 4CEWA 1MZ6A 2VOVA 3WW4A 3B9CA 1HRV3 2GU9A 1ND2C 4NHMA 1J84A 4PBOA 4XZPA 1NQJA 4FOYA 3B3QE 3VBOA 2IXIA 2YZ4A 3MEPA 2D3SA 4E8CA 5K9YA 4QHBA 1XQNA 4AHWA 2MPFA 3P3PA 3ZMNA 4CDXC 1W9SA 3CNAA 2YBPA 3FHAA 3U07A 4N90A 5JPMB 2VMFA 2LM3A 1JYNA 1SFPA 4XUOA 2XG3A 2WINB 4R52A 1XNTA 3MV01 2NN8A 3F2ZA 3PJYA 4DRRA 1GANA 1NXMA 3H8XA 2ORXA 3VBHB 1XYNA 4XAAA 4LA3A 3U1XA 4CU9A 1H9WA 2XMLA 1QJY2 1RINA 2D43A 1FOD3 2VTXA 4MHRA 1XNBA 4M3CA 3VZLA 1PO12 4QWNA 1J3QA 1UZ0A 1MS5A 2DYCA 3T0DA 1C3HA 1UZZA 3OCPA 4UFMA 1LGCA 4AW7A 4RGKA 1GNHA 2BP6A 3LFMA 4QDSA 3WD5A 1QDCA 3WG4A 1EUTA 1UKRA 2RR12 4Q4V1 3E5QA 1VBD1 5E16A 5C4WC 2JDHA 5D2AA 4P9YA 1HRI3 4XYXA 3UJOA 4DXTA 4ISQA 4J1WA 5FAXA 2XH6A 5EJZB 3VHRA 2EAKA 1K5MB 2GZWA 4B8EA 2V5YA 5IK5A 1EV13 1UYXA 1LHUA 4JX0A 4QX7A 5FP3A 3RWKX 1DQ2A 5LBBA 1BBT2 4PIZA 1OH4A 3C7FA 1VB2A 2G9ZA 3ES1A 4Q8KA 5KHGA 1CIWA 3IB3A 5JSRA 4QX5A 4AEKA 4DO0A 3FMGA 1CAXB 3WQ1A 4C1XA 2WWSA 5A80A 3WP3A 1CONA 3OD4A 5K0UA 1V6LA 3I3BA 5C9AA 5FLJA 1URXA 5JI7A 2B42B 2X53S 1SBDA 4Y22B 3RFRA 3KHCA 3INAA 2HWC1 2IUWA 2OX0A 2QE3A 4NPMA 4CDQC 3PNAA 1S0DA 4ES8A 4QX1A 4ZONA 1RXGA 5KHKA 3GF6A 5GLZA 4ZZ8A 1RB8G 2CGPA 1PK6B 1H1AA 1HLCA 1VBA2 1IKQA 3AL5A 2PN5A 3ORJA 4QPIB 1GQPA 1ODMA 5J48A 1C5IA 2CTVA 4CDUB 2GC0A 3ZXGA 3CKHA 4M3CE 4BIOA 5BY5A 5L7OA 3VD3A 3VD4A 4HPKA 3CDZB 3KCYA 1HB2A 1OPMA 3LKJA 5LBFA 3VBRB 3LPGA 1F5FA 1GP5A 1PO23 3N4MA 2YV8A 4GB32 5FMOS 1X9PA 1ONAA 1S4CA 5JZGA 2RS51 1QHDA 3WP4A 4HT1T 2WNVB 4K40A 4YNIA 1AX1A 4ZU4A 5A6YA 5J37A 1SZBA 1PGSA 1ZBE3 4JTNA 4LO7A 3M7AA 5CFDB 2OT7A 5JLVA 5FBZA 3TN93 4AHZA 1MVQA 2UYAA 2I74A 3AXDA 4KG8A 4YGEA 4CDUA 1N1SA 2PFWA 1DLLA 4UBGA 2PMWB 1PGW1 5GLWA 1OPOA 4YVWA 4LNVA 4AE2A 4XDQA 2RM22 4XBLA 4M01A 3ZFFB 2W68A 1FNZA 3TNPB 2HWD3 1GV9A 1ZZ9A 1DGLA 2JICA 4MGTA 1AR92 3VHNA 1C57A 3ZSJA 2JWPA 5FPUA 1UIKA 1BQPA 2HYKA 3JCIA 2BBVA 4UXAA 2XGXA 4EN7B 4YGDA 2ZHKA 1HIXA 1COV3 1BEV1 5A33A 1MEC3 3C8XA 4Z92B 4Q5OA 2KA3A 2WNUA 4J6GA 1FMD2 3RS6A 1OOPA 3LA2A 1C8M1 1XU1A 4MSVA 4BA6A 5BV6A 1G9BA 3Q9OA 2BPA2 1F4AA 1UNBA 3H3ZA 2EF6A 5FYUA 2Q1ZB 5FQ0A 4OUSA 3ILRA 3ZSMA 3CZUA 1J1LA 2A6YA 2VUDA 2HWF3 3OB8A 5F1RA 2VVEA 2GP5A 2J1EA 1EP0A 5KHJA 1SQ4A 4F3JA 5FCCA 3ILFA 1NCQC 3KT7A 3LZZA 3VDDA 1OF3A 1VBB2 1Q8SA 1W05A 4DINB 2ZGSA 1T6BX 2XLAA 4Y1ZA 1SFNA 2JKXA 2D6PA 5F5CA 3OBAA 1NUKA 1DBNA 1LOGA 1UO9A 4U2AA 3FZ3A 4QPGC 1S2BA 1O91A 3FHQA 2G19A 3GGLA 3KM5A 4WM8A 3C7HA 1WCDJ 2IXHA 1YNAA 5ABJC 3PVEA 2WSUA 1IGOA 1WD3A 2WN3A 3KT4A 3KZ4C 4FT8A 1CQ9A 3BU7A 1R1A2 4BQ4A 4FP3A 5C5UA 2YPJA 4YVSA 2FQPA 1VMHA 4YZ3A 5DZGA 4B4QA 3OPZA 2E7QA 3WLUA 1QEXA 2H0BA 2WRAA 3ZIXA 1NA1C 1S2KA 2XJPA 4L9BA 4FP2A 1WWYA 3POJA 4C91A 5ACA1 5JI9A 1SLAA 2VBBA 4XAEA 3NNMA 4BOWA 3S5AA 2WO3A 4BJ0A 2K2SA 2DU1A 2P6HA 2GNBA 4HSLA 3WCRA 2Y33A 1RMU1 1QF3A 3WDXA 1YXWA 2ZX3A 5C33A 1HN0A 2E7AA 2NPIA 2ILMA 4OULA 4EN8B 5GJ6A 2XBO1 3T0AA 1POQA 1POV0 5DDJ1 5E6HA 4HSJA 1OUXA 1W0OA 3E6DA 2C1FA 2HJIA 1VBC3
chains in the Genus database with same CATH topology
3IMNA 1IZ3A 3P3NA 1QNYA 3CJIC 4XF3A 4D94A 2D5FA 4N43B 3VN4A 5AC91 2DVDA 3ELNA 2ZX4A 3AMMA 3MDPA 3H1YA 3WG2A 5BNNA 4RS5C 4BM8A 3UKVA 4BHPA 4KWJA 2AGSA 4DNYA 1HV0A 3ECQA 3WINE 5DZFA 3KLSA 2G9GA 1SCRA 1CAUB 4QGMA 2X8KA 5HCAA 2BTVC 2WT2A 3ZX7A 4DY5A 3I59A 4GH4C 1D4M1 1WLTA 1AX0A 1VRH2 3ALQA 3S7IA 4Q8LA 1MS1A 3AP7A 2NP0A 5HBAA 2BVVA 4CEWC 1Q8PA 1DFQA 1G9DA 4YM2A 4JVAA 4S2DA 3VBOC 4NWWA 3N7JA 1RUH2 1ENQA 3HT1A 1OA4A 1EPWA 1NY72 1O4YA 2WA4A 4YZ1A 2YYOA 1VAKA 2YUEA 3H0OA 5A32B 3AKTA 2ZACA 3PHMA 4ZXKA 3POYA 1M4WA 4XIKA 4CDWB 1Y3TA 1QY4A 1QOTA 3MF6A 4RHV2 2Q8OA 3AM2A 4YG0A 3D82A 4RSUA 2D3RA 4W65A 3WHUA 1YI9A 4E4ZA 1G9CA 1LU2A 1O5LA 1UX6A 3HR9A 4V1PA 5DG2A 1V9U2 2EAAA 3AZYA 2RMU3 2R0FA 4FQZA 2R1BA 4JGZA 4YW4A 1H2MA 5FRAA 5DXDA 4Q0VA 1FYUA 5A3MA 4AVBA 3MIEA 3QH7A 1LKNA 1VAMA 2RR11 4Y20B 1H8TB 2ARXA 3LAGA 3EXUA 3C3VA 2H0VA 4Y4YA 5IT6A 5FFOC 1W6NA 3SH5A 1QXJA 1WW5A 4IEYA 4AG4A 5CAZA 2DVBA 2R32A 3R6SA 4HMZA 2AUYA 5K0UC 1ZZ7A 2PHFA 4HANA 1RUI2 1POV1 3GHMA 3D0JA 1K5MC 1J3RA 5BNOB 1WLWA 4N53A 2XVGA 2ETEA 1U5XA 2PLV3 1QJY3 1RUG2 4ONUA 2WLQA 2XJVA 2IXLA 2R073 3M1HA 1QOOA 1DQ1A 1PO13 4LO5B 1AXYA 1AYM2 3THTA 1Q3EA 3IT8A 4E2SA 4DOUA 2XPJA 1IOAA 2FHRA 1IS4A 4AF9A 4L99A 4XJAA 2R042 2DCKA 5JZGC 3DUIA 3H8UA 2UWBA 5E1RA 4NN0A 3USUA 3UV9A 4FOVA 3RDIA 1Y9QA 1MS4A 2DUPA 4R8HA 1CAWA 1KXGA 5T5OA 3WW2A 2LALA 1PVXA 1SLBA 4CDUC 2GC3A 4YFZA 2CAUA 1RUJ2 2MEV1 4ZU7A 1FNYA 4WZFA 4YVWC 1QWRA 2LUWA 5I0UA 4UBHA 2ZOEB 1IPKA 3L2HA 1AXKA 4MGYE 2JG9A 5IK7A 3X29B 3DF0A 4WVMB 4PIYA 1KFXL 1SLLA 4PLMA 5JDBA 1S0CA 3UL2A 1X7NA 2FZ1A 1FV2A 1APNA 1ZREA 1AR91 1A6CA 1VBA3 2WNUC 3NKGA 1BMV2 3M70A 1LHVA 3AP6A 1OOPC 2ZHMA 3ZYIB 5ABJA 3VBFB 3WR0A 2GH8A 4ATFA 1AYN1 3RG0A 4KNCA 1FMD1 2OUJA 1LOCA 4GULA 1BK1A 4K6BA 3SLIA 5GZGA 4GB33 1OD5A 5BNPB 1OA2A 4KBBA 3NJZA 3I2DA 2R062 4WM8C 1RUOA 4Q4V2 1TE1B 4PBPA 1M06G 1VBD2 1VBB1 3N3HA 2E53A 1PMIA 4M0HA 4LBMA 4YVSC 1D0HA 2XWJB 5JWPA 2VGDA 1ASJ2 4K1YA 1F9KA 2FMYA 1SEFA 5E88A 3KB5A 4JGYB 4AK3A 4Q4Y1 2ZGKA 4A2UA 1R1A1 4H7MA 4ES9A 1NCRA 1H4HA 3MLKA 4I01A 2X5IA 1HQNA 4AFCA 2K0GA 4JRAA 2ET7A 1UAIA 1QGLA 1AL0G 3DPRA 1ND3B 4AVTA 4EN6B 4FTEA 2HWC2 5E89A 4S2GA 2DCYA 2O8QA 2Y0IA 4OUMA 2UY8A 3RJ2X 2K9ZA 1U12A 5HCBA 1BJQA 5KC5A 3TNQA 1MZFA 2QFEA 4IV3B 1CESA 5T50A 5GLTA 3THPA 4JCKA 5BNNC 1PNGA 1ZRRA 1BKZA 2CAVA 5FDBA 3H7YA 4NHKA 4FPJA 4G3YC 4KGGA 3ZPYA 1KITA 1G6NA 5F5QA 3DV8A 2RS52 3POSA 3VKLA 2RS32 3IPVB 4LHLA 5HCFA 2IXJA 3WDYA 3BPZA 2VNOA 4FPKA 1AL23 4N43C 4E2GA 1WMFA 1VP6A 2PTMA 4K9SA 1RUE3 4AI1A 4IV3A 4FOQA 3MW4A 3AKQA 5LRSA 3L2YA 1PGW2 1QU0A 3IDBB 4AVAA 4MXWB 3LOIA 1QXRA 3J8F3 4RA0A 2ZGLA 2JKBA 2NZ9A 3IBMA 1B35B 1XYOA 1KS4A 1OLQA 3PTYA 1NYWA 2Y26A 1R093 1UKGA 1O5UA 1ZRDA 4JRLA 1XNKA 5L19A 1GSLA 4CEYA 1BEV2 3A0NA 4FPOB 1RUH1 2GNTA 1C8M2 1KJLA 2B8MA 3JZVA 4P9GA 3GHNA 2IXCA 4AGRA 1DZRA 2WS92 5GALA 1VBE1 4XFAA 3MFAA 4OLLA 3NV1A 4N9HA 3NAPB 2MHFA 4OHVA 5FLIA 2Z79A 1V6JA 4COYA 4L2NA 2ZBJA 3FFQA 3B9IA 4JGZC 1RUD1 1YYNA 4HK9A 5EYXA 3OGGA 3M2MA 2PHUA 4P9IA 2JENA 1MZEA 1QJU2 1V9U1 3UK9A 3VBSA 4W6WA 1Y7BA 3WW3A 4EN0A 1DYKA 5ACA2 3RMXA 3B94A 1F31A 1QJZA 4K1ZA 1EAH1 4X8NA 3VBUB 5I93A 1FT9A 2BFUL 3GNEA 4MV2A 4Z8BA 2W39A 1RMU2 1WMEA 2OZ6A 5DUVA 4AFDA 1V00A 3OTFA 4N53C 5DUUA 1JBCA 1Q5OA 3SCFA 4QQPA 3D4KA 5LEJA 2PHWA 4RHV3 3OYWB 1WD4A 4HN0A 3WX5A 3LGRA 3LCPA 2OYZA 5CFCB 3S0MA 3B5LB 5KXBA 1QJX3 1XNDA 4RGAA 4LBQB 2DVGA 3VGIA 3GALA 5I0SA 1CGPA 1AYM1 1N3OA 2A7AA 5SV8A 2ZZJA 3NO8A 1GQHA 3H9AA 1NLSA 2XKOA 1D0GA 4HL0A 5KWRA 1ZA4A 2O1QA 1JYIA 2ZKNA 1CJDA 2HEWF 3M3CA 1GLHA 2XJUA 4Q27A 5EJ3A 4C0BA 1Z0HA 2Z42A 1AR72 4GMP0 3H7JA 1W6PA 2VY0A 2JG9C 1KJRA 4IEWA 1RUI3 4C1WA 4W6YA 4R9CA 1G9AA 2RS11 1C8NA 3IM0A 4AQSA 3T1MA 4EV0A 4F83A 4AQTA 1C1FA 2BQPA 2WT1A 4HKOA 4HN1A 4K20A 3B02A 1QXPA 1RUG3 4KWKA 3WG1A 3IDEA 4FPCA 4XXPA 3KT1A 3WG3A 2AH2A 2BNMA 5ABJC 2DCJA 1UW8A 4XF4A 1WMDA 1W6MA 2VW2A 3AZVA 2GN3A 5HI0A 1BMV1 2IZWA 2VULA 3ZSKA 3VLBB 2JEMA 2WFF2 4M3CF 3QOPA 3WHTA 5EZWA 3V0AB 4YW1A 3PLQA 3WW1A 5FPXA 3JB8A 1QQP1 4ZU5A 2JDZA 2ZHLA 1ULDA 5A3LA 3AMNA 5JOZA 2YC0A 3GZUC 1ZRCA 4Z07A 2P17A 2VMHA 2R061 5T5PA 3V64A 5C8WA 1JOJA 1RUJ3 1GYKA 3AZXA 1PIV2 3V0AA 4XQWA 4Y1XA 2WZR1 3VBHA 3WVJA 2HWB3 1NCRC 2GDFA 1ASJ1 2X5IC 5T55A 4BWOA 4OHYA 2WQ4A 1AR82 2CV6A 3RYKA 5JCTA 3DPRC 5J96B 2QKDA 3E97A 1GQGA 5GZCA 4BYYA 1LHWA 3AXEA 4CP2A 1FPN1 3RI8A 1GICA 4N7UA 4AEDB 2JG8B 2A6ZA 4KGQA 1K5MA 4YGCA 3SNMA 4PLNA 3NSTA 1WW7A 2HEVF 1RUF1 4IETA 3AP4A 5GZEA 3R05A 2KM2A 4Z1VA 2CWMA 2ZAHA 5HXVA 4XTMA 2VPVA 1VBD3 1CAXA 4AVCA 3EO6A 3BOPA 5EWSA 3ZXDA 5CU1A 5DUXA 3ZFEB 2BGCA 4Y22A 4OVEA 5I8SA 4HBNA 4H55A 4BPZA 2N7GA 3SCHA 1S0JA 2RS31 4IV3C 3AK0A 4IEQA 1PK6A 3ACLA 2R1DA 4GMP1 2MEV2 3WDTA 1O3SA 4PIXA 1DQ4A 4QPIA 2WIIB 1L3JA 4WM7B 4BZ4A 5T5JA 5CIRA 4I02A 2DCZA 2A71A 1JTZX 4IEPA 4Q26A 4CYDA 1HXS1 4IL7A 3HBZA 3HT2A 2WT0A 2HWC3 3O12A 2D6LX 4MZUA 1FI2A 3VBRA 4JAAA 4CEYC 2GSYA 3QACA 1OMIA 1TMF2 1G86A 2AENA 2WNVA 1XE8A 2DWRA 4KQ7A 4BLIA 2DF7A 5CFDA 1RC6A 3TWIA 3PJQA 1ZZ8A 5JOWA 1AYN2 3ZXEA 2PELA 3RSJA 1HDKA 1VJ2A 2ZS6B 3MZHA 2WS91 5H9PA 5SV5A 3TAYA 3ZFFA 1VALA 1WUVA 3VHPA 2RS53 4AEMA 2ZMLA 1VIWB 3N36A 2D6NA 4XFHA 4MXVA 2IFWA 2JJ6A 1UIJA 1RVF2 1YCIA 4P9LA 4COWA 4MVTA 4XBNA 1WW6A 5IK8A 2P37A 4E4SA 3VBSC 3ZFGB 3AYEA 2VNGA 3RJRA 4Q4Y2 4C0HA 3C2UA 1QJU1 2OZJA 4Q0UA 1YJLA 2UU8A 4RR3B 2CY6A 4K21A 3N35A 5FMOL 3D6EA 4Q1RA 3VKOA 3KCCA 5FREA 5J09A 1FV3A 1BEV3 1I1EA 4LO4B 4CZSA 3BB6A 2F6BA 3JQXA 5AFBA 3U10A 1C8M3 4FAGA 4QQOA 3SISA 5L73A 1V70A 4XTPA 2TEPA 4FPEA 4XQ4A 1HKDA 1YUDA 2ZGQA 2VOWA 1G8WA 2B5HA 3WQ7A 2D44A 1ZZCA 4MX3A 3DL3A 1XNCA 4TLFA 1BZWA 5T52A 3H3UA 3AMPA 3FBMA 3A4UA 1PVC3 1ZBA2 4LA2A 4RQPB 1OQDA 1NE4A 1TME1 3GZAA 2BVBA 1C4RA 3SHRA 1REEA 3OY8B 1CAVB 4URTA 2NMNA 3B01A 4IEUA 5BXXA 1A8MA 3NV4A 1UPSA 4DFSA 1ULGA 3AFGA 2WSVA 3ATGA 4N43A 1OQ1A 3SH3A 1H8VA 2QCSB 2W08A 4KU8A 1RMU3 4MH0E 4E27A 3I7DA 4O9GA 2QDRA 3VL8A 3LOBA 1CVNA 2XBO3 4ZKTB 1Z7S3 1VB4A 3GZTB 1AR71 1V6OA 1NXD1 5DDJ3 1RUC2 3U11A 4B4PA 2IC1A 1Q8QA 1CAUA 4UW4A 5AC93 4AVSA 3WNXA 2I2SA 2XL7A 4Q0QA 1VBE2 1LOFA 2ZX2A 3WXPA 4Q4X1 4XFCA 1R082 3NW4A 4OI1A 2RMU1 1IS6A 1ENSA 2PAMA 4IV1B 3IDCB 2WFF1 1UN1A 3HMYA 3CLPA 3RYPA 2JXAA 4TYSA 4LULA 4XFFA 1RUD2 2Q30A 4LLFA 3CF6E 4ATEA 4DY3A 5C8CB 2ZGNA 1D4M3 2WQZC 5A32A 1MS8A 4X6QB 1OQEA 2JX9A 4LBJA 1SCSA 3VBHC 4CDWA 1AVBA 5BYNA 1O3TA 2EXIA 2PYTA 2D6MA 1NG0A 3BIWE 1IS5A 1AJOA 1EAH2 1RHI1 4JQRA 3S30A 4H3WA 4AFBA 4YM3A 4JDOA 1WA4A 1C28A 2IWGB 2VVFA 1AR81 1BYHA 4KWLA 2YMZA 2PHXA 5JAXA 4XETA 2GN7A 1QOSA 3LA7A 3ES4A 4Y20A 1H8TA 1A78A 4Q0PA 3MIGA 4HETA 2VECA 2OVUA 4JDNA 2ZZQA 2DFCA 3AFKA 4F7ZA 4LBNA 1S0FA 2Q5TA 1DF0A 1H2KA 3JD71 1V6NA 2RR13 1O3QA 1YFUA 3MI8A 3HD8B 2XJSA 3WY6A 5BNOA 1NQDA 1OKQA 5GLVA 1PK6C 4EWAA 1W6OB 3G7DA 4QPIC 5T54A 2D40A 3BTAA 2E7TA 1GZWB 4I3PA 1BBT3 3S6PA 4S2FA 3SCGA 1POV3 2ZGUA 1YRZA 3ME2A 2RS12 3QLQA 3VBRC 4PF5A 4DRVA 1GFF2 4LBKA 4AQ6A 1DIWA 2WNVC 2RE9A 1SDWA 1FOD2 1W6OA 4I2OA 4AI8A 2YY1A 5CFDC 2C9AA 2EVXA 4Q4W1 1TMF1 1N3QA 4JTOA 1ND2B 2HEYF 2Y38A 1YWKA 4PDWB 4P9WA 1AR61 3M3OA 4QU2A 4CDXB 1H9PA 3ZFFC 4HLTA 3I8TA 1XRUA 1QQP2 4YG3A 1EV12 4XEZA 4WVMA 3NL1A 1H1MA 1OHFA 1X50A 3WDVA 3ENRA 3VKMA 3WT3A 2RJKA 2ZMNA 1UZYA 2DTYA 5B2GB 3QCWA 4PDWA 1RVF1 4B7EA 4LBOA 2ET1A 2ZGOA 1LULA 3VBFA 2WZR2 3PVNA 1I9RA 4FAHA 3T1LA 2FMDA 1LOBA 1HV1A 4XFBA 5JOXA 5C4WB 1ULFA 2RM23 4Y1VA 1S1AA 2A3YA 3PMEA 4PQ9A 2W52A 5BNPA 1AR93 1LCLA 4LO6B 1J3PA 4FO9A 1QH7A 1FPN2 3WDWA 2XVLA 1MZ5A 5T3NA 4QM9A 3MFCA 3MLJA 1AYN3 5D8AB 1FMD3 1OFNA 3U0ZA 1TNFA 4M0NA 4EWDA 4HZFA 1RUF2 4LLOA 1AXZA 3ZYJB 4JGYA 3KCXA 2NYYA 4L8QA 5K7PA 2WKKA 4CDQB 1J59A 4NWVA 4AFMA 1VBB3 4OFGA 4XF0A 1ND3A 3M3EA 4Y26A 1DDLA 1ZBA1 1F2NA 3KD4A 2YROA 1D2SA 3OJBA 3KSCA 3RQ0A 3J8F1 5CVRA 3PVOA 4OI2A 3SXWA 3FWEA 1X36A 1EYBA 1R1A3 1GZCA 4HVRA 4FPLA 4DS0A 1WGPA 1V6KA 2VH9A 1TQ5A 3MLLA 4WV8A 1O4TA 1H4GA 2RJLA 4XFIA 1HXS2 4NR1A 2KXLA 1V6MA 3DN7A 4INDA 4YLZA 4YW5A 5K8SA 1DG6A 4JV4A 5FPZA 3B00A 3E5UA 2ZA9A 3B7MA 3KS7A 3WUCA 1H2LA 1YIPA 4WZCA 1PGL2 2HWF2 3B69A 4QD2A 3IPVA 4IXLA 2QJVA 3MW2A 1NZCA 4WBBA 3HQXA 1RUC1 2ES3A 4LE4A 1PIV3 5EYYA 1IPJA 1LOFC 1T6GC 1ULEA 2D5HA 1JUHA 4WVZA 4MXWA 3ZXFA 4Z82A 1O4ZA 5BPXA 4BMEA 1I5ZA 2UWCA 3KGLA 1H30A 1R081 1B35A 2UYBA 1AZDA 4XMIA 5DG1A 1LJ7A 1H1IA 1PM7A 4W6XA 4B3NA 3JBG1 4JC1A 4QM8A 4RGGA 1DU3D 4B29A 2YGLA 2CYFA 1LB2A 3O0VA 1VLNA 4YW2A 1S0EA 2H6CA 2C0ZA 3CL1A 3ZN5A 1NCQB 1MQTB 4NPRA 5LRRA 3H1MA 3WV6A 3ZN4A 4CDWC 1ZRFA 1AF9A 3GYDA 1W6QB 3NWKA 1MVEA 4D3WA 5LEKA 4QPGB 1VRH3 5H9SA 1IS3A 1N1VA 4XJZA 3NAPA 2VW0A 2YXSA 4BH9A 4GXLA 1RUH3 4OI0A 4DXZA 4YM1A 1SLCA 2Z69A 4AHYA 4A7KA 2C5DA 2P2KA 2HWE1 1NA1B 1MQTA 4QPYA 5FO7B 5I8TA 1N1TA 1KS5A 1VBE3 2P3IA 5EXOA 4XJWA 1LENA 2D7FA 4XHBA 5GLUA 2VMIA 1H8TC 4KG0A 2D3PA 3J4UH 1QH6A 4IEXA 1AX2A 1O3RA 4LBQD 2D93A 1LESA 1EY2A 4XF1A 5H9QA 1FXZA 2GALA 3VBUA 1VAVA 1TME2 4YGBA 3FHIB 4HKWA 4LHNA 3CJIB 1S0GA 2I45A 3OBTA 5FTTC 1V9U3 1BVVA 1DGWA 3PVBB 2OPKA 4GKYA 3JQWA 2BUKA 5BNOC 4LBLA 3URFA 2DUOA 4I0WB 2PHRA 4K8FA 5JMCA 4LHKA 1MS3A 5KC6A 2ZGTA 2SBAA 3HWJA 4RS5B 1UU4A 5F9TA 2ZPXA 1PZ7A 3ZN6B 4E2QA 3OYWA 4D7YA 4L92A 1DYPA 2OIIA 4GALA 2OUHA 1HRV1 3AMQA 2PHDA 4UW6A 2Y0OA 5CFCA 1LOEA 4QQ2A 2NQYA 2VOXA 2HKXA 5JIUA 5DZEA 4LBQA 4NHLA 3D5OA 1JN2P 4GH4B 4BLJA 1RJ8A 5F6LB 1N47A 4CEWB 3APBA 4COZA 3NV2A 4DB5A 4Q4X2 4YZ4A 3VBOB 1FOD1 4DQAA 3E5XA 1X8MA 1N1YA 2RMU2 1SFYA 4X6RB 1UMZA 2D6OX 5KHIA 3MF9A 2A5ZA 5JSOA 3AB0A 1AYM3 3HN1A 2VNRA 1AHSA 1VBC3 2R49A 2D97A 4YRDA 3VZMA 3WP6A 4N7IA 4OZXA 1LOAA 1IQAA 1KDMA 3SH4A 1HRI1 1UD1A 1YLLA 2R043 2ZJCA 4GWNA 1NLRA 2NMOA 4TSVA 2VU9A 3M4FA 3ROUA 1WBFA 2HWB1 4QXKA 1EV11 3ZSLA 4ITCA 3W9AA 4M3CB 4PDWC 4M00A 2DVFA 4IEOA 4C90A 3VBFC 1VR3A 1SBFA 1Q43A 4HK8A 3VHOA 2RHPA 4AXOA 3RYRA 1YO8A 1ZVFA 4OHXA 5J98B 4LTAA 1PHMA 3VL9A 2A6WA 2RS13 3KMHA 4LT5A 2BW8A 3MPBA 1RHI2 1GKBA 3AYAA 1HQWA 2BNNA 5BNPC 1NOVA 4XE9A 1H2NA 5FOJB 5KHHA 2PLV2 1UPIA 4QQHA 1QNWA 2R072 1Z78A 2P3KA 3V0BB 1X33A 4PCRA 3BCWA 1UF2C 3B93A 2GNMA 3M3QA 4X8PA 3ILNA 5K0UB 5CG9A 4EJRA 4E4DX 3HIFA 4JGYC 5C9AB 5IK4A 3D8CA 1QQP3 1G9FA 2A75A 1JYCA 2YHJA 4I30A 1PO21 2Z2SB 4WVWA 5J7MA 2XJQA 4AHXA 3U4XA 3GBGA 1ND3C 2CWSA 3JD72 2R063 3V0BA 1ZBE1 4Q4V3 5D8AC 1DQ5A 3VZKA 2NM1A 1UCXA 5DUWA 3SITA 3TN91 5L7OB 1ULCA 2UURA 2WZR3 4HPKB 1DGWX 2VQ0A 3K48A 1CPMA 4FPFA 5AFEA 4AEDA 3JUUA 5GZDA 1ASJ3 2JG8A 1ZZ6A 2ZGMA 2PHTA 5GM0A 4XQDA 3ASIA 5JZGB