1HRV3

Hrv14/sdz 35-682 complex
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
236
structure length
236
Chain Sequence
GLPTTTLPGSGQFLTTDDRQSPSALPNYEPTPRIHIPGKVHNLLEIIQVDTLIPMNNTHTKDEVNSYLIPLNANRQNEQVFGTNLFIGDGVFKTTLLGEIVQYYTHWSGSLRFSLMYTGPALSSAKLILAYTPPGARGPQDRREAMLGTHVVWDIGLQSTIVMTIPWTSGVQFRYTDPDTYTSAGFLSCWYQTSLILPPETTGQVYLLSFISACPDFKLRLMKDTQTISQTVALTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title SDZ 35-682, a new picornavirus capsid-binding agent with potent antiviral activity.
pubmed doi rcsb
source organism Human rhinovirus 14
molecule tags Virus
molecule keywords HUMAN RHINOVIRUS 14 COAT PROTEIN (SUBUNIT VP1)
total genus 38
structure length 236
sequence length 236
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1995-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1hrv300
2RMU3 3J8F1 1QQP3 2RMU1 1C8M1 3VDDA 5DDJ1 4GMP3 4FTBA 2BFUL 1ASJ1 1BEV2 1H8TC 3VBRB 5ACA2 1QJY2 1Z7S2 1BBT1 5BNNC 3JBG1 1NA1A 2FZ1A 1NY72 3NAPB 1FOD1 4N43A 3JB4C 2RS52 1TME2 1SMVA 5L7OC 4WM7C 1DDLA 1VBB3 4GB33 1AR71 3DPRB 4Z92B 2WS91 5JZGC 1HXS3 1HXS1 1HXS2 1E57A 2GSYA 5BNOB 4FSJA 5BNPC 1RUH2 4CDUA 4AEDA 1VBA3 1D4M3 4CDQC 1RHI1 1PVC3 4CDUB 1AR62 1RHI3 3VBFB 4Q4X2 1H8TA 1EAH2 1RUE2 1ZBA1 1VBD3 4IV1C 1RUD3 3VBOC 1PGL2 5C8CA 1MQTA 1MQTC 1ND3C 1FPN1 1RUF3 1RVF3 4GH4C 1FMD2 3CJIA 4QPIB 1VRH1 4GH4B 1M06G 4IV3A 5DDJ3 5D8AC 1AR83 4JGZB 5BNPA 1NG0A 1NOVA 2WZR3 3VBFC 4YVWB 1AL22 1AL21 1QJZA 3JD72 4IV1A 1EAH1 1RUE1 1BBT2 2BPA2 5A33B 3VBSA 4CDQA 3JD71 4AEDC 3VBSB 2HWC1 5L7OA 5A32A 1RUJ2 2FZ2A 5C4WA 1V9U3 1RUJ3 4SBVA 1PIV2 1VAKA 4CDWA 5C4WB 1BMV2 1PIV3 1RUI1 1POV3 1R092 5C9AA 5FMOS 1COV2 1MEC3 1F2NA 2HWF1 2PLV1 1AYN3 1COV3 5J98B 1TMF1 3VDDC 4BCUA 4Q4Y1 4N43C 1AYM1 3VBFA 1QJU2 2HWD2 1H8TB 1NY71 3S6PA 1BEV3 4Q4V1 4RHV2 1R1A1 4JGZC 1QJY1 1RUF1 5C8CB 5C8CC 1PO22 4QPGA 4WM8B 1ND2C 4CEWA 4GH4A 4QPGB 1PO23 1HRV3 1OOPB 2RS31 3TN91 1ZBA3 5C9AC 3ZXAC 4CDXB 1NCRA 4JGYB 1AYM3 1QJX1 1ASJ2 1BEV1 1W39A 2RS51 1D4M1 3ZFGB 1WCDJ 5JZGB 2R062 2HWB3 1AR91 2R063 5BNOA 1AL0G 3VBHB 2RS12 3IDEA 2X5IB 1PVC2 2R071 5GKAC 2XBO1 5CFDA 1FPN2 1C8M3 4RS5C 1X33A 1C8M2 1RUG1 5AC93 2RMU2 1EV12 1IHMA 4WM8A 1EV13 2GH8A 3ZFEB 1B35C 2ZAHA 1B35A 2HWB1 4PDWB 1VRH2 1FMD1 4Q4W1 2RR11 5D8AA 1AR73 1HRI2 1PGL1 4N53B 2XBO3 4CEYA 5CFDC 1POV0 2WS92 1TME3 3JD73 5FOJB 4GB31 3JB8A 1NCQA 1PO13 4CDXC 1BBT3 2ZTNA 5A33A 2QQPA 3DPRA 1R082 2WLPA 1PGW1 1V9U1 4EJRA 1RUI3 1R083 4RQPC 1RUI2 3M8LA 4CDWB 1PVC1 3ZFGC 1ZBE1 3ZFFA 1AR81 1VBA2 1MEC1 3FBMA 4CEWC 1RUH3 1VBE1 4YVSB 2DF7A 1TMF3 1D4M2 3JBG3 1NCQC 3HAGA 4YVWC 3JBG2 2MEV2 3VBUA 1RUD2 1QJX2 2X5IA 1K5MB 1R1A3 1VBD2 3VBSC 2R042 5DDJ2 1NCRC 1AR93 2R061 2BBVA 4NWVA 2RS32 1FMD3 4GMP0 2RS33 4JGZA 4LLFA 3J8F2 5ABJB 1RMU1 1NA1C 5BNPB 1RVF1 4Q4V2 2IZWA 4Q4X1 4RS5B 3VBRA 4YVWA 4RS5A 1AYM2 2WFF2 1PO21 4IV1B 2WWSA 2BUKA 4GMP1 4PDWC 1AYN1 2RR12 5JZGA 1PO11 3NAPA 4N43B 1RUH1 1VBE3 5ABJC 2HWD1 1RUC2 1PGW2 1V9U2 5BNOC 4QPGC 1ND2B 4CDUC 1QQP1 4QPIA 1COV1 4Q4W3 1R091 1AYN2 5C9AB 1VBD1 5ABJA 2R073 1QQP2 2HWE3 1X36A 5LK7B 1PIV1 3VDDB 4PDWA 3DPRC 2HWD3 4AEDB 1ND3B 1HRI3 3VBUB 5ACA3 3VBUC 2XBO2 1QJY3 2X5IC 4CEYC 1OOPA 4FTEA 1NA1B 1NCQB 1C8NA 1R081 2RM21 5L7OB 1POV1 4Y5Z0 2RS53 1VB4A 1ZBE2 1RUG3 5AC91 1ZBE3 4GB32 4QPIC 1ASJ3 4RQPA 3VBRC 1VB2A 4RQPB 2HWC3 1VBB1 5C4WC 3ZFFB 3ZFFC 2RS13 5CFDB 1OPOA 5CFCC 1AR63 2Y26A 4CDQB 3NAPC 1QJU1 1EAH3 1RUE3 1VBC2 1RHI2 1VBC3 4RR3C 1BMV1 5A32B 1VBA1 5K0UA 1MQTB 1B35B 1RUF2 2WZR1 1HQNA 4IV3B 5D8AB 3ZFEA 1A6CA 1RVF2 3CJIB 1FOD2 1VRH3 3VBHC 3J8F3 1FOD3 1AR72 4JGYA 4WM8C 1EV11 1Z7S1 1Z7S3 3VBOA 2XPJA 1HRI1 1RUC1 2TBVA 1ND3A 4CEYB 3LOBA 2WS93 1PO12 1AL23 1RMU3 3ZFGA 3VBHA 4Y4YA 1CJDA 1RMU2 2MEV1 5FMOL 1VBB2 2BFUS 5ACA1 3ZFEC 1NCRB 1VBE2 1RB8G 4FTSA 4N53C 4CDXA 1OHFA 5BNNA 4RFT0 2RM23 5BNNB 4YVSC 2RM22 1AR61 2MEV3 1MEC2 1TMF2 1QJX3 2HWE2 4Q4X3 3VBOB 1QJU3 1K5MA 1R1A2 1AR92 1K5MC 2R043 3CJIC 1AUYA 1CD3G 4IV3C 4Q4Y2 4RR3A 4RHV3 4Q4Y3 1AR82 4WM7A 4CEWB 1OOPC 4Q4V3 1ZBA2 1TME1 2WZR2 1VBC1 1HRV1 3TN93 1HRV2 4N53A 3TN92 2ZZQA 2WFF3 1RUG2 5K0UC 2WFF1 4NWWA 1RUJ1 2RR13 5J96B 4YVSA 2HWC2 4RHV1 2HWB2 1RUC3 2HWF3 2PLV3 4CDWC 2VQ0A 5CFCA 2HWF2 2PLV2 1F8VA 5CFCB 1ND2A 2HWE1 4Q4W2 4RR3B 2R041 1R093 5AC92 2R072 1FPN3 4JGYC 5K0UB 4WM7B 1HX6A 1GFF2 1RUD1 2RS11
chains in the Genus database with same CATH superfamily
2A3YA 3J8F1 4COZA 3PURA 2IC1A 5FYYA 4FFIA 4QGNA 2B7YA 1GQGA 2XJPA 3MLKA 4XUOA 3LA3A 3SCGA 3U75A 3KLSA 3ZR6A 3B9CA 4Y33A 3O12A 2OX0A 1ENRA 5ACA2 5IAXA 1UL9A 2CY6A 1CAUA 4QQOA 2QDNA 2F4PA 2YBSA 2PQQA 3QH7A 2VUJA 5DG2A 3O0WA 2Z79A 4BXSV 1JZ8A 4N43A 3TB0A 2WNEA 3KQRA 1JMUB 2ARBA 2VMCA 1OPMA 1ULCA 2HKXA 1PX4A 1SMVA 2IVJA 4QB2A 5IYYA 4GJYA 5B4NA 2RG4A 3ES4A 4H14A 5FYHA 4I09A 5FPLA 1YFYA 2HH9A 4AHZA 1AR71 1WCQA 4TN7A 1ZX5A 1IS6A 3W20A 5JZGC 5A6XA 2EVXA 3K51A 2ARAA 2D3PA 4OZXA 3ACIA 3CO2A 1CQ9A 3LFIA 3L9JT 5DZEA 5FIXA 3WP6A 4DXSA 2D3RA 3PUSA 2GSYA 4HOOA 3C3VA 5FZHA 1F5JA 4DUVA 1D4M3 4CDQC 1DGRA 1RHI1 2DVFA 4CDUB 4CCJA 5IVFA 1RHI3 1XRUA 3BPSA 3WDYA 5J3UA 1EAH2 3HIFA 1VBD3 2BEOA 1MS9A 1OXCA 2HYKA 1DGWA 4XMAA 1IG3A 1UIJA 4ZU7A 3VBOC 2XR4A 3TEZA 4C0BA 5BPXA 5F3EA 1RUF3 3SKJE 3T2QA 1SLIA 3HJRA 4GH4C 1FMD2 1VRH1 3USSA 5C33A 4QHOA 5DDJ3 4XF3A 5D8AC 4W6WA 1YWKA 4XUNA 4LE3A 3VL9A 3O14A 2C6SA 1W8TA 3I2FA 4NUBA 4TLGA 2ZACA 1PMIA 1C5IA 2VTXA 5APAA 5FUIA 2HEVF 5BNPA 4NJ4A 2O1QA 4AGRA 5HPOA 2V09A 3VKMA 1NOVA 1X8MA 1GQHA 3VBFC 3WD5A 2VUAA 1AL22 2IXJA 4CVUA 1STMA 1W0OA 4CXXA 3QCWA 1S0JA 4Q0SA 2DYCA 4DZGA 5HV4A 3Q8FA 4IGPA 2R1BA 1PMJX 3OUHA 5M0TA 4ZPIA 1PK6A 1EAH1 3NJZA 5DABA 2NYYA 1OD5A 2NPIA 5A33B 3I2HA 4GA9A 4CU6A 5F6LB 2VCCA 4AEDC 1GOHA 3B7MA 3LD8A 2GMPA 4QXHA 1UX6A 3D6EA 3H3LA 5GLVA 2IVIB 3NV2A 1LGNA 5L7OA 4LUKA 1XXNA 2XVLA 1V9U3 5FZGA 3SITA 4LORA 2UU8A 3AP7A 3RGBA 1GANA 3BVCA 3KCCA 4D7YA 5J36A 1POV3 1XE8A 1R092 4IW3A 5J7MA 3O1MA 4XABA 1UZYA 2MPFA 1W04A 1DGWX 3D8CA 3EHKA 2XL9A 1YXWA 2Q30A 2WO1A 5DUWA 1OFNA 3WQBA 4BYYA 4JDMA 4MHUA 1APNA 1SG3A 2ET1A 2ADDA 5FPXA 1F2NA 4R8HA 1AYN3 4V1PA 4YW2A 4XZUG 5A7WB 5FYCA 5J98B 1DZRA 4PIZA 1TMF1 2ZX3A 3VDDC 4Y1XA 5IVEA 4Q4Y1 1VMFA 1QXJA 2JKXA 4I02A 4QGLA 1W8FA 4XF4A 1TVGA 1UY4A 4LBQD 1CZTA 1JOJA 3DGTA 3HMYA 1RC6A 3AXEA 4FFFA 5LZ6A 3L2HA 1UMHA 4CU9A 4JGZC 3RWNA 1QJY1 1U5ZA 4XMIA 3WUDA 4LA3A 5C8CB 4P9WA 4LNVA 2VU9A 1FV2A 4UFMA 1PO22 4QPGA 5EV7A 4DOUA 5C5TA 2OPWA 2MNGA 1UU5A 3M1HA 3SHRA 1UIKA 3WP4A 3WY6A 1OOPB 2RS31 3I7DA 1ZBA3 4Z82A 1E5SA 3S5AA 5F3CA 4E2QA 4IXLA 1PZ8A 2YUEA 1XNCA 3AYDA 5HCBA 3NKTA 4HK9A 4DXZA 3B94A 1LOEA 4B4QA 1IS3A 3GCWA 2JD4A 4AI8A 1PHMA 1S0BA 3OBZA 4K8RB 2BVBA 4I2OA 4HKOA 4YG3A 2FMYA 2RS51 1YEWA 4UFKA 4KWJA 1O3QA 3USUA 2GAUA 1SCSA 2ZA9A 4I0BA 2ZGLA 2R063 4AF9A 3T08A 3ZSJA 4IGQA 1J83A 4ITCA 3TEYA 1L7LA 1UNBA 2QQKA 3WHUA 2YFZA 5IAVA 5HCFA 2X53S 3WDTA 1ZNPA 2A71A 1C8M3 4HETA 4LUMA 2IFWA 1X33A 3FHIB 4RFRB 4AEJA 4I3GA 1GR3A 1G86A 1NXD1 1RUG1 4OHXA 2XXZA 2BJSA 4IDZA 4QPWA 4Y4RA 3R0RA 1IHMA 2VBDA 3P3NA 4D6RA 5FPUA 3E5QA 2ZX4A 1Q5OA 4PDWB 3KF3A 4H55A 3WDVA 3BYWA 5AFEA 3NW4A 2XWJB 5K9YA 2EIDA 2QTWB 1AR73 2VVDA 3JXSA 3VD3A 1YI9A 4EN7B 2QQJA 4DEVA 1PGL1 4R52A 1YQ8A 4Q27A 1WLCA 5FAXA 2ARXA 2VTXJ 4JV4A 4COVA 1KDKA 5C3RA 2P34A 1V0AA 2JE7A 4D0QA 1W3XA 1TME3 4MHRA 2ZHKA 4GB31 3D4KA 2YU1A 4HONA 5HV0A 4MXWA 4MGTA 3DCQA 3GJBA 2WRAA 2PN5A 2HEYF 1KDMA 2DBNA 2VOKA 4XXAA 1ULGA 1E5HA 3JCIA 4Y1YA 5F5AA 1FX5A 2H6BA 1PGW1 4BHPA 3O7OA 2JG8C 2ZABA 2VO5A 1R083 1PMHX 4LHNA 1FV3A 2A6YA 5FYMA 4E2GA 1W6QA 1RUI2 2VL4A 5A3PA 4K1YA 2NM1A 2D6NA 2JDZA 4D3WA 3MI8A 5F5CA 3WW2A 3ZFGC 4TTGA 3AKPA 4JDOA 4L0PA 1ZVFA 3OY8B 4FOQA 4E8CA 1GZTA 5HXVA 2VNGA 2ZJCA 4NRPA 3P1IA 3LQCA 1ZZ8A 4OVEA 1RUH3 4XZPA 4QKBA 3JBG3 1NCQC 1HB2A 2D6PA 3MW4A 2VOVA 4P9JA 4YVWC 2ETEA 3LA7A 2MEV2 1RUD2 2DCKA 1QJX2 2ZEYA 3OUIA 4BIFA 2VVFA 1D0GA 2VPVA 1IG0A 5IWFA 2A75A 2VG9A 5CZKA 4K1ZA 5A3MA 1CESA 1V6NA 2E51A 2JB4A 3AP6A 3HVDA 4S2HA 2D5HA 1GNHA 3OB8A 4F7ZA 1A3KA 4FFGA 5FP9A 3G6JB 5KR7A 2ZHLA 2J1TA 4P02B 5ABJB 2WLQA 2WT2A 4ASLA 5A7PA 2IFRA 2FDKA 4YW3A 1NA1C 4OHYA 2I2SA 3H1MA 3H8RA 4NMIA 4Q4V2 1O91A 5G04L 5EIYB 3K3OA 4H3WA 4HXCA 4UBGA 2J22A 4V2WA 2LW8A 3EXUA 3I3DA 5EHDA 2WWSA 4JKLA 3U4XA 2W1UA 4PDWC 1AYN1 3IIAA 2FD8A 2WSUA 2K9ZA 5JZGA 4NIHA 3A0KA 5FZ7A 1SBFA 3TYJA 2UWCA 1VBE3 2HWD1 3KV9A 2YGMA 3AK0A 2XONA 4FPEA 2QUOA 2BRTA 5HCHA 5DAVA 1VIWB 5FP3A 2W52A 5LBCA 1QQP1 2C1FA 3ZXFA 4B3NA 2FDJA 4AI1A 1WMDA 2ET7A 4LMFA 4QDSA 3SKVA 3THCA 4D7TA 2Q4SA 4HK8A 5H9SA 1IOAA 5ABJA 2Z69A 1V6LA 3NMBA 4OI0A 1QQP2 1DQ5A 3KV4A 1X36A 4K8FA 3J9SA 4CTEA 2ARCA 5A7WA 2HWD3 5FO8B 1MZ6A 3U37A 2W2IA 4AEDB 1TQ5A 1HRI3 3KB5A 3WXPA 3P5BA 1QJY3 1H2MA 4KGQA 4XDOA 1WA6X 2X5IC 3VLBB 2OIIA 2JDUA 4M0NA 5LBFA 3GNEA 2WNOA 2KA3A 3LFMA 1V6JA 3VD5A 1AX1A 1CPMA 4JAAA 1NCQB 2RM21 2J7MA 5L7OB 4GULA 1ZRCA 2R16A 5I0SA 3TNQA 3WR0A 1I5ZA 2D6MA 2DUOA 1W6MB 1VB4A 1KEXA 1HB3A 2XWBB 3RZHA 3ZR5A 1KS4A 4XYXA 4AWDA 4GWJA 4LPLA 3MICA 1RUG3 5CISA 1ZBE3 4P9GA 2DTWA 1ASJ3 1KJRA 3ZSKA 4GWNA 4M3CF 1MS0A 2P3JA 1EY2A 4KI5M 4Q26A 2GC2A 1W8WA 1RUOA 2VZ3A 3ZFFC 5FKCA 2ZMKA 3VZKA 2RS13 3BOWA 4Z2AA 4HFSA 5CFCC 2D7FA 3L2YA 3ZYBA 4O9EA 3FHAA 4ZONA 4MSVA 1W6PA 4B1MA 2PAKA 5C71A 1RUE3 1VBC2 3WNLA 1RHI2 2WWUA 3WW1A 1UF2C 4FPGA 1FT9A 5FZLA 2CGOA 3CJXA 4BLJA 4ONUA 4NHXA 5K0UA 1MQTB 4LO7A 3MHZA 4KMQA 4GWIA 1B35B 3UKTA 4W4ZA 4AG4A 5IVBA 4IV3B 4RGKA 2J1UA 2V5YA 1XE7A 5L36A 2LS6A 2X29A 1RVF2 5H9RA 2B39A 4OHZA 1DZQA 3VBHC 1PNFA 1JYVA 3X29B 4CP9A 1WW6A 1JYWA 1LB2A 1FOD3 5F39A 4ATEA 2GU9A 4WM8C 1XPWA 1BYHA 4AFAA 1G9FA 3CQOA 5ISLA 3OTFA 3MEPA 2VVEA 3SLIA 3DXTA 1W9FA 2VXJA 5FMBA 1H1IA 3U10A 5FPAA 1GSLA 1L7QA 2ZHNA 4CP1A 3AX4A 4QM9A 1AL23 2BNNA 5I0UA 3ZFGA 2R6QA 5TSWA 1XNAA 1BK1A 1GMMA 4OMCA 4ZS2A 5FQ0A 5L9RA 5C3QA 3OGVA 1CAXB 4AEKA 1RB8G 4FTSA 2AACA 5FR3A 3NNFA 1Y9QA 4FOYA 1OD3A 3SCFA 4K7JA 5F8PA 2GNMA 2D93A 4LT5A 2EIGA 3I3QA 2FMDA 2YB7A 3K4ZA 4FPYA 4UBHA 3OJBA 2CL2A 4MZUA 4RFT0 1ZRDA 2ZGTA 4HPKA 2VECA 2JG8A 3PU3A 2P1BA 4QX7A 1EUTA 1WW4A 4CP9B 3ZXGA 4QDQA 2WKKA 2JJ6A 3CZJA 3IIIA 4B4RA 5JOYA 1KRIA 1YQ6A 2HWE2 3IN9A 4V2VA 1CZSA 5KXEA 2Y6HA 2GALA 2H6CA 2JXAA 4Q1PA 1F35A 4LBKA 4M3CE 2O8OA 1K5MC 5A80A 4NIAA 4KWUA 4L2NA 3T1LA 4MO3M 2R043 3B02A 4C0HA 1OLME 1JH5A 1PNGA 4XBNA 4XUTA 2GP5A 3KQ4B 5F5QA 2C0ZA 1LEDA 4KG8A 4Q4Y3 4Y1UA 5KHKA 3H8XA 3S5QA 2E63A 4CEWB 5EP9A 4TZDA 2UYBA 2GMEA 3AZWA 2G9ZA 3FLTA 3WCRA 3ZPYA 2WZR2 4DFSA 3TN93 4ES8A 2VUCA 4N53A 2A73B 2LALA 2W91A 1LULA 1XYOA 3AYCA 1GLHA 4HKLA 3WF1A 1DLLA 3MO4A 5A1FA 3AFKA 1DGLA 5EXOA 5FMCA 2OT7A 3NKGA 3NNLA 4AOCA 2RR13 2MHFA 1GP5A 4KWLA 3PU8A 3I3MA 3C7EA 3LWCA 1DQ2A 1PGSA 1JHNA 1DCSA 1QJEA 3B69A 3VN4A 3V0BB 1LODA 1HB4A 1RUC3 1IKQA 1ODMA 2E7TA 3FFZA 1LTEA 4HL0A 3RWKX 3K3NA 4LIUA 1US3A 4FXKB 1H2KA 4RR3B 5LY2A 4YPJA 1YJLA 2Y0OA 3E6DA 2R072 4XCBA 5AC92 5JR2A 1HX6A 2BV4A 3M3QA 1CIYA 1GFF2 2ES3A 2RMU3 4B7EA 4FPKA 1AX0A 4XHBA 2RMU1 3E6BA 2UY8A 1C8M1 5FYTA 5HXMA 1VALA 3N36A 3VDDA 2YPJA 4PF5A 4AE2A 3GBFA 1OQEA 4LBMA 3FFQA 4GMP3 2R30A 4ISQA 3BTZA 3D3AA 2BFUL 3HBZA 3HEIA 1ASJ1 1BEV2 3K4DA 4UW6A 2OPKA 4XF9A 5F7UA 1XBFA 3M3CA 1Z7S2 2VZ1A 3ZYPA 1BBT1 3POBA 1KFUL 5FMDA 2FDGA 1X9TA 3MW3A 3T0AA 1FOD1 2VUDA 5A70A 1H2NA 4LIVA 3VD4A 3MFCA 3A7QA 1TME2 3DUIA 1S1AA 1UQXA 5FZ8A 4DY3A 5L7OC 1GKBA 3MIFA 5GJ6A 2OKXA 1VBB3 3AKQA 3V65A 2VNRA 2ZS6B 4GB33 1DG6A 1O5LA 4DIQA 4Z92B 4TWTA 1OUSA 4XJUA 2XJUA 3VHRA 2WO3A 3RPQA 4Q5OA 4WVMA 4XJ9A 4YNIA 2X10A 1HXS3 3S30A 2QDRA 4XUPA 1VAMA 1HXS1 4BMBA 3CNAA 5BNOB 3IWZA 3WDWA 1BKZA 3OBAA 1OQDA 4CDUA 3AKTA 4AEDA 4BQ3A 1VBA3 5J09A 3E5XA 1CWPA 2Y6LA 4CXYA 2XUEA 2ZX0A 4FAGA 1REDA 3N7MA 1AR62 2W9XA 4Q4X2 4S2GA 2OUJA 2B5HA 5IUQA 3ROUA 1H8TA 3AKRA 4R9AA 3NVCA 3ON7A 4MX3A 4PIYA 1NXMA 1PGL2 2VZUA 5FZAA 4I01A 4EZHA 2ZX1A 3OUJA 5DPNA 1DYOA 2H0VA 1JU3A 4COUA 4MGYE 3ACLA 4LBQB 3CJIA 2L9LA 4QPIB 2E7AA 4OMDA 2JB8A 3MIDA 3KVAA 3PDQA 4IV3A 4XFAA 4FPCA 4YARA 4IEYA 2JDHA 5JIAA 3WP3A 3K2OA 5F1RA 2BU9A 1C4RA 2RJLA 3VDCA 1LHWA 3AKSA 2DCZA 4PHZA 3K4AA 4YVWB 1AL21 1IGOA 4XPVA 5GLWA 1O4TA 5HI0A 5A7QA 4EZ4A 1VLNA 2VGDA 4UFJA 5C6CA 2OZ6A 1JYIA 1OURA 4XVHA 1S55A 4BA6A 5FY7A 3KMHA 4CP0A 4CDQA 1W6PB 2XOMA 2EALA 3NV4A 4XDQA 3VBSB 2HWC1 1HN0A 1S2BA 1SEFA 1QHDA 3F2ZA 4R9CA 3O1TA 4Y20A 4AQ6A 3T4VA 1LR5A 2VMFA 1IS4A 1NLSA 2JWPA 1ODNA 2BGPA 2IXCA 2ORZA 2P3YA 4J1XA 4XOGA 3GHMA 2WAAA 4A44A 1RUJ3 1VAKA 5C4WB 5LATA 3O1OA 1PIV3 1YYNA 4BPZA 3RI9A 1G6NA 2B46X 3LAGA 3ZYIB 1HJGA 5C9AA 4MGSA 2JDNA 1KXGA 1O3SA 3ZDVA 4PLNA 1WCKA 3HBKA 3J4UH 5FK7A 3W5MA 4XILA 5A3TA 2DV9A 3AB0A 4LLOA 2ADEA 1MEC3 5FFOC 5LASA 2YV8A 1N1YA 4N90A 4Q8KA 5ANNA 3NNGA 4GKYA 1LHNA 2E7QA 2P3IA 4LO4B 5IK5A 4N43C 3APBA 5CIRA 2QZ3A 5JVVA 4LKFA 1UX7A 3N3HA 2I45A 4BJ0A 1H8TB 2C9AA 1ZRIA 3R6SA 3UNPA 1R1A1 3QD6A 3MIEA 5KC6A 1OLMA 2YFUA 3CIHA 2A6VA 3UESA 2VBBA 3CEWA 1XB9A 2J1AA 5FZDA 3THDA 1XYPA 3U0ZA 2GNTA 3VKOA 4Y3OA 1D2SA 4QPGB 3H42B 1IZ3A 3TN91 2XGXA 4IEPA 5C9AC 3B5LB 1VJ2A 1NCRA 4JGYB 1OLQA 1ULFA 2BDRA 3DECA 3LEMA 2JDKA 2VM9A 2Y6JA 4LO5B 4QHZA 4FBFA 3GJAA 2PHTA 3O1RA 1QJX1 3MF9A 3PUAA 4XIKA 3I2IA 4XFFA 3R4SA 3RYPA 1D4M1 3WV6A 3OPWA 4FI9A 5JZGB 2K0GA 4DMIA 2HWB3 3POJA 2YPDA 3G7DA 1AR91 4NHKA 3KT4A 3W21A 4HZFA 4AQ2A 4DEQA 5FOBB 2WZEA 3IDEA 4IERA 2X5IB 1PVC2 3VKNA 2XBO1 5CFDA 1N3PA 1T6BX 4K20A 4P9YA 2JEMA 3AP9A 1TNFA 4MGKE 3M4FA 4C1WA 2WABA 1MZEA 1C8M2 3A23A 5FJKA 1EV12 2F17A 4IETA 4WM8A 2ZGPA 5FZ1A 1OC1A 1SLBA 4JX0A 5CBLA 5I8YA 3M3IA 4ZZ5A 5JDBA 4ARXA 2VE1A 2W68A 3WZ1A 2HWB1 4DRVA 4OQ9A 1VRH2 2C9KA 2BWCA 5D8AA 1UMZA 4OHWA 2XH6A 3FJSA 1PK6C 1V70A 2VNOA 1CPNA 2CTVA 2XBO3 3ZYJB 3CZUA 2ZGOA 3Q8CA 3QBQA 3ZOIA 1OF3A 4CEYA 5CFDC 1RTVA 2BNOA 4TLFA 1UN1A 3GZAA 4A41A 4URTA 4YFWA 5KC5A 5A3NA 3AMMA 2Q5TA 4FCAA 1CX1A 4QXKA 1NCQA 1N1SA 1NX9A 3WSOA 2A3WA 2UWBA 1BHGA 4NR1A 1RXGA 1ZRRA 4QDRA 3BUCA 2QVSB 2ZTNA 2VQTA 4NPRA 3A4UA 2IXHA 4QKDA 5A33A 3SH4A 3S0MA 2QQPA 1HQLA 3DPRA 1FNZA 2KM2A 2W92A 3FLPA 5BY5A 4YM0A 1J3RA 2ZMNA 1H0BA 1V9U1 2WLPA 4RGAA 1W99A 1GZ9A 3M2MA 5LY1A 1TE1B 2R0HA 2W5FA 3WG1A 1W0PA 2FCUA 4QX3A 3M8LA 2WJSA 1UXZA 2Q1ZB 5FXWA 3GBWA 4WVZA 1V6MA 3VB9A 5FWJA 4KU8A 5FWEA 2CGPA 5I93A 3ZXLA 5K7PA 2VZVA 1S0CA 1VBE1 4CUBA 5C8WA 1TMF3 4Z2WA 2HBUA 4CSWA 4YZ1A 1LHOA 3JBG2 4C91A 4D8MA 4NOTA 1GWMA 3D5OA 5FBZA 2X5IA 2ZEZA 3KZ4C 2R1DA 4NAMA 4XBQA 2C5DA 3VBSC 2W1SA 4GALA 3CL1A 4AVBA 2SLIA 1W9YA 4XJZA 3DYOA 1NCRC 2R061 3HWJA 3O0XA 4NWVA 5EJZB 1HV0A 1FMD3 2WBKA 3OD0A 4NRQA 4YM3A 2ZGMA 3HQXA 2RS33 3HD8B 3J8F2 4D6SA 2O14A 5A6ZA 5FY9A 4D6QA 4XJ8A 1RMU1 3NQHA 2XQXA 3AVRA 5FZ6A 1C5HA 4BQ5A 1RVF1 4A3ZA 2RJKA 1VR3A 5A3LA 1FATA 3BGAA 4WVMB 3HNBM 1GWLA 2VD7A 3OGRA 4M00A 1X9PA 4HVRA 5FZCA 2WYFA 5GM0A 4IV1B 4CCEA 2WQ4A 3V0AA 2XHKA 4OQ8A 4ZS3A 1Q8PA 1OUXA 5CFDB 2RR12 2Y6FA 3WT3A 1JTZX 3DXUA 2Q0AA 1GV9A 3ELNA 3FL7A 4LK7A 1UW8A 4N43B 2ZCWA 2WZPP 5ABJC 3AZYA 4BQXA 1A8DA 1GUIA 4ET7A 2IWGB 3GXUA 4ZU4A 3QOPA 5LA9A 2QJVA 1KITA 2WSVA 1SDDB 3FUQA 3HQUA 4QPGC 1RXFA 4JKKA 5FREA 1T6GC 1Y4WA 2G9GA 4YSFA 5A6QA 1N1TA 3V56A 5F9TA 1GWKA 2YGLA 3P6BA 4XQ4A 1DYKA 4DXRA 4ZZ8A 2HEWF 5HBAA 2OQ6A 3T09A 5AVAA 4CZSA 5C9AB 1VBD1 1S0IA 2Y60A 5FZBA 4H7LA 3GM8A 3OPTA 5D21A 1SCRA 2DTYA 4PDWA 4YW6A 2ZGRA 1S4CA 2C24A 2EICA 2Q8CA 2VULA 1J1TA 2XLGA 2AGSA 1RJ8A 2P6HA 2Q8OA 1O3TA 1ND3B 4P5YA 3VBUB 2EIBA 3ZXJA 5ACA3 5FXZA 2W94A 4S2DA 4XFIA 3RZLA 1J84A 2Y0IA 1ZA7A 1F15A 2WT0A 4YFZA 4AK3A 5JXIA 3BODA 1XSRA 3ETPA 3ILRA 3AYEA 1L3JA 4BB3A 3RZMA 3FHQA 1R081 1O4YA 4QXBA 1NE4A 2QFEA 4Y5Z0 5FY5A 3T2PA 1UOBA 3H7JA 3IM0A 1US2A 3KVBA 4PBPA 3WNPA 1V6IA 2I74A 3HT1A 3NNMA 2VW0A 1QDCA 1SFNA 4M4RA 3N4MA 2ZGSA 1BVP1 4HN0A 1YLLA 3KGLA 4GB32 4OULA 4QPIC 2DU0A 1REEA 2BNMA 2R0FA 2JIGA 1VB2A 4RQPB 1QH7A 4XF0A 3FZ3A 4P9XA 3ZO0B 1VBB1 4EYUA 1Y43B 3PVNA 5GZDA 2JDYA 3ZYFA 4XAEA 1GP6A 4NVPA 5AVPA 3ZFFB 5I8TA 1JODA 1OA2A 2BP6A 5C5UA 2PAMA 5A3WA 2OYZA 2JE9A 4FOVA 2A5ZA 1JBCA 5EYXA 2Y26A 4OUSA 4JZRA 3NAPC 5T55A 4CU8A 2R7EB 1LU1A 1EAH3 4E4HA 5GLZA 2FDHA 2K2SA 3MGUA 2ZGNA 4NN0A 3VV1A 1VBA1 3RJ2X 2LUWA 1RUF2 1OSGA 1NLQA 3ZN4A 2DUQA 3PIJA 5DAWA 1LHUA 4H7MA 2WO2A 4Y5SA 5FZMA 3ZFEA 3CJIB 4QKFA 4AFMA 3D82A 5JSOA 3OSDA 5GZEA 1YIFA 3FLRA 1EV11 4GIQA 1U5YA 1C57A 4BISA 1XSQA 3VBOA 4KQ7A 4XDPA 2XPJA 1UWWA 4UW5A 1ND3A 4A3XA 2KD7A 5IATA 2WS93 4JHZA 1PO12 3VD7A 1RMU3 1N47A 4XAAA 3VBHA 4AHYA 5CG8A 3WQ7A 4CUGA 1RL3A 1KFXL 2VNVA 4K21A 3UGFA 4JHTA 5FO7B 3RNSA 5JI7A 3LPGA 4PLOA 1NCRB 3DEMA 5T3NA 5FZIA 2VCMA 3I3EA 3VHPA 1J59A 5T50A 3N9OA 5A7SA 4DB5A 1LU2A 1M4WA 2PQSA 4CDXA 5I0RA 1DIWA 3IT8A 3RMYA 3QH6A 5F2WA 1H9PA 4Z8BA 2RM23 4Y24A 1AF9A 4HPKB 4IE7A 4YVSC 2WC2A 1AR61 3QACA 3U11A 2GP3A 2XVKA 4QB1A 2GC3A 2BZDA 3OOXA 3PJYA 4KG0A 4RYDA 3VBOB 1UZ0A 3OEBA 1QJU3 1K5MA 2PHWA 1AR92 2WN3A 2FHRA 4YWAA 1XNTA 4PJYA 2GNBA 4A7YA 3ZKYA 2OQ7A 4GWMA 4CPBA 1CD3G 2PHRA 3H8OA 4HSLA 1JHJA 4UW4A 4MXWB 3S7EA 3MYXA 1SBDA 3VZMA 1O5UA 2E9QA 1S0GA 4UFLA 5JSPA 1VMHA 2ERFA 2WL1A 1FI2A 3IMMA 5LK5A 3MV11 1ZBA2 3LPFA 1TME1 1MS4A 3A22A 4QM8A 1H9WA 1QXRA 1HRV1 4IEUA 4BWOA 5JMCA 5KWRA 4W50A 3E97A 3TN92 4X8PA 4EE2A 1CAWA 1DFQA 1RUG2 2IXKA 2BW8A 4NWWA 1PZ9A 2E6VA 4XACA 3JU9A 3SH3A 1NAEA 1S2EA 2NZ9A 4O61A 3EO6A 4JQRA 4YVSA 3W59A 2HWC2 4YM1A 3KM5A 2VOTA 1TEIA 4N8MA 4E4SA 3CDZB 4Q0PA 2XKOA 3T0DA 3POWA 3UT0A 1Y9GA 5A32A 1MS1A 2VCAA 4KGGA 1WW5A 2HWF3 2DUPA 2PLV3 2Q8EA 3SEPA 1QGLA 3MV01 3O1UA 2AR6A 1ALYA 1ND2A 1UYPA 2HWE1 2ZKLA 2ZBJA 3C7HA 4WVWA 3T30A 5CFCB 4Q4W2 2BBAA 3WG2A 3ZMOA 1W6QB 4EWDA 4WM7B 2CAUA 3NJYA 2D5FA 3PUIA 5T5LA 5IFPA 3OCPA 4LKEA 1A34A 2VH9A 3OPZA 3BIEA 1WMEA 2RS11 2HYXA 2WUHA 4QX5A 4UYBA 1JW6A 1NZIA 3VHOA 5CKNA 4ZHNA 2VBPA 4MYEA 1SLCA 4JRLA 5DDJ1 4A2UA 4FTBA 2EIEA 3NL1A 2RJ2A 4P9IA 5A3OA 1H8TC 3UK9A 3DYPA 2NN8A 4XBLA 3LDBA 1QJY2 2VXRA 5FP4A 3POEA 2ZPXA 5BNNC 1RJ7A 3NWKA 3MIHA 5DUUA 3JBG1 4QMAA 1VPHA 1NA1A 3LDKA 1NY72 2G1MA 4ARYA 4FFHA 3MUY1 1UZZA 4FXGB 2VW1A 2RS52 1WCSA 1DHKB 2FQPA 2CNAA 4H2AA 4IEXA 1HKDA 1SHWB 4WM7C 2Q8DA 1DDLA 4DUWA 3RQ0A 1YFWA 2D6KA 4GAZA 1AHSA 2PELA 4R9DA 4MUVA 1SFPA 1LOCA 5T54A 1DP0A 3DPRB 3MIGA 4EN0A 3I59A 4N7UA 5FZ9A 3MBWA 3UJOA 2QBXA 3ALQA 1OF4A 3IBMA 5T5PA 1GNZA 3J7HA 3SMHA 3V0AB 4QX8A 3GCXA 3OBTA 2CDPA 5JSRA 1D7PM 1E57A 4TXWA 4FSJA 2O8QA 2XKPA 2GNDA 2BVVA 5BNPC 2VAUA 2B9UA 3DF0A 4I0AA 4P5HA 1KGYA 4UXAA 1NLRA 1ACCA 3I3BA 3TEWA 3M3OA 4YZ3A 5SV5A 1IPSA 2VQUA 3H3ZA 5GZCA 3U1XA 4QQPA 4IV1C 3JQXA 4YZ5A 2J1SA 4AGVA 1I1EA 1RUD3 5C8CA 3UGGA 3BTYA 1MQTC 4FQZA 4UAPA 4S2FA 3BU7A 2XMLA 1N1VA 2Y38A 2AEZA 1SACA 2CU5A 2CHHA 2ZZJA 4YW7A 2OXBA 1JZ6A 4YGDA 1AR83 3VGIA 1K12A 1XOYA 2VMHA 5EJ1B 2UURA 4JGZB 3ETQA 1DBNA 1ENSA 1OKOA 2QCSB 3I2DA 1CAVA 4BIOA 2VCBA 3KCXA 4Z07A 2WZR3 3VKFC 3GF6A 3ZDSA 1MR5A 2PHXA 3JD72 1OI6A 2YZ4A 3E5UA 4CCNA 5A7NA 3ABZA 3I2OA 3PVEA 2X05A 1O7FA 3IPVA 1BBT2 1LRHA 2BPA2 3VBSA 3NSTA 2EXIA 2VC9A 3BCWA 3JD71 4PI2A 5JAXA 4HT1T 4AVSA 4HVOA 3BN6A 4BQYA 4UFHA 3I8TA 4Z1VA 1VMJA 3OYWA 1YI7A 2CYFA 4INDA 3ZIXA 4GZ9A 3WEZA 4UI9L 1MVQA 4Y26A 3KT1A 5C4WA 1D0HA 2ORXA 1XJAA 3MUZ1 3RDIA 1NQJA 3OEAA 1LOFA 2PFWA 4HVQA 4OUMA 1RUI1 2PHDA 5IT6A 1WD3A 4D7SA 5KXCA 4JQTA 3Q8EA 3VUOA 3ZX7A 4C1XA 5KHGA 4GXLA 3CU7A 5FMOS 3PVOA 1COV2 3NV1A 1DYPA 4QQ2A 4OYUA 2JG9C 4FPLA 1NE6A 4COWA 4FAHA 5IVJA 5F37A 2QQOA 4YRDA 1LESA 2GMMA 5FZOB 1EPZA 3HT2A 4N7IA 1AYM1 4OUEA 4RGGA 5KHJA 1K42A 2AENA 3UL2A 2HWD2 2QZ2A 3LSDA 1NY71 2DDUA 3S6PA 1BEV3 4BOWA 1LJ7A 2O0OA 4PCRA 3I97A 1OQ1A 3KV6A 3S57A 5FY0A 3IPVB 3O1SA 3WOGA 1IPJA 1H30A 5C8CC 1G7YA 2AREA 1CJPA 3MLLA 5CYYA 3UGHA 2XUMA 3GHNA 1YIPA 3MZHA 3BTAA 4J1WA 4NIGA 1PO23 5DUVA 1HRV3 1KD7A 4EN8B 1QOSA 5I0DA 3ST7A 4C90A 3POIA 4W6YA 1CAXA 4CDXB 1N3OA 3I4IA 1GZWB 1YQ5A 1CAVB 2GDFA 1AYM3 3ES1A 2NQYA 4M4PA 3WUCA 3BALA 3CBNA 3MPBA 4EWEA 3ZXDA 1ASJ2 1BEV1 1VRBA 1REFA 1IKPA 3PTYA 4G4FA 2EAAA 2JG8B 2JX9A 3PL0A 4OI1A 2YYOA 3KV5A 4XF1A 2LTNA 1WCDJ 4QGMA 5CVRA 5IFTA 2WR9A 4QPYA 1QXPA 4XIOA 5FDBA 4QQLA 5BNOA 4HBNA 4P08A 2R49A 2Y64A 5GZGA 2A7AA 3LEIA 3M3EA 2R071 4C8DA 1W2NA 4LHKA 1URXA 3EJKA 1SFYA 1I9RA 3JZVA 2ZEXA 4RS5C 2XB6C 3DYMA 4WV8A 2VZRA 3UKNA 3WX5A 3VZLA 5EPAA 4COYA 1W8UA 4HN1A 3T1MA 1A78A 1FYUA 3GGLA 3ZSLA 2BTVC 2CAVA 2D43A 3T3YA 3N9QA 2W0XA 2PYTA 1O59A 3CKHA 2D98A 4OZOA 2W1QA 4Q4W1 4NE9A 2RV9A 5JXGA 5C3OA 1W28A 1HRI2 3Q9OA 4N53B 5A7OA 2GN3A 5GLUA 1YUDA 1YJKA 3AJZA 4M3CB 4YM2A 3ZVXA 1JXNA 1LCLA 1ULOA 1W6OA 2W39A 2F6BA 3OGJA 1GU3A 2EXKA 2EXHA 4ZXKA 4AAXA 3THPA 4A7ZA 3N7KA 5FOJB 3PUQA 1UKGA 1CGPA 1XNDA 3CLPA 3JB8A 1H4GA 4WVVA 4AXOA 1HW5A 2AH2A 4P9LA 1AJKA 1WZXA 5DAPA 1QDOA 5J48A 3V0BA 4Q0UA 1MVEA 5IJRA 1W2OA 1R082 5FUNA 3LE0A 4EJRA 1Q3EA 4Y20B 2Y33A 5FRAA 1S2KA 1VE0A 2G19A 4CDWB 1PVC1 2XL7A 4NRMA 5EYYA 2JD9A 5E89A 5FKBA 1MZFA 2DBIA 3IAQA 3CF6E 3N9MA 3P3PA 4ES9A 2E31A 3ZFFA 1AR81 4B7KA 5KHHA 1MEC1 5I8SA 1JOBA 1AXYA 2DF7A 4LITA 1D4M2 3HAGA 4CYDA 3RZKA 5DMYA 4Y5TA 4YW1A 4AHWA 5LWBA 2VW2A 4LJHA 1D4VB 4QT6A 4CCDA 3H3UA 1QNYA 1R1A3 1VBD2 3QLQA 5EFUA 4EROA 3AFGA 4AI2A 3KD4A 5E6HA 2R042 4LBQA 2V73A 1AXKA 5FBJA 5L73A 4DPNA 1Q56A 2I07B 3EMRA 3LB9A 3DV8A 2H0BA 1AR93 3IDBB 4QHBA 4LBNA 4YLZA 4TSVA 4ZXEA 4A7KA 1ZM1A 3NV3A 1QEXA 1CR7A 1LAJA 1U5XA 3DKWA 1W8ZA 1FXZA 4LLFA 5FPBA 2E32A 4XFGA 1G9BA 3PVBB 2WNVA 2WNUB 4IEQA 3CHXA 2DFCA 5EZWA 5BNPB 2RHPA 4XQWA 2IZWA 4EN9B 4RS5B 4AL9A 3LIGA 1WMXA 1UYXA 4FT8A 1POQA 1YO8A 2XHNA 2WFF2 4BE3A 2XDVA 1PO21 4DNYA 2BERA 5JXHA 3WW3A 2BOIA 1AXZA 4GMP1 4XTMA 4LHLA 5DG1A 1UU4A 4XXPA 5G05L 5F6KA 1PO11 3LKJA 5C3SA 3NAPA 1KJLA 5DZFA 3M70A 1RUC2 3B3QE 3KGZA 1PGW2 3FMGA 4RD7A 5BNOC 3SCHA 3PTRB 3WDXA 4IEVA 4A4AA 4CDUC 2D3SA 1ULEA 3B01A 3K75B 1COV1 3TOJA 3EYPA 3LOIA 4JDNA 4LTAA 2LROA 3ILFA 1R091 1N3QA 2VOXA 1OA4A 2ZMLA 3RI8A 1OVSA 1GQPA 2R073 4JTNA 3UKVA 2HWE3 3PHMA 4JRAA 1QKQA 2Z42A 1WLDA 1YCIA 3J7NA 2V5DA 4GQ7A 4L9BA 3V64A 3VDDB 5A3UA 5CADA 3C7FA 3DPRC 5E88A 3WLUA 1CN1A 4PT6A 3TWIA 3VZNA 2DWRA 4O7XA 5FK8A 4NO4A 4JCKA 1L7RA 1O6UA 3IMNA 4META 4OI2A 4RL7A 5CA6A 4LO8A 4MADA 2XBO2 3HPNA 3ZIWA 3MF6A 3LCPA 4L11A 3C8XA 4IL7A 5FV3A 2PMWB 1J3PA 1V00A 2XJRA 4FVVA 4CUCA 4DUXA 2CWSA 1W8OA 2D40A 4CEYC 1RIRA 1NA1B 2UY9A 1PVXA 4E2SA 1QU0A 3MLJA 5FYUA 4NROA 1OMIA 2ATFA 1POV1 1GICA 2WNVB 3SEEA 4X6QB 1YHFA 1GZWA 4MG2A 3ZN5A 1CAWB 2YDEA 1RYYA 5BNQA 3AP5A 4KNCA 2XJSA 3WNKA 1SDWA 4Q8LA 4RQPA 3RSJA 4AAPA 2VZSA 4DINB 2WINB 5LEKA 3VBRC 4FOWA 1PK6B 2GN7A 5FP8A 5C4WC 5IK8A 2LRPA 5ANQA 4UFIA 1F4HA 1OA3A 4PF1A 4ASKA 3N35A 1KS5A 1NKGA 1K3IA 1A8MA 2P37A 2QQVA 4IEZA 1PM4A 3RJRA 1S0EA 2IXIA 5JPMB 4CDQB 3VDBA 4NHMA 4I0WB 3SQOA 4AQTA 1QJU1 4G3YC 3NJXA 1LNSA 1JUHA 3ZM8A 1W90A 4UF0B 4OFGA 1VBC3 1F4AA 4RR3C 2FCTA 2B4KA 3HOBA 5A32B 1QMJA 3POGA 2J1RA 1AX2A 1S0DA 1F9KA 4XC9A 3H7YA 1H1AA 4B8EA 1DGRN 1HQNA 4GJZA 2GC1A 3H50A 5D8AB 3ZMNA 1JZ2A 1I5PA 1FAYA 5IVVA 1FOD2 1JS9A 4IE0A 3J8F3 5A6YA 1RUNA 2Y34A 2QNKA 3E1F1 1AR72 4JGYA 3AP4A 1J58A 3LZZA 4MGQA 2YU2A 4AFDA 1Z7S1 2RVAA 2VZPA 2PAEA 1Z7S3 1TG7A 2C26A 3BOPA 4Q0QA 4DY5A 2Z2SB 4LQRA 2TBVA 4J25A 2V4AA 4XEZA 4M3CA 1O3RA 3USUB 1QJFA 4Y22A 1W6OB 4PI0A 1RGSA 3LOBA 1JN2P 4KH9A 4U2AA 3WQ0A 3I54A 1CJDA 2BGCA 2X09A 4Y4YA 2W87A 3WVJA 3ZYRA 1LKNA 2FDFA 1R1ZA 4B1LA 5FMOL 2EAKA 1TZOA 1K45A 2QQUA 2BFUS 2QQMA 3IKWA 3ZXKA 5ACA1 3OG2A 5LB6A 1VBE2 3U07A 2OA2A 2YC0A 2XVGA 4YG6A 3W58A 4N53C 3ECQA 1H6XA 1H6YA 3TRSB 5T5JA 3AYAA 4UT5A 5H9QA 3RYRA 1VP6A 4QU1A 3RVHA 3ZXEA 1OHFA 3LDRA 5KBFA 4RSUA 2PTMA 1NYWA 5FZ4A 5BNNB 2YMZA 2RM22 1WA4A 2DFBA 4LO6B 3Q8AA 4IESA 1CIWA 1MEC2 4DO0A 1QJX3 2YC4A 3MPPG 4HSJA 1MPXA 5FZ3A 2VMGA 5AFBA 5FXVA 2DU1A 2DCJA 3KT7A 5T52A 2DVDA 2IUWA 1TNRA 1W6NA 4XFCA 5FZOA 1B09A 4Y22B 2VZOA 4XTPA 3UYJA 2W3JA 2TEPA 3IB3A 2NMOA 1FNYA 1AJOA 1WLTA 1ZYBA 3MDPA 4IV3C 4Q4Y2 4R9BA 4RR3A 1JYTA 4LKDA 2D97A 2DCTA 2D44A 1WWYA 3GALA 1W06A 3S7IA 1ZREA 4ORFA 3PUHA 4ASMB 1OOPC 2AEYA 4L97A 4QB6A 3A21A 1C1FA 3VZJA 2OUHA 2ZAAA 1HRV2 1ONAA 3H1YA 4W65A 1Q43A 1DF0A 4OI4A 5CEHA 3C7OA 2Q1MA 4CE8A 2PA7A 4CCMA 2ZGQA 1I3HA 2B9VA 5BV6A 1H8VA 3PLQA 5FZFA 5J96B 2G4IA 1ZZ9A 4K9SA 1JYXA 1ZZCA 1Q8OA 3ACHA 3MW2A 4BQ2A 1J3QA 4R4XA 1SZBA 2DVGA 1UY2A 2QQWA 3ATGA 5LRRA 3I49A 3CMGA 5FZEA 1ZA4A 2RDSA 2VQ0A 5CFCA 4PQ9A 2P4EA 3Q8BA 1UCXA 1PM7A 4BQ1A 4DRRA 5JCTA 2V4VA 3IDAA 3GBGA 1R093 2WO7A 3AJYA 2YROA 1U0AA 2XLAA 1G9CA 2VQAA 1WW7A 2LM3A 5C7GA 2XG3A 3WINE 1LENA 1QQP3 5T5OA 1OLRA 1HV1A 1XC6A 2ZOEB 4MXVA 4D94A 3W5NA 1DZTA 4QX0A 3K48A 2VZQA 2YY1A 5DAXA 4X8NA 3R4UA 3VBRB 2W1WA 2GC0A 3VL8A 3SH5A 3U14A 2RDNA 3AXDA 1LGBA 5BYNA 4NHYA 1G9AA 2FZ1A 3H0OA 2A6WA 2G9FA 2WIIB 4BMEA 4EWAA 3NAPB 4JTOA 3JB4C 1UY1A 1SLTA 4CCLA 2NP0A 3AZZA 2VJXA 1GOGA 1UU6A 3HN1A 5FY8A 5C3PA 2P6CA 2E33A 2YBPA 3VD9A 3POFA 1JZ3A 3O5SA 1GYKA 5DZGA 3R05A 4AW7A 4QWNA 4E4ZA 3WNXA 1PZ7A 3K77A 4DS0A 2DCYA 2WZ8A 3PMSA 4XCAA 2WS91 3AVSA 4FP3A 1UYYA 3I59B 4Q1RA 4JC1A 1O4ZA 5H9PA 2CSGA 2J42A 1HXS2 1OH4A 2RDRA 2PHFA 1W3VA 3DL3A 1RUH2 3HN3A 5JOZA 4AVCA 4IE4A 3KHCA 1W9SA 1PVC3 2ZHMA 4CXWA 5LBEA 1W8HA 1O8SA 1V6KA 3FN9A 3VBFB 2NLRA 4BK4A 4XUQA 1RUE2 1ZBA1 5LRSA 4P14A 2K46A 3O0VA 3U78A 3BTXA 3SC7X 1E5IA 4AI9A 1DQ4A 4LBJA 5LW9A 1UAIA 4CU7A 1MQTA 2E26A 2JDMA 1F31A 1ND3C 1FPN1 5FYSA 2EA7A 1RVF3 4BLIA 4URAA 5FZKA 4GH4B 1M06G 4OCTA 2YC2A 5JMOA 2PXJA 4FPHA 4O65A 3WCSA 1GBGA 2QQIA 3WF4A 3ACGA 3RS6A 3EBRA 1EP0A 4AVVA 4CP2A 3TEXA 4BK5A 2AC1A 4YZ4A 1NG0A 4U36A 1IQDC 2WNUA 2XLFA 2QQNA 3M7AA 1BZWA 3JQWA 5CG9A 5EJ3A 1W9WA 1QJZA 4IV1A 2JKBA 2CGNA 1H4HA 1Z0HA 3OD4A 4E9KA 2YBKA 2GH2A 3HR9A 4XJWA 1RUE1 4NIIA 2FCVA 3LIHA 2BQPA 4R4ZA 3O1VA 3PIGA 1P8JA 3N9LA 1XNKA 1G8WA 4F3JA 3OYWB 1IQAA 1J1LA 2W46A 4N9IA 4ZKTB 1NZCA 1RUJ2 4FQ4A 2FZ2A 4Q2FA 2WDBA 4CCKA 4AHXA 4CDWA 4SBVA 1PIV2 5SV8A 1BLZA 2XJQA 1GP4A 3NO8A 3AMQA 3BPZA 1BMV2 2HLEA 1LHVA 3LF7A 2Z5WA 2ENRA 4F8AA 3AL5A 4MV2A 1IS5A 1IPKA 1Y3TA 3LSEA 5CU1A 3LEKA 2VY0A 2P2KA 1OKQA 1UOJA 4NIDA 4A6SA 2HWF1 2PLV1 1F5FA 3AC0A 1COV3 5CAZA 3FX3A 1DLCA 4AI3A 5FY1A 4BCUA 4YW4A 1UD1A 3HNYM 3VBFA 1QJU2 1HN1A 3T4HB 1W6NB 3SXWA 1JYNA 4AI0A 4YGBA 4Q4V1 4RHV2 5K4LA 4IQPA 1CVNA 3IAPA 4LHSA 5CKMA 5FP7A 4PLMA 3E6CC 1LOBA 1RUF1 4G9SB 1YQ2A 2KR2A 4BQ4A 3B93A 4WM8B 4E4DX 1ND2C 4CEWA 4GH4A 5FLJA 1W05A 4QXCA 5FYBA 5JWPA 3ZXAC 4XFHA 1LEMA 2VMIA 5LA0A 4KBBA 4XQDA 2V72A 3AMHA 2ILMA 2JICA 1MACA 4B29A 5C70A 2A6XA 5JR7B 3MFAA 4FO9A 1BXHA 1LOFC 1S0FA 3WQ1A 3H1WA 1W39A 3SNMA 3W9AA 3B00A 3I2KA 3VKLA 1QH6A 5D2AA 1CX4A 3ZFGB 1UO9A 2R062 5E16A 5FQ0B 1AL0G 5FLHA 2RS12 3VBHB 4GD4A 1KQRA 5J1XA 1WD4A 5F2SA 4HANA 4FP2A 2VTFA 5GKAC 4EN6B 2SBAA 1BK0A 1OBNA 4WBBA 5CB7A 1FPN2 3LGRA 4LBOA 1RITA 3ZYGA 5F3IA 4ZU5A 1MS5A 1SBEA 3ILNA 4YG0A 4MGZE 4AGGA 4AVTA 2GZWA 2RMU2 5AC93 1LECA 1W8NA 4M01A 1DQ6A 1Y7BA 4HMZA 5B4XA 4JVAA 1EV13 2D6LX 2TUNA 2FBEA 2WNVC 2ZX2A 2GH8A 4NAOA 1B35C 3ZFEB 2ZAHA 1B35A 5FO9B 1OVPA 4MVTA 4EQVA 4LK6A 1H1MA 4PIXA 1FMD1 4HLTA 4F83A 2RR11 2YXSA 1ENXA 5LA2A 4AQSA 2WN2A 3IZOA 3BU0A 3F95A 1JI6A 3BIWE 5F32A 5CNAA 1WMFA 2Y6KA 5LA1A 4LKSA 4D69A 1X7NA 1UPSA 1ST8A 3KF5A 4IEOA 4IEWA 4L99A 4QKNA 1POV0 2PHLA 1QOOA 2WS92 3FBYA 3C2UA 1JZ7A 2P3KA 3JD73 4AVAA 2HBTA 1QF3A 5JXJA 2F4LA 2TNFA 1UY0A 1PO13 4CDXC 3TNPB 1BBT3 4GKXA 1BQPA 4AFCA 4AZZA 3WF2A 1Q8VA 1W6MA 4O9GA 5FCCA 4PQQA 3KS7A 4K6BA 3J7MA 5FYIA 1RUI3 3GZEA 4FPFA 4RQPC 1UOFA 3FUOA 2XJTA 4XFBA 1QWRA 4Y1ZA 4J6GA 4KU7A 1W0NA 1QY4A 4I30A 1QNWA 1UKRA 3OY8A 4K3UA 5KXBA 1ZBE1 1XYNA 5FPZA 1YQCA 4XJAA 1CZVA 2W95A 1VBA2 4BM8A 2EF6A 3FBMA 1X82A 1ZZBA 4YGCA 4CEWC 5F5IA 3JUUA 3POSA 4YVSB 3ASIA 5I0TA 1XQNA 2DVAA 3RYKA 4BU2A 4PBOA 1BVVA 1G9DA 5IK4A 2B8MA 3OGGA 3VBUA 2FDIA 1K5MB 1X8EA 5JI9A 5F3GA 1AZDA 4HKWA 5FLIA 4LXLA 4UWDA 2UYAA 3PMEA 5DDJ2 2BBVA 3AZXA 4X6RB 3AMPA 2RS32 2QE3A 5JLVA 3BI3A 5L9BA 1U5IA 4GMP0 1Y9MA 4JGZA 4Q29A 1AVBA 1X50A 3WDUA 2KXLA 5FY4A 1BJQA 4NPMA 3N7LA 1LOGA 3T2TA 4BDVB 2WQ8A 4Q4X1 2ZEWA 3RRDA 1RINA 2B42B 2DVBA 4YVWA 3VBRA 1O8PA 3KSCA 1SPPA 4RS5A 1AYM2 5FJHA 3RZJA 1XU1A 5DUXA 2QQLA 4LOTA 2BUKA 3OF1A 1DU3D 4XE9A 4Y1VA 1OT5A 5A1LA 1RUH1 2VR4A 3J7LA 3B9IA 1UYZA 1V9U2 3KWVA 4IUGA 4LBLA 1WCUA 2WT1A 4QU2A 3UETA 3GYDA 3J26N 4A6OA 1ND2B 4CCCA 1MS8A 2ID4A 1D2QA 1WKYA 5EWSA 4QPIA 2J1EA 1DQ0A 2WAOA 2JE8A 3AMNA 5J37A 4Q4W3 1NQDA 1AYN2 3H9AA 1V6OA 2ZGUA 4CUAA 2Z4FA 3ACFA 5CKQA 5I91A 1W2TA 5LK7B 5IVYA 1MS3A 1PIV1 5ERLA 3VHNA 3TAYA 1C28A 3ZKUA 2Q1FA 2AUYA 5FTTC 1YC61 3KCYA 1SPPB 2W47A 4A45A 4KBZA 4AR2A 1UOGA 5BXXA 3VBUC 3WP5A 4UOJA 5IHRA 1EYBA 3BB6A 1C1LA 2OVUA 3RMXA 5EQUA 1XNBA 2BOJA 3N9PA 1ENQA 1EPWA 2OW4A 4QD2A 1YNAA 2BYVE 3N9NA 1OOPA 4OHVA 1SLLA 4FTEA 1W2UA 4HG6B 1DQ1A 4CPBD 1EUUA 2WWJA 1C8NA 4LOSA 1WLWA 2WA3A 2RS53 5E8AA 1WBFA 1HIXA 5GALA 1JZ5A 2C4XA 2ZXQA 5GZFA 1HJFA 1ZBE2 2JDAA 4EV0A 2BWAA 5AC91 3AZVA 4ZY9A 1HDKA 1UPIA 3OGSA 1W03A 4LE4A 5FYZA 3NJVA 3ZYHA 4RN5A 1VAVA 1Z78A 2HWC3 3NNJA 2ZKNA 5FZ0A 3VZOA 2A70A 3U4SA 1MZ5A 3WNOA 1GNYA 4UW3A 5FXXA 4A42A 2D6OX 1UY3A 1OPOA 3ZN6A 1W9TA 3DN7A 1AR63 4IGOA 5A1AA 1WUVA 2IXLA 3KHBA 3N7JA 3HQRA 1JZ4A 4TYSA 3DKQA 1JYCA 4MOAA 1UZVA 2AYHA 2VMEA 5L9VA 1BMV1 5KXDA 3FC0A 4NHLA 4UF0A 5DAQA 3POYA 1Q8QA 1ZRFA 4MGIE 4N9HA 2JG9B 3GZUC 3T2OA 2J1VA 3WG4A 5FPVA 5IW0A 2WZR1 2JENA 2WYSA 2NMNA 3ENRA 1A6CA 2HJIA 1VRH3 1JU4A 4QX2A 5FYVA 5B2GB 3EQEA 1LGCA 1NUKA 2CV6A 3FWEA 3INAA 3I2JA 3O1PA 3AM2A 4QQHA 2JIJA 4CCOA 1HRI1 2Y8KA 1NT0A 2A3XA 1RUC1 2CWMA 4AEMA 4DXTA 3RG0A 2Y6GA 1BCXA 2WQZC 5FUPA 4CEYB 2QKDA 2VZTA 5BUVA 1CONA 1PX3A 5DXDA 3K46A 2E53A 2XJVA 4L8QA 4XURA 3ITQA 3URFA 2WFPA 3RZZA 1RMU2 3ME2A 3BKZA 2MEV1 4MLOA 4CRQA 4IE6A 1E5RA 3LA2A 2W08A 1VBB2 2ZGKA 3LEGA 2X8KA 3ZFEC 3PJQA 4XW3A 1K5JA 2AZ5A 4KWKA 2P17A 4AYUA 4RA0A 3D0SA 4XETA 2JDPA 2YG0A 3GDBA 1HQWA 4WZFA 5DQ0A 3WNNA 1ZZ7A 3THTA 3RFRA 5JUVA 2XQRA 2WA4A 4K40A 2P5BA 3FE5A 3NRUA 3WF3A 5L19A 5LEJA 5BNNA 4BH9A 3WNMA 1JOPA 1YFUA 3WF0A 4FPJA 4LA2A 3WW4A 1R64A 1SQ4A 1UMIA 2JECA 4NPLA 5GLTA 4M0HA 1C3HA 2MEV3 4E27A 1TMF2 2R32A 4YYOA 1OH3A 4IE5A 4DQAA 5JOXA 1GOFA 4Q4X3 5DN2A 4LR4A 3VDAA 4ATFA 5KHIA 2CDOA 3ZN6B 3IDCB 2B45X 1QIQA 4W6XA 2EXJA 5LBBA 1CAUB 1UXXX 1R1A2 1SLAA 3C7GA 1ULDA 5LCWL 1ZZ6A 3H8UA 4KL1A 4YW5A 5IVCA 3SISA 3CJIC 3EB7A 4ISRA 1AUYA 1XU2A 5E1RA 1I6XA 3TBDA 3D0JA 3UJQA 3GZTB 4RHV3 2DURA 3R4DB 1AR82 4OLLA 4WM7A 4YZ2A 2JG9A 5K8SA 4W8JA 4QAWA 4XHXA 2VOWA 4Q0VA 3UV9A 3ZPOA 1JUIA 3MIBA 1YFXA 4Q4V3 5HCAA 4QX1A 3A0NA 3AL6A 5JOWA 1Q8SA 1UZWA 4JKMA 1XE0A 4BQWA 1VBC1 2WNUC 2YHJA 2PHUA 4WZCA 1HLCA 4SLIA 1WBLA 5IK7A 2ZZQA 5D1IA 3T0BA 2WFF3 1YRZA 4BZ4A 5K0UC 2WFF1 1RUJ1 4L92A 4LULA 2OS2A 4P00B 2VMDA 3WHTA 1W2AX 4RHV1 4LEJA 3ZSMA 1LOAA 4E8DA 2HWB2 1H2LA 3PNAA 1ULPA 1WGPA 1QOTA 1OFSA 2A6ZA 3ZSEA 4AFBA 3HNMA 2OZJA 2A1XA 4CDWC 2N7GA 5JPNB 3RZGA 1U12A 2BGOA 1T2XA 2HWF2 2PLV2 2RE9A 1F8VA 3OBRA 1HB1A 5JIUA 2RDQA 3WG3A 4B4PA 3I2GA 2R041 4CA9A 3ZLIA 4BXFA 3ORJA 4I3PA 1FPN3 4JGYC 4YGEA 1GZCA 5K0UB 4MH0E 1RUD1 4FPOB 2UWAA
chains in the Genus database with same CATH topology
2A3YA 3J8F1 4COZA 2IC1A 4QGNA 2B7YA 1GQGA 2XJPA 3MLKA 3LA3A 3SCGA 3KLSA 3B9CA 3O12A 1ENRA 5ACA2 1UL9A 2CY6A 1CAUA 4QQOA 2QDNA 2F4PA 2PQQA 3QH7A 2VUJA 5DG2A 3O0WA 2Z79A 4N43A 3TB0A 2WNEA 3KQRA 2ARBA 1OPMA 1ULCA 2HKXA 1SMVA 3ES4A 4H14A 4I09A 1YFYA 4AHZA 1AR71 1ZX5A 1IS6A 5JZGC 2EVXA 3K51A 2D3PA 4OZXA 3CO2A 1CQ9A 5DZEA 3L9JT 3WP6A 2D3RA 2GSYA 3C3VA 1F5JA 1D4M3 4CDQC 1DGRA 1RHI1 2DVFA 4CDUB 1RHI3 1XRUA 3WDYA 5J3UA 1EAH2 3HIFA 1VBD3 2BEOA 1MS9A 2HYKA 1DGWA 4XMAA 1UIJA 4ZU7A 3VBOC 4C0BA 5BPXA 1RUF3 1SLIA 4GH4C 1FMD2 1VRH1 3USSA 5C33A 5DDJ3 4XF3A 5D8AC 4W6WA 1YWKA 3VL9A 4LE3A 3O14A 5BNPA 2ZACA 1PMIA 1C5IA 2HEVF 4AGRA 2O1QA 2V09A 3VKMA 1NOVA 1X8MA 1GQHA 3VBFC 3WD5A 2VUAA 1AL22 2IXJA 4DZGA 1W0OA 3QCWA 1S0JA 4Q0SA 2DYCA 2R1BA 1PK6A 1EAH1 3NJZA 2NYYA 1OD5A 2NPIA 5A33B 4GA9A 5F6LB 4AEDC 3B7MA 2GMPA 1UX6A 3D6EA 5GLVA 3NV2A 5L7OA 1LGNA 4LUKA 1XXNA 2XVLA 1V9U3 3SITA 2UU8A 3AP7A 1GANA 3KCCA 4D7YA 5J36A 1POV3 1XE8A 1R092 5J7MA 1UZYA 2MPFA 1DGWX 3D8CA 3EHKA 2XL9A 1YXWA 2Q30A 5DUWA 4BYYA 1OFNA 4JDMA 1APNA 2ET1A 5FPXA 1F2NA 4R8HA 1AYN3 4V1PA 4YW2A 5J98B 1DZRA 4PIZA 1TMF1 2ZX3A 3VDDC 4Y1XA 4Q4Y1 1QXJA 4I02A 4QGLA 4XF4A 4LBQD 1JOJA 3DGTA 3HMYA 1RC6A 3AXEA 3L2HA 4JGZC 3RWNA 1QJY1 1U5ZA 4XMIA 3WUDA 4LA3A 5C8CB 4P9WA 4LNVA 2VU9A 1FV2A 1PO22 4QPGA 5EV7A 4DOUA 2MNGA 1UU5A 3M1HA 3SHRA 1UIKA 3WP4A 3WY6A 1OOPB 2RS31 3I7DA 1ZBA3 4Z82A 4E2QA 4IXLA 1PZ8A 2YUEA 1XNCA 3AYDA 5HCBA 3NKTA 4HK9A 4DXZA 3B94A 1LOEA 4B4QA 1IS3A 2JD4A 4AI8A 1PHMA 1S0BA 2BVBA 4I2OA 4HKOA 4YG3A 2FMYA 2RS51 4KWJA 1O3QA 3USUA 2GAUA 1SCSA 2ZA9A 4I0BA 2ZGLA 2R063 4AF9A 3ZSJA 4ITCA 3WHUA 5HCFA 2X53S 3WDTA 1ZNPA 2A71A 1C8M3 4HETA 4LUMA 2IFWA 1X33A 3FHIB 4AEJA 4I3GA 1GR3A 1G86A 1NXD1 1RUG1 4OHXA 3R0RA 1IHMA 3P3NA 3E5QA 2ZX4A 1Q5OA 4PDWB 4H55A 3WDVA 5AFEA 3NW4A 2XWJB 5K9YA 4EN7B 1AR73 2VVDA 1YI9A 1PGL1 4R52A 4Q27A 1WLCA 5FAXA 2ARXA 4COVA 4JV4A 1KDKA 2JE7A 2P34A 1TME3 2ZHKA 4GB31 3D4KA 4MXWA 2PN5A 2HEYF 1KDMA 2VOKA 4XXAA 1ULGA 3JCIA 4Y1YA 4BHPA 1FX5A 2H6BA 1PGW1 3O7OA 2JG8C 2ZABA 4E2GA 1R083 4LHNA 1FV3A 2A6YA 1W6QA 1RUI2 4K1YA 2NM1A 2D6NA 2JDZA 4D3WA 3MI8A 3WW2A 3ZFGC 3AKPA 4JDOA 1ZVFA 3OY8B 4FOQA 5HXVA 2VNGA 2ZJCA 1ZZ8A 4OVEA 1RUH3 4XZPA 3JBG3 1NCQC 2D6PA 3MW4A 2VOVA 4P9JA 4YVWC 2ETEA 3LA7A 2MEV2 1RUD2 2DCKA 1QJX2 4BIFA 2VVFA 1D0GA 2VPVA 2A75A 2VG9A 4K1ZA 5A3MA 1CESA 1V6NA 2E51A 3AP6A 4S2HA 2D5HA 1GNHA 4F7ZA 1A3KA 3G6JB 2ZHLA 5ABJB 2WLQA 2WT2A 4ASLA 2IFRA 4YW3A 1NA1C 4OHYA 2I2SA 3H1MA 4Q4V2 1O91A 4H3WA 4UBGA 3EXUA 2WWSA 3U4XA 4PDWC 1AYN1 3IIAA 2WSUA 2K9ZA 5JZGA 3A0KA 1SBFA 3TYJA 2UWCA 1VBE3 2HWD1 2YGMA 3AK0A 4FPEA 2QUOA 1VIWB 2W52A 1QQP1 2C1FA 3ZXFA 4B3NA 4AI1A 1WMDA 2ET7A 4D7TA 2Q4SA 4HK8A 5H9SA 1IOAA 5ABJA 2Z69A 1V6LA 4OI0A 1QQP2 1DQ5A 1X36A 4K8FA 3J9SA 4CTEA 2HWD3 5FO8B 1MZ6A 4AEDB 1TQ5A 1HRI3 3KB5A 3WXPA 1QJY3 1H2MA 4KGQA 2X5IC 3VLBB 2OIIA 4M0NA 3GNEA 2KA3A 1V6JA 1AX1A 1CPMA 4JAAA 1NCQB 2RM21 5L7OB 4GULA 1ZRCA 2R16A 5I0SA 3TNQA 3WR0A 1I5ZA 2D6MA 1W6MB 2DUOA 1VB4A 2XWBB 4AWDA 1KS4A 4XYXA 3MICA 1RUG3 1ZBE3 4P9GA 2DTWA 1ASJ3 1KJRA 3ZSKA 4GWNA 4M3CF 1MS0A 2P3JA 1EY2A 4Q26A 2GC2A 1RUOA 3ZFFC 2ZMKA 3VZKA 2RS13 3BOWA 4HFSA 5CFCC 2D7FA 3L2YA 4O9EA 4MSVA 1W6PA 2PAKA 1RUE3 1VBC2 1RHI2 3WW1A 1UF2C 4FPGA 1FT9A 2CGOA 3CJXA 4BLJA 4ONUA 5K0UA 1MQTB 4LO7A 3UKTA 1B35B 4AG4A 4IV3B 2V5YA 1XE7A 5L36A 2X29A 1RVF2 5H9RA 2B39A 4OHZA 1DZQA 3VBHC 1PNFA 3X29B 1WW6A 1LB2A 1FOD3 4ATEA 2GU9A 4WM8C 1BYHA 4AFAA 1G9FA 3OTFA 3MEPA 2VVEA 3SLIA 1H1IA 3U10A 1GSLA 4CP1A 2ZHNA 3AX4A 4QM9A 1AL23 2BNNA 5I0UA 3ZFGA 2R6QA 5TSWA 1BK1A 5FQ0A 1CAXB 4AEKA 1RB8G 4FTSA 1Y9QA 4FOYA 3SCFA 4K7JA 2GNMA 2D93A 4LT5A 2EIGA 2FMDA 4FPYA 4UBHA 3OJBA 2CL2A 4MZUA 4RFT0 1ZRDA 2ZGTA 4HPKA 2VECA 2JG8A 1WW4A 3ZXGA 4B4RA 2WKKA 2JJ6A 1KRIA 5JOYA 2HWE2 3IN9A 5KXEA 2GALA 2H6CA 2JXAA 4Q1PA 4LBKA 4M3CE 2O8OA 1K5MC 4L2NA 3T1LA 2R043 3B02A 4C0HA 1JH5A 1PNGA 4XBNA 5F5QA 2C0ZA 1LEDA 4KG8A 4Q4Y3 4Y1UA 5KHKA 2E63A 4CEWB 4TZDA 2UYBA 2GMEA 3AZWA 3FLTA 3WCRA 3ZPYA 2WZR2 4DFSA 3TN93 4ES8A 4N53A 2A73B 2LALA 3AYCA 1LULA 1XYOA 4HKLA 1GLHA 1DLLA 3AFKA 1DGLA 5EXOA 3NKGA 2RR13 2MHFA 4KWLA 3LWCA 1DQ2A 1PGSA 1JHNA 3B69A 3VN4A 3V0BB 1LODA 1RUC3 1IKQA 2E7TA 3FFZA 1LTEA 4HL0A 4FXKB 1H2KA 4RR3B 1YJLA 2Y0OA 3E6DA 2R072 5AC92 1HX6A 3M3QA 1GFF2 2ES3A 2RMU3 4B7EA 4FPKA 1AX0A 4XHBA 2RMU1 3E6BA 2UY8A 1C8M1 1VALA 3N36A 3VDDA 2YPJA 4PF5A 4AE2A 3GBFA 1OQEA 4LBMA 3FFQA 4GMP3 2R30A 4ISQA 2BFUL 3HBZA 4XF9A 1ASJ1 1BEV2 4UW6A 2OPKA 3M3CA 1Z7S2 3ZYPA 1BBT1 1KFUL 3MW3A 1FOD1 1H2NA 3MFCA 1TME2 3DUIA 1S1AA 4DY3A 5L7OC 1GKBA 3MIFA 5GJ6A 3V65A 1VBB3 3AKQA 2VNRA 2ZS6B 4GB33 1DG6A 1O5LA 4Z92B 4TWTA 4XJUA 2XJUA 3VHRA 3RPQA 4WVMA 4XJ9A 4YNIA 3S30A 1HXS3 2QDRA 1VAMA 1HXS1 4BMBA 3CNAA 5BNOB 3IWZA 3WDWA 1BKZA 1OQDA 4CDUA 3AKTA 4AEDA 5J09A 1VBA3 3E5XA 4FAGA 2ZX0A 1AR62 1REDA 3N7MA 4Q4X2 4S2GA 2OUJA 2B5HA 5IUQA 3ROUA 1H8TA 3AKRA 4R9AA 3NVCA 4MX3A 4PIYA 1NXMA 1PGL2 4I01A 2ZX1A 4COUA 2H0VA 4MGYE 3ACLA 4LBQB 3CJIA 4QPIB 2E7AA 3MIDA 4IV3A 4XFAA 4FPCA 4YARA 4IEYA 5JIAA 3WP3A 5F1RA 1C4RA 2RJLA 1LHWA 3AKSA 2DCZA 4YVWB 1AL21 1IGOA 4XPVA 5GLWA 1O4TA 5HI0A 1VLNA 2VGDA 5C6CA 2OZ6A 1JYIA 1S55A 4BA6A 3KMHA 4CP0A 4CDQA 1W6PB 4XDQA 2EALA 3NV4A 3VBSB 2HWC1 1S2BA 1SEFA 1QHDA 4R9CA 4Y20A 1LR5A 5A32A 1IS4A 1NLSA 4J1XA 2IXCA 4XOGA 3GHMA 1RUJ3 1VAKA 5C4WB 1PIV3 1YYNA 4BPZA 3RI9A 1G6NA 2B46X 3LAGA 3ZYIB 5C9AA 1KXGA 1O3SA 4PLNA 1WCKA 3J4UH 2DV9A 3AB0A 4LLOA 5FFOC 1MEC3 2YV8A 1N1YA 4N90A 4Q8KA 4GKYA 1LHNA 2E7QA 2P3IA 4LO4B 5IK5A 4N43C 3APBA 5CIRA 2QZ3A 5JVVA 3N3HA 2I45A 1H8TB 2C9AA 3R6SA 1R1A1 3QD6A 3MIEA 5KC6A 2A6VA 3CEWA 1XYPA 3U0ZA 2GNTA 3VKOA 1D2SA 4QPGB 1IZ3A 3TN91 2XGXA 4IEPA 5C9AC 3B5LB 1VJ2A 1NCRA 4JGYB 1OLQA 1ULFA 4LO5B 4FBFA 2PHTA 1QJX1 3MF9A 4XIKA 4XFFA 3R4SA 3RYPA 1D4M1 3WV6A 5JZGB 2K0GA 4DMIA 2HWB3 3G7DA 1AR91 4NHKA 3KT4A 4AQ2A 4HZFA 5FOBB 3IDEA 4IERA 2X5IB 1PVC2 3VKNA 2XBO1 5CFDA 1N3PA 4K20A 4P9YA 2JEMA 3AP9A 1TNFA 4MGKE 3M4FA 4C1WA 1MZEA 1C8M2 1EV12 4IETA 4WM8A 2ZGPA 1SLBA 5CBLA 5I8YA 3M3IA 5JDBA 2W68A 3WZ1A 2HWB1 4DRVA 1VRH2 2BWCA 5D8AA 1UMZA 4OHWA 2XH6A 3FJSA 1PK6C 1V70A 2VNOA 1CPNA 2CTVA 2XBO3 3ZYJB 2ZGOA 3QBQA 4CEYA 5CFDC 1RTVA 2BNOA 4TLFA 1UN1A 3GZAA 4URTA 4YFWA 5KC5A 3AMMA 2Q5TA 4FCAA 4QXKA 1NCQA 1N1SA 2A3WA 2UWBA 4NR1A 1ZRRA 2QVSB 2ZTNA 4NPRA 5A33A 3A4UA 2IXHA 3SH4A 3S0MA 2QQPA 1HQLA 3DPRA 1FNZA 2KM2A 3FLPA 5BY5A 5CADA 4YM0A 1J3RA 2ZMNA 1H0BA 1V9U1 2WLPA 4RGAA 3M2MA 1GZ9A 1TE1B 2R0HA 3WG1A 1W0PA 3M8LA 2WJSA 2Q1ZB 3GBWA 4WVZA 1V6MA 4KU8A 2CGPA 5I93A 3ZXLA 5K7PA 1S0CA 1VBE1 5C8WA 1TMF3 4Z2WA 4YZ1A 1LHOA 3JBG2 4C91A 4NOTA 3D5OA 5FBZA 2X5IA 3KZ4C 2R1DA 4XBQA 3VBSC 2C5DA 4GALA 3CL1A 4AVBA 2SLIA 4XJZA 1NCRC 2R061 3HWJA 3O0XA 4NWVA 1HV0A 1FMD3 3OD0A 4YM3A 2ZGMA 3HQXA 2RS33 3HD8B 3J8F2 4XJ8A 1RMU1 1C5HA 1RVF1 2RJKA 1VR3A 5A3LA 1FATA 4WVMB 4M00A 4HVRA 5GM0A 3V0AA 4IV1B 2WQ4A 2XHKA 1Q8PA 2RR12 3WT3A 1JTZX 2Q0AA 1GV9A 3ELNA 2WZPP 4N43B 1UW8A 2ZCWA 5ABJC 3AZYA 1A8DA 2IWGB 4ZU4A 3QOPA 2QJVA 1KITA 2WSVA 3FUQA 4QPGC 5FREA 1T6GC 2G9GA 4YSFA 5F9TA 1N1TA 3V56A 2YGLA 4XQ4A 1DYKA 2HEWF 5HBAA 5AVAA 4CZSA 5C9AB 1VBD1 1S0IA 4H7LA 1SCRA 2DTYA 4PDWA 2ZGRA 2VULA 1J1TA 2XLGA 2AGSA 1RJ8A 2Q8OA 1O3TA 1ND3B 3VBUB 3ZXJA 5ACA3 4S2DA 4XFIA 2Y0IA 2WT0A 4YFZA 4AK3A 3BODA 3ILRA 3AYEA 1L3JA 1R081 1O4YA 1NE4A 2QFEA 4Y5Z0 3H7JA 3IM0A 4PBPA 1V6IA 2I74A 3HT1A 2VW0A 1QDCA 1SFNA 3N4MA 2ZGSA 1BVP1 4HN0A 1YLLA 3KGLA 4GB32 4OULA 4QPIC 2DU0A 1REEA 2BNMA 2R0FA 3ZO0B 1VB2A 4RQPB 1QH7A 4XF0A 3FZ3A 4P9XA 1VBB1 1Y43B 3PVNA 5GZDA 3ZFFB 4NVPA 5AVPA 5I8TA 1OA2A 2PAMA 2OYZA 2JE9A 4FOVA 2A5ZA 1JBCA 5EYXA 2Y26A 4OUSA 5T55A 3NAPC 1LU1A 1EAH3 5GLZA 2K2SA 3MGUA 2ZGNA 4NN0A 3VV1A 1VBA1 3RJ2X 2LUWA 1RUF2 1OSGA 3ZN4A 2DUQA 1LHUA 4H7MA 3ZFEA 3CJIB 4AFMA 3D82A 5JSOA 5GZEA 1YIFA 3FLRA 1EV11 4GIQA 1U5YA 1C57A 3VBOA 4KQ7A 2XPJA 4UW5A 1ND3A 4A3XA 2WS93 1PO12 1RMU3 1N47A 3VBHA 4AHYA 5CG8A 3WQ7A 1RL3A 1KFXL 4K21A 5FO7B 3RNSA 5JI7A 4PLOA 1NCRB 5T3NA 3VHPA 1J59A 5T50A 4DB5A 1LU2A 1M4WA 4CDXA 5I0RA 1DIWA 3IT8A 3RMYA 3QH6A 1H9PA 4Z8BA 2RM23 4Y24A 1AF9A 4HPKB 4YVSC 2WC2A 1AR61 3QACA 3U11A 2XVKA 2GC3A 3PJYA 4KG0A 3VBOB 2PHWA 1QJU3 1K5MA 1AR92 2FHRA 4PJYA 2GNBA 4A7YA 4GWMA 1CD3G 2PHRA 4HSLA 3S7EA 4UW4A 4MXWB 3MYXA 1SBDA 3VZMA 1O5UA 2E9QA 1S0GA 5JSPA 2ERFA 2WL1A 1FI2A 5LK5A 1ZBA2 1TME1 1MS4A 4QM8A 1H9WA 1QXRA 1HRV1 4IEUA 4BWOA 5JMCA 5KWRA 3E97A 3TN92 4X8PA 1CAWA 1DFQA 1RUG2 2IXKA 2BW8A 4NWWA 1PZ9A 2E6VA 3JU9A 3SH3A 3W59A 2NZ9A 4YVSA 3EO6A 4JQRA 2HWC2 4YM1A 3KM5A 1TEIA 4E4SA 4Q0PA 2XKOA 3POWA 1MS1A 4KGGA 1WW5A 2HWF3 2DUPA 2PLV3 1QGLA 2AR6A 1ALYA 1ND2A 2HWE1 2ZKLA 5CFCB 2ZBJA 4WVWA 4Q4W2 3WG2A 3ZMOA 1W6QB 4EWDA 4WM7B 2CAUA 5T5LA 2D5FA 3OCPA 2VH9A 3OPZA 2RS11 1WMEA 4QX5A 1JW6A 3VHOA 4MYEA 1SLCA 4JRLA 5DDJ1 4A2UA 4FTBA 3NL1A 4P9IA 1H8TC 3UK9A 4XBLA 2NN8A 1QJY2 2VXRA 2ZPXA 5BNNC 1RJ7A 3NWKA 3MIHA 5DUUA 3JBG1 4QMAA 1NA1A 1NY72 1UZZA 4FXGB 2VW1A 2RS52 1WCSA 1DHKB 2FQPA 2CNAA 4IEXA 1HKDA 4WM7C 1DDLA 3RQ0A 1YFWA 2D6KA 1AHSA 2PELA 4R9DA 4MUVA 1LOCA 5T54A 3DPRB 3MIGA 3I59A 4N7UA 3UJOA 3ALQA 3IBMA 5T5PA 1GNZA 3SMHA 3V0AB 3OBTA 5JSRA 1E57A 4FSJA 2O8QA 2XKPA 2GNDA 2BVVA 5BNPC 2B9UA 3DF0A 4I0AA 4P5HA 4UXAA 1NLRA 3M3OA 4YZ3A 5SV5A 3H3ZA 5GZCA 4QQPA 4IV1C 3JQXA 4YZ5A 1I1EA 4AGVA 1RUD3 5C8CA 1MQTC 4FQZA 4S2FA 3BU7A 2Y38A 1N1VA 1SACA 2ZZJA 4YGDA 1AR83 3VGIA 2VMHA 2UURA 4JGZB 3ETQA 1DBNA 1ENSA 2QCSB 3I2DA 1CAVA 4BIOA 3KCXA 4Z07A 2WZR3 3VKFC 3GF6A 3ZDSA 1MR5A 2PHXA 3JD72 1OI6A 2YZ4A 3E5UA 3PVEA 1O7FA 3IPVA 1BBT2 1LRHA 2BPA2 3VBSA 3NSTA 2EXIA 3BCWA 3JD71 5JAXA 4HT1T 4AVSA 4HVOA 3I8TA 4Z1VA 3OYWA 1YI7A 2CYFA 4INDA 3ZIXA 1MVQA 4Y26A 3KT1A 5C4WA 1D0HA 3RDIA 1NQJA 4HVQA 1LOFA 2PFWA 4OUMA 1RUI1 2PHDA 5IT6A 1WD3A 4D7SA 5KXCA 3VUOA 3ZX7A 4C1XA 5KHGA 4GXLA 3CU7A 5FMOS 3PVOA 1COV2 3NV1A 1DYPA 4QQ2A 4COWA 2JG9C 4FPLA 1NE6A 4FAHA 4YRDA 1LESA 2GMMA 1EPZA 3HT2A 4N7IA 1AYM1 4RGGA 5KHJA 2AENA 3UL2A 2HWD2 2QZ2A 3LSDA 1NY71 3S6PA 4BOWA 1BEV3 1LJ7A 2O0OA 4PCRA 1OQ1A 3IPVB 3WOGA 1IPJA 1H30A 5C8CC 1G7YA 2AREA 1CJPA 3MLLA 3MZHA 2XUMA 3GHNA 1YIPA 3BTAA 4J1WA 1PO23 5DUVA 1HRV3 1KD7A 4EN8B 1QOSA 3ST7A 4C90A 4W6YA 4CDXB 1CAXA 1N3OA 3I4IA 1GZWB 3ES1A 1CAVB 2GDFA 1AYM3 2NQYA 3WUCA 3BALA 3MPBA 4EWEA 3ZXDA 1ASJ2 1BEV1 1REFA 1IKPA 3PTYA 4G4FA 2EAAA 2JG8B 2JX9A 4OI1A 4AQ6A 2YYOA 4XF1A 2LTNA 1WCDJ 4QGMA 5CVRA 4QPYA 1QXPA 4XIOA 5FDBA 4QQLA 5BNOA 4HBNA 2R49A 5GZGA 2A7AA 3M3EA