1HRV3

Hrv14/sdz 35-682 complex
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
236
structure length
236
Chain Sequence
GLPTTTLPGSGQFLTTDDRQSPSALPNYEPTPRIHIPGKVHNLLEIIQVDTLIPMNNTHTKDEVNSYLIPLNANRQNEQVFGTNLFIGDGVFKTTLLGEIVQYYTHWSGSLRFSLMYTGPALSSAKLILAYTPPGARGPQDRREAMLGTHVVWDIGLQSTIVMTIPWTSGVQFRYTDPDTYTSAGFLSCWYQTSLILPPETTGQVYLLSFISACPDFKLRLMKDTQTISQTVALTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN RHINOVIRUS 14 COAT PROTEIN (SUBUNIT VP1)
publication title SDZ 35-682, a new picornavirus capsid-binding agent with potent antiviral activity.
pubmed doi rcsb
source organism Human rhinovirus 14
molecule tags Virus
total genus 38
structure length 236
sequence length 236
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1995-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1hrv300
1H8TC 2HWB1 4RR3B 2MEV2 1TME2 1RUF1 1COV3 1AL21 1RUI3 3VBHC 1R092 1VBE2 1B35C 1OPOA 4CDQA 3VBFA 3ZFFA 1K5MA 1VBA1 1NA1B 1ND3B 4N43C 1QJX1 4CDUC 2R043 4WM7A 5CFDA 1RHI3 4FSJA 1AYM1 2XPJA 1QJY3 1HXS3 1MQTB 1RUE1 3JBG3 5CFCB 1PO21 2WWSA 5C4WA 2XBO3 5AC91 1BMV1 4GMP1 1ND2C 1C8NA 3ZXAC 1RMU3 4YVSC 2HWD3 4RS5C 3VDDA 1AR63 1PIV3 1VBD3 4CEYB 4PDWB 1X33A 3NAPB 1AR92 4Q4W1 5ABJA 5K0UA 1FMD2 4IV3C 1RUH1 4WM8A 4Q4V3 2TBVA 1POV0 1AR71 3ZFGC 4JGYC 3TN91 2RS12 2HWF2 4CDQB 1AYN3 1K5MB 1VB2A 4Y5Z0 4GH4B 1PGW1 2WZR3 3VBRC 1A6CA 5D8AA 4WM7B 5CFDB 3VBSC 4Z92B 4Q4W2 1ZBA3 2BUKA 4JGZA 1R082 4Q4Y1 5C4WB 2R063 2X5IB 1RUH2 5DDJ1 1RUJ2 4CDWA 1TMF3 1EAH3 1VBB3 2QQPA 1QJU1 1ZBE3 1BEV3 5GKAC 3VDDB 4SBVA 5C9AA 1HRV1 5ABJB 5K0UB 1PGL1 3ZFEA 5ACA1 4WM8B 1RUD3 1ASJ1 4RQPA 4CEYC 1RUC2 4GB31 1VB4A 1VRH1 2RM23 1R1A2 1QQP3 2HWE2 2RS51 1D4M2 1FOD2 4CDXA 1MEC2 2WFF2 1F8VA 1C8M3 3JD73 5D8AB 1AR81 1BBT1 4CDQC 2RS33 4GH4C 1CD3G 5L7OA 1NG0A 1RUG3 4JGZB 2GH8A 1EV13 4CDWB 2PLV1 4CEWB 2R071 1AL0G 2HWC3 5C8CA 2RMU1 5C4WC 2X5IC 1PO11 1Z7S3 4RFT0 3ZFEB 5BNOA 2RR13 1FPN2 3VDDC 4RHV1 2WS93 1RVF3 4EJRA 4RQPB 1NCQA 1V9U2 1HRI2 1IHMA 1COV1 2MEV3 1TME3 4WM8C 1R093 2R072 1VBE3 5A33A 3CJIA 4N53A 4CDXB 1AUYA 1PVC2 1NY72 3J8F2 5J96B 2R041 5L7OB 5LK7B 1RHI1 3DPRC 1QJY1 2DF7A 3S6PA 1HXS1 4IV1C 2HWB2 4JGZC 4AEDA 5C8CB 2XBO1 5J98B 1RUF2 1AL22 1RMU1 4CDWC 2HWD1 4CEWC 1VAKA 1VBD1 5BNOB 5JZGC 3HAGA 1VBA2 1AR93 1NCQB 4Y4YA 4Q4X1 1QJX2 1FMD3 4Q4V1 4LLFA 1AYM2 1NCRA 5A33B 1RUE2 3CJIB 2RS13 4N53B 4RR3C 1PO22 1AYN1 2HWF3 3VBFB 3ZFFB 5AC92 1BMV2 2WZR1 4YVWA 5BNNA 4FTEA 3FBMA 1H8TA 1ZBA1 1NA1C 4Q4W3 5FOJB 1ND3C 2R061 4Q4X2 1R083 5L7OC 3VBHA 4Q4V2 1TMF1 1EAH1 1B35A 1RUJ3 1RUH3 1VBB1 1ZBE1 1AR72 2WLPA 1BEV1 1MQTC 3TN92 2FZ2A 5CFCC 1VBC1 4N43A 1PGW2 1QJZA 1CJDA 4PDWC 1HX6A 1RUC3 3NAPC 1NCRB 2RM21 4BCUA 1QQP1 4Q4Y2 1R1A3 1W39A 5DDJ2 2HWE3 4YVSA 4RS5A 1D4M3 1FOD3 4YVWB 5BNNB 1QJU2 1C8M1 1MEC3 3CJIC 3JD71 2WFF3 1VBC2 2Y26A 2RS31 3VBFC 3ZFFC 1K5MC 3IDEA 1RUG1 4NWVA 1HRV2 1EV11 1POV1 4IV3A 1PGL2 3VBHB 5ACA2 2BBVA 3ZFGA 4WM7C 1B35B 4JGYA 5CFDC 1ASJ2 2HWC1 4GB32 1VRH2 4N43B 2RS52 5C9AB 3VBRA 2RR11 4NWWA 4GMP0 2WS91 2ZTNA 1RVF1 3VBSA 1FPN3 1AR82 1BBT2 2MEV1 1TME1 1V9U3 1HRI3 4QPGA 5ABJC 5K0UC 1OHFA 4QPIA 1RUI1 1R091 3LOBA 1VBE1 2PLV2 2R073 4RS5B 1NCRC 2RMU2 1PVC3 1PO12 3J8F3 5BNPA 2BFUS 5A32A 4RHV3 4IV3B 4CEYA 4RHV2 5D8AC 3ZFGB 1E57A 4JGYB 3JBG1 1GFF2 2HWB3 1COV2 2ZAHA 1RUI2 1RUF3 1AL23 1DDLA 3VBRB 1AR61 1PIV1 3VBSB 4GH4A 1AR91 1VBA3 3VBUA 5C9AC 1FMD1 2R042 4QPGB 1RHI2 1QJX3 3VBOA 3ZFEC 4QPIB 1AYM3 1QJY2 1HXS2 2RS11 3JBG2 4RQPC 3M8LA 2X5IA 1RUE3 2HWF1 1PO23 1OOPA 2XBO2 5BNPB 1RMU2 5AC93 4GMP3 2HWD2 5A32B 2VQ0A 1AR62 1NOVA 4CDXC 1PIV2 1VBD2 2BFUL 1R081 3JB4C 4Q4X3 1RUJ1 4AEDB 1AR73 1WCDJ 3TN93 1HQNA 5C8CC 1AYN2 2WZR2 3DPRA 3VBUB 4CDUA 3VBOB 2BPA2 1RUD1 1M06G 5BNOC 2IZWA 1RUC1 4IV1A 1ZBA2 1R1A1 1NCQC 2R062 4Q4Y3 4QPGC 2HWE1 1OOPB 4CEWA 1ND2A 5FMOS 1TMF2 4QPIC 1EAH2 1D4M1 1FOD1 5DDJ3 1VBB2 1ZBE2 1MEC1 1BEV2 2WFF1 1QJU3 5JZGA 4N53C 1VBC3 1F2NA 5BNPC 2FZ1A 1H8TB 1HRV3 4FTBA 5ACA3 1RUD2 1ASJ3 4RR3A 1SMVA 4GB33 2RM22 1VRH3 1QQP2 1Z7S1 4AEDC 2RS53 3DPRB 1RB8G 3JB8A 4CDUB 1FPN1 1C8M2 3JD72 2GSYA 1NA1A 1ND3A 2RS32 1AR83 1BBT3 4IV1B 4FTSA 1V9U1 1HRI1 3VBUC 1RUG2 1EV12 1POV3 3VBOC 1ND2B 1MQTA 2PLV3 2HWC2 4YVSB 1X36A 5CFCA 2ZZQA 5FMOL 1PVC1 1NY71 2RMU3 1Z7S2 3J8F1 5JZGB 1OOPC 1PO13 4YVWC 5BNNC 2RR12 2WS92 1RVF2 4PDWA 3NAPA
chains in the Genus database with same CATH superfamily
2ID4A 2CYFA 2GN3A 5FZ3A 3V0AA 3AK0A 2JG9B 2MEV2 5A3WA 1TME2 2WC2A 1LRHA 2OXBA 2Y6KA 3AJZA 1COV3 3SH3A 3RRDA 5F3EA 1SPPA 2R32A 4RGAA 1VBE2 3POIA 3ZVXA 4AVVA 3ACHA 2G9GA 5FYUA 4UFLA 1SLIA 1ST8A 4W8JA 4ISRA 5LRRA 1NE6A 3U10A 3ZFFA 3O1VA 1VBA1 4AHYA 1NA1B 4K7JA 3AZYA 1DGWA 4N43C 5F7UA 3WX5A 1UOGA 2JD4A 5E88A 3MPPG 5FZIA 2R043 2BW8A 5CFDA 1QXPA 1AYM1 1OQDA 3THPA 2D98A 3MIFA 4MXWA 3W59A 4BQWA 1CX1A 3DUIA 3IDAA 2XMLA 1CPNA 5LK7B 4LO4B 4YW3A 1LR5A 3LDBA 3BCWA 1KDKA 3NV2A 4PIZA 4FOVA 3VD3A 5E1RA 3KV6A 2P34A 3GHMA 3PUSA 1HN0A 4S2DA 4W65A 1F5FA 2JXAA 2VVDA 3EHKA 2HWD3 4FT8A 5GLZA 3VZMA 5K9YA 3I7DA 4NO4A 3M3OA 1SQ4A 2PXJA 2XL9A 2NMNA 4LBLA 3WEZA 4QDQA 1ZRIA 2JDZA 5C33A 2PHRA 1GSLA 1OVPA 1NT0A 3JQWA 3POBA 4INDA 1Z78A 4Q4W1 4XDPA 2W1SA 4XUNA 3C7HA 1FMD2 1JOBA 4UI9L 4QXHA 4HXCA 4Q4V3 1DG6A 2RDRA 2QBXA 3PVOA 4G4FA 4V2WA 5LA0A 3IWZA 1F15A 2RS12 4GULA 4X8NA 4QD2A 2JG9C 2RDSA 4JCKA 4N9HA 1O3SA 5IVEA 4P00B 3BOPA 3LD8A 3O0XA 3IPVB 2VOXA 3ROUA 1PGW1 3H7YA 4QAWA 3PNAA 4HMZA 1DQ5A 5HV4A 3NO8A 1OURA 2VZ3A 5D8AA 2WQ8A 4WM7B 1LGCA 1GQPA 4UOJA 3HD8B 3AX4A 2XWJB 2P2KA 4Q0SA 2GC3A 4QHZA 1T2XA 2Y33A 2R063 4LHSA 1W6OA 1RUH2 1A3KA 3CIHA 1OUSA 5DDJ1 3WVJA 4LIUA 1DGLA 3PVNA 4DRVA 3KZ4C 3MIHA 1V6IA 1WD3A 3LFMA 3LPFA 1VBB3 3M3CA 4ATFA 4CCOA 2KR2A 2JECA 1OI6A 4UFHA 2YB7A 1ACCA 3AYEA 3NKTA 3ZOIA 5C9AA 1GZWB 4BB3A 2VW0A 3FHIB 5FY8A 5K0UB 1LHWA 3EJKA 4FAGA 4JDOA 2P17A 3KD4A 2ZEZA 1JYIA 1TEIA 2VR4A 3SLIA 3O1PA 1VB4A 4NHXA 2VCAA 3LEGA 2Z42A 3AFGA 4IGQA 2C4XA 3FUOA 3ABZA 4KG8A 3W9AA 2FDHA 5GJ6A 2HWE2 2YZ4A 2KXLA 4XURA 3I3MA 1FOD2 1QOOA 5A6QA 4CDXA 1N1YA 4WVWA 4OZXA 4LT5A 1SLTA 1F8VA 1NXMA 1BBT1 1UZVA 1S2KA 2P6HA 4QKDA 2AENA 5J36A 1L7QA 1CPMA 4COVA 1URXA 1W6MB 3JU9A 2WNVC 4FPGA 3N3HA 1EV13 2XUMA 1GQGA 2JD9A 4RSUA 4Q0VA 3DN7A 2W39A 2WIIB 1V6OA 4OI4A 5FY7A 4CU9A 2ZGTA 2YDEA 2HWC3 4HPKB 3K77A 3PTRB 2XQXA 2RMU1 4A3XA 3I59B 4AI1A 2OKXA 2CY6A 1JZ3A 1RITA 1HLCA 4V2VA 1Z7S3 4LHLA 4P02B 4GWNA 1C4RA 2DUOA 2WT2A 4Y22B 3WZ1A 2GC1A 2ORXA 4RFT0 4I09A 3ZFEB 5BNOA 1FPN2 3B9CA 2QKDA 4RHV1 4B7EA 1IS5A 2VUDA 4FBFA 1AXYA 3IMNA 1JZ6A 5J7MA 5FPLA 3I3DA 1V9U2 1HRI2 1YJLA 4A7KA 4BWOA 5IT6A 2YROA 4K8RB 1CESA 2KA3A 1BHGA 4QWNA 4YGCA 3WNKA 4KNCA 1R093 4LQRA 3ILFA 2WFPA 2ZGQA 2A6WA 1PZ9A 3AP6A 1VMHA 3CJIA 5A33A 3U07A 5KWRA 5A7PA 1ZZ8A 4UFKA 2Y0OA 3MF6A 1PVC2 1V0AA 3DEMA 2BDRA 5H9QA 1UOJA 3H1WA 1UY3A 4NRQA 4QX7A 3W5NA 1O3TA 3HNMA 1MVEA 4XPVA 5EV7A 1DGWX 2VQUA 1GQHA 2BZDA 4LBNA 5L7OB 4LLOA 1RHI1 4XDQA 5A7NA 3RI8A 1W2TA 4M4RA 5FMDA 4COWA 3W5MA 2XJSA 4PI2A 3D8CA 2R1BA 4UW5A 5T3NA 1H4HA 3RI9A 1US3A 4N9IA 4PLMA 1CAWB 1ZRCA 4E4HA 2DVBA 2Y0IA 3M1HA 3I2HA 2XBO1 4J25A 3AP5A 4QX0A 4XOGA 4UF0A 1W6NA 2R49A 2VZVA 4EV0A 3M3IA 4AVSA 1VAKA 1JI6A 4R9DA 3U11A 4CUCA 1D7PM 2WKKA 1S2EA 2GH2A 4FFGA 1QXRA 5LY2A 4OHZA 2WBKA 2DBNA 2R0FA 5JZGC 2FDGA 4NR1A 1VBA2 5EXOA 1AR93 1NCQB 4NN0A 4Y4YA 2R1DA 2WT0A 3BPZA 4XXAA 5I8SA 1AYM2 5T5JA 4H2AA 3I49A 2XQRA 1WBLA 1NCRA 2LW8A 3LE0A 4ZONA 4YM2A 3KM5A 3BKZA 4C1XA 3NWKA 5BXXA 3I2KA 1XU2A 1RXFA 2OUJA 3CF6E 1OA4A 3N9NA 2DUPA 2C9AA 3PVEA 4LBQB 1RTVA 4UYBA 5DG2A 5APAA 2BBAA 4B4QA 5BNNA 1ZRFA 5JAXA 4YYOA 1OQ1A 2WWUA 1XNBA 1ZZBA 2E63A 1JYNA 5JPMB 2GMPA 3VKNA 1ZA7A 2BVBA 1ZBA1 2MPFA 2VTXA 4IEWA 2SBAA 4Q4W3 3NV3A 1IG3A 4BQ5A 5L7OC 2JG8B 2JDMA 1TMF1 1V70A 2DTYA 2W1WA 4OULA 1CN1A 3O12A 4IE6A 1YJKA 4UWDA 3VL8A 1ZBE1 3ZYRA 2WLPA 1JN2P 1SG3A 4Q26A 1SHWB 3AMPA 2FZ2A 4YWAA 5CFCC 4L92A 1FNYA 4N43A 3SMHA 4AXOA 4C0BA 4QHBA 3H8UA 5L36A 5F32A 4I0AA 4AGGA 3C2UA 1GYKA 1PGW2 3ZN5A 2OVUA 1S0EA 5FY9A 3E97A 1D0HA 1QJZA 1UIKA 4HKOA 4AVAA 3WF0A 2EA7A 3ZXEA 3AKSA 1CJDA 5FAXA 4C90A 1KQRA 2VUCA 3VDCA 3ZYJB 5HI0A 3MIDA 2QDRA 1QQP1 2ZEYA 3BOWA 3CQOA 1R1A3 1UQXA 1W39A 2DVDA 4KI5M 4XE9A 5DDJ2 3MIGA 1DGRA 1IGOA 1OXCA 2FD8A 1O3QA 1D4M3 4YVWB 3RDIA 2VCMA 2ET7A 1GOGA 3FWEA 1YC61 2RS31 5CNAA 3KS7A 4NROA 5A3TA 2NPIA 1K5MC 1WGPA 3MICA 3S5QA 5CKNA 4AFDA 3KHCA 4FAHA 1Q5OA 3T0DA 3P1IA 5JOYA 3NMBA 1H2MA 2A71A 3VBHB 2H0VA 1C28A 5H9PA 4XIKA 2NP0A 1W03A 3MPBA 3EYPA 4LBKA 3WV6A 1SACA 2ATFA 2AEZA 4C1WA 4FOYA 4LBQD 1KEXA 4CZSA 4YW7A 4L0PA 2FCVA 3P3NA 1H4GA 3F95A 3ILRA 4Q8KA 4XJWA 4NE9A 3WDWA 2EICA 4GMP0 4GWMA 1EYBA 3WQ1A 2VOKA 3LEMA 3MUY1 4DNYA 5EFUA 3BUCA 2NM1A 1BBT2 3C7EA 3FLTA 2F4PA 3LPGA 1VE0A 4EWDA 5T5PA 5ABJC 2W95A 4HKWA 3BYWA 4I0BA 5G05L 2VOTA 1RUI1 4QPYA 2GNTA 2Z5WA 1PZ7A 3NJZA 1UXZA 1OH4A 2OPWA 4NRMA 5DN2A 4LE4A 4CCCA 1LEDA 1V6KA 2PHTA 2RMU2 3K2OA 4HK8A 1C5IA 2PHLA 3BPSA 4MSVA 4NUBA 4COZA 3J8F3 4FFIA 4AVBA 1I5ZA 2BFUS 2EXJA 5T55A 4XQWA 5A3LA 3GNEA 1W8UA 3M70A 1RGSA 4DXSA 4Q29A 2VNGA 4P14A 4UXAA 1LOGA 1YCIA 2DBIA 2XLAA 4FO9A 4RHV2 2OYZA 3I2JA 4LPLA 2BV4A 1JU4A 1W9YA 3VDAA 5JUVA 4P9GA 1FX5A 2HWB3 1H9PA 2ZAHA 3BU7A 3PL0A 2ARAA 1CQ9A 4KGQA 2PAEA 1XNAA 2HEYF 2OT7A 3OGJA 4DIQA 3VBRB 1X8EA 1GLHA 1UYXA 5DZGA 1S0BA 3VBSB 1IPKA 3S5AA 3VBUA 2WNVA 4IQPA 3L2HA 5LBFA 3CJXA 1IQDC 1XU1A 3RZZA 1SZBA 1RHI2 1QJX3 5FMBA 1S0FA 2PA7A 1X9TA 5BNQA 2DCJA 4XFBA 2A1XA 3JBG2 3JCIA 3M4FA 4AFMA 5FPAA 4AI8A 1RUE3 5GLUA 2XBO2 1W8ZA 1LHVA 2Y6GA 2XKOA 2QQNA 2QFEA 2VMEA 3HNYM 1Q8OA 4LO7A 3ENRA 5AC93 3AZZA 5BNPB 2DCZA 2VQ0A 3NNMA 3QOPA 1AJKA 3AC0A 2Y6FA 5LA9A 1GZWA 2ARCA 2VNRA 3HPNA 5FY4A 3RMYA 2ZX0A 4Q8LA 4RN5A 2J1UA 3PIJA 2GALA 3SH5A 3ZXDA 5FQ0B 2VO5A 4A44A 4DY3A 1W8WA 3WF3A 2E26A 4YZ2A 1HQWA 1ZYBA 3V65A 1JXNA 1UX6A 3AZVA 2B42B 1VP6A 2K9ZA 3IAQA 4KBBA 5GZDA 4YPJA 4DUVA 4CXYA 5F5AA 2WO7A 1AR73 4TLFA 3UYJA 2YG0A 1WCDJ 3MYXA 5LBEA 3K75B 1H2NA 5FWEA 4MADA 4Z2AA 3B69A 3WCRA 5C8CC 2WN2A 1PNGA 4OI2A 4L97A 5JXGA 2Z4FA 5C3PA 3NV4A 4XHXA 1JW6A 5A7WA 3ZYFA 3TOJA 2VMDA 2XJVA 3VBOB 1DZRA 2QZ2A 3THTA 1WA4A 4XF3A 1ZBA2 1WMEA 3NRUA 4MLOA 1Y9QA 2VGDA 2ILMA 5K4LA 2GNMA 3MZHA 1P8JA 3HN3A 1TMF2 3GZUC 2WNUB 3UNPA 1MZEA 5CKQA 5LB6A 3RYRA 5IK7A 2PYTA 1ZBE2 1MEC1 5ANQA 1RC6A 3I59A 1TZOA 4K20A 4DOUA 4HVQA 1QJU3 1I1EA 5JZGA 3PJQA 3WNOA 1YHFA 3OGRA 4XQDA 5FZKA 1JU3A 5GLWA 5BNPC 5ISLA 1H8TB 1WMXA 5A6YA 2JDYA 3AL6A 4XFGA 1HRV3 4PI0A 4Y3OA 1JZ4A 5FY1A 4JDMA 5ACA3 1RUD2 4MUVA 3KWVA 3SEPA 5JVVA 1SEFA 1TVGA 2BYVE 3Q8CA 4B1LA 3VHNA 1HN1A 3ITQA 2VZOA 1LEMA 1QQP2 4MGYE 4BYYA 2QJVA 4KG0A 3T3YA 1H8VA 4H7LA 1HIXA 1N1VA 3AVSA 4OLLA 4EE2A 4WVVA 4KH9A 3WNPA 4WVMB 4CDUB 1EUTA 1SCSA 5J09A 4M0NA 2W94A 3ZPYA 4MGKE 4PCRA 1O8SA 2RS32 3PHMA 3SH4A 4FTSA 2VW1A 3WQ7A 2TEPA 3MGUA 1MPXA 1DYPA 3VBOC 2E53A 4YFZA 1ND2B 2WNOA 4U2AA 3SXWA 3VV1A 2QE3A 2BNOA 4Q0PA 5CFCA 2PHDA 3BALA 3HJRA 2YXSA 3EXUA 4ARYA 2RE9A 2L9LA 3MLJA 4BLJA 2DYCA 3SHRA 1PO13 4HFSA 4HVOA 4LA2A 3SCGA 1BVVA 1Y9GA 1W28A 5DXDA 2HJIA 1D2SA 3MHZA 1YQ6A 3IM0A 1XNTA 4YGDA 4TWTA 3ZKUA 4Z82A 1H8TC 4RR3B 3OYWB 2LALA 3ST7A 4E8DA 3MV01 2VBPA 5FJHA 4BXSV 1RUI3 3KMHA 3OEBA 3R4SA 2FCUA 4HLTA 1ZA4A 3ZR5A 1B35C 1OPOA 4P08A 4QXBA 3AKRA 3GBWA 3PJYA 4KU7A 3POWA 3VUOA 1NLRA 4W50A 1K5MA 4FXKB 2YGLA 1XSQA 4I02A 3TEZA 1ND3B 1PK6B 3QH6A 1XC6A 5IVFA 3I2GA 2OZJA 4COYA 3N9QA 5JOZA 2MNGA 4CDUC 2BU9A 1YUDA 3NVCA 4A41A 4Q1RA 1VAMA 1XQNA 3AKPA 5FZOA 5CB7A 1QJY3 3WF1A 3WW2A 4AI0A 5I93A 4XABA 4FOQA 1MQTB 4RFRB 2BTVC 1YWKA 2WWSA 2ZGRA 3IIAA 3PDQA 3GYDA 2LRPA 4LMFA 2XLGA 1CR7A 2ERFA 3IN9A 4HZFA 4BIOA 1DCSA 3K4ZA 1HV0A 2JENA 1XYPA 1ND2C 5FYHA 3OGSA 1OA2A 4XW3A 3VN4A 1ULCA 2CGPA 2BEOA 3KQ4B 4DINB 1UY1A 2YU2A 2XLFA 5KR7A 4LA3A 3AMNA 3WG2A 4OCTA 2CNAA 1X33A 1DBNA 1N1SA 1W8TA 1XRUA 3NAPB 5EQUA 5ABJA 3OBTA 2B4KA 4FPJA 5DG1A 5IW0A 4BMBA 3POFA 2JB8A 4KWUA 3NJXA 4OQ9A 3I2DA 4JTOA 4IV3C 1RUH1 5T5LA 4GKYA 2TBVA 4AOCA 3ES1A 3CEWA 3T2OA 1KJLA 4Y5TA 1AJOA 3JZVA 2W5FA 4JGYC 5FZAA 5HCBA 3TN91 4CDQB 1AYN3 4UBHA 4BXFA 3E5XA 4OHYA 2WZR3 2AYHA 1S0DA 2OIIA 4B8EA 1A6CA 4ZPIA 4AW7A 1XNDA 1ZRRA 1UU4A 1XJAA 1WLWA 3BN6A 5IK4A 1PK6C 1LECA 2BUKA 3N9MA 3BIWE 4BOWA 4Q4Y1 5C4WB 3ZDVA 2X5IB 3UV9A 1YQ2A 4FXGB 4KWLA 3T4VA 1VPHA 3ZM8A 4K21A 4CVUA 4UFIA 5GZCA 2PHXA 3USUB 3DXUA 1BEV3 4PF5A 5F8PA 5GKAC 5LK5A 1VMFA 1H0BA 5D2AA 1Q8SA 3H9AA 2ADDA 2Q1FA 3VDDB 5BY5A 3POGA 2F4LA 2B5HA 4ASMB 3ASIA 3I2IA 1V6LA 3OPTA 4KU8A 1E5RA 3KQRA 4OFGA 4G3YC 1UNBA 1IS3A 3MIBA 4MHUA 4WM8B 4ES8A 3RZLA 1ASJ1 1ZNPA 3R05A 2EXHA 3AXDA 2KM2A 3J9SA 2VOVA 1I5PA 3NSTA 2WO2A 4GB31 3VD4A 5LRSA 1GKBA 4YW6A 2RM23 3KB5A 2QQUA 1RJ8A 2QUOA 2B45X 2Z79A 5K7PA 2RS51 1NAEA 2W92A 4DZGA 2ZEXA 1CIWA 2QQIA 1IPSA 1CAVA 1WW7A 1MEC2 2ZPXA 1GMMA 3J7LA 2LTNA 2WT1A 4DB5A 4CDQC 1G6NA 2IXJA 3BTYA 2O0OA 2YHJA 4D3WA 1CD3G 1LNSA 1RUG3 3PUHA 4JGZB 1CAXA 1PX4A 2GH8A 4NIIA 4DEQA 2J1EA 3H7JA 1HQLA 3IIIA 4Q2FA 1GBGA 4CDWB 1OLQA 1DP0A 3LZZA 1OLMA 1F4AA 5I8YA 3HT1A 1AL0G 1KXGA 4XJ8A 1JUIA 2A3WA 4ARXA 3H3LA 1X7NA 5C8CA 2C0ZA 2VQAA 1MS1A 5C4WC 3V0BA 1AHSA 1J3PA 2X5IC 4Z1VA 4M4PA 3TAYA 1YO8A 3UESA 3SEEA 3VHOA 2RR13 1GOFA 3VD7A 3VDDC 5F3GA 2WS93 3NKGA 1H6YA 3NNJA 5FP8A 3I3EA 4RQPB 2W47A 4QB2A 2XH6A 4YFWA 1H6XA 2MEV3 2G19A 1TME3 3LA7A 2HLEA 3N9OA 3RZHA 2E6VA 4AHWA 4WM8C 3D4KA 2R072 1VBE3 4IEOA 1ULEA 4K1ZA 4CCNA 2UYAA 5FPVA 3WINE 3MI8A 3QCWA 2HEWF 4XFIA 2OA2A 3OY8B 3OBAA 4AFBA 1XPWA 4EN6B 5JPNB 1K45A 2BNMA 2C9KA 4GWJA 3TEXA 1O5LA 5LBBA 3DPRC 4LKDA 1UPSA 4AF9A 1NXD1 4IEVA 4PT6A 3S6PA 4XCAA 1HXS1 4PQ9A 5C70A 3D82A 1F5JA 5EJ1B 5C8WA 5FWJA 4IV1C 3FMGA 3N9PA 5FZLA 5JWPA 4A4AA 4JGZC 3ZYGA 1HV1A 1W6QB 3MW3A 3H3UA 4LJHA 2CAVA 1RMU1 5IAXA 4CDWC 1YNAA 2ORZA 1E5IA 4MXVA 3LDRA 1VBD1 4UFJA 2FBEA 1W9WA 5HCFA 1HJGA 1TE1B 2UY8A 2VVEA 1GICA 4ET7A 2A75A 1JYXA 1QKQA 4FOWA 1MS8A 3T2PA 3M3EA 1FMD3 2AREA 2Y6JA 5EHDA 2BWAA 2Y34A 4AR2A 1OKQA 2LM3A 3WW3A 1GZCA 3IDBB 4XDOA 2AR6A 1KS4A 2RS13 4N53B 4CCEA 5CG8A 3H3ZA 4GWIA 3G7DA 4S2FA 1WCQA 3VBFB 1MZ6A 2JKBA 5LCWL 1ZZCA 3AM2A 3U1XA 1UPIA 1LHNA 2QQWA 2ZEWA 3K4DA 4RYDA 4A2UA 3MUZ1 4E2QA 2MHFA 2ZHLA 1M4WA 2O14A 2W1UA 5H9RA 2XJQA 4J6GA 4MX3A 1US2A 1H8TA 4QM9A 4XFFA 4ZU7A 1DQ6A 1NA1C 4FPLA 5FOJB 3CNAA 3O0VA 4Q4V2 4DMIA 4XMIA 5GLVA 1EAH1 1B35A 1RUH3 4RGKA 1XOYA 5M0TA 2Y6HA 4IEUA 3SISA 5DAWA 2VECA 2PN5A 4K8FA 4LUMA 5DAQA 5GZEA 3TN92 3UKTA 1K3IA 3AP4A 3FC0A 2VM9A 2YPJA 4HG6B 4LULA 4NIDA 2X10A 5FKBA 1U12A 1BJQA 5GLTA 3T4HB 1S2BA 3D3AA 4D7SA 4MG2A 4MV2A 4Y4RA 4Z8BA 2UY9A 3KLSA 1J3QA 4BCUA 2VPVA 3TB0A 4XJUA 2YPDA 2UWCA 1Q8QA 1YFXA 2JDNA 4IGPA 4Q4Y2 3LSEA 4QHOA 4EWEA 4I01A 2J22A 4XFCA 2HWE3 4AVCA 3WQ0A 1U5XA 4W6YA 1FOD3 2FDIA 1QXJA 1T6GC 3AMMA 1C8M1 3JD71 2VMGA 5JMCA 1YIFA 2Y26A 5FZCA 3VBFC 2PHFA 3PURA 1N47A 3IDEA 4XHBA 5FZ4A 4R8HA 3H8OA 1RUOA 4NWVA 1NKGA 1JODA 3VKOA 4IV3A 3BIEA 1WD4A 1DQ4A 2VY0A 1Q3EA 2CDOA 4WM7C 2FHRA 3GBFA 1X50A 4JGYA 1ASJ2 5FZDA 2Q8EA 4GB32 4OHXA 1HB1A 2E7AA 5DUWA 1LOAA 4R9AA 3WNMA 2GMEA 4XBLA 1U5IA 3BTXA 2WAAA 2VCBA 2RS52 3Q8AA 5DAXA 4F3JA 4FP2A 4LO6B 4NWWA 4L9BA 1GUIA 2D3RA 1RVF1 1FPN3 2OW4A 4K3UA 3VGIA 1YQCA 4PF1A 5FOBB 4Y26A 3MW4A 1GZTA 1LOCA 3E5UA 2DVGA 4DS0A 1R64A 1G9AA 1V9U3 1HRI3 2WINB 1UY0A 4QPGA 4DUWA 5K0UC 5T52A 4AE2A 4QPIA 3N36A 4GXLA 3J7MA 5C3QA 4RS5B 2A3YA 5EIYB 2BJSA 4CCJA 1W2NA 1B09A 2BWCA 1A8DA 2ZHNA 1UZZA 2YGMA 4Y1VA 2UWAA 1O4TA 3ZXLA 4DFSA 5BV6A 1PVC3 1DHKB 2HYKA 4LHKA 3BB6A 4XBNA 5IATA 5A32A 1JZ7A 4XJZA 3T1LA 3B3QE 2BGCA 1ZM1A 4QX5A 3VD9A 2D7FA 4JHZA 3GCXA 3D5OA 2W68A 2ZMKA 4PLNA 1QNYA 2JDPA 3ZFGB 1E57A 3WUDA 3JBG1 2DCTA 2FMDA 4M3CB 4GJYA 1RXGA 1ODNA 1TNFA 1NLQA 2WR9A 4ZU4A 5FBJA 2W91A 3ZYHA 1UAIA 4CUGA 1W2AX 2JEMA 2C1FA 3I4IA 4HT1T 5DUXA 1AF9A 4AGRA 2Z2SB 1LESA 4FPOB 1E5SA 4J1WA 1G9DA 2X05A 5DMYA 5E16A 1VBA3 2YYOA 1KITA 2E7QA 2WSVA 1UMIA 2EIEA 4AQTA 1DLCA 4Y1ZA 3ZFEC 4EQVA 3ZPOA 1AYM3 3T2QA 3I3BA 1HXS2 3CMGA 3GM8A 1W6PB 2XVLA 2B46X 2X5IA 3WF4A 2CTVA 2HWF1 4ONUA 4S2GA 5T50A 1DIWA 1REDA 5A3NA 5KXDA 2UURA 1RMU2 4Y20B 5FP3A 1AR62 4ZXKA 1PIV2 1VBD2 3Q8EA 4XQ4A 2XR4A 2VULA 1ULFA 2QQLA 3E6DA 3HOBA 5FLIA 1R081 1DGRN 5FYSA 3ACIA 5A6XA 4P5HA 4A42A 1RUJ1 1L3JA 4AEDB 3HQUA 4I3GA 1CAUB 2Q0AA 3CO2A 5FRAA 1UWWA 5CYYA 4QX2A 3U14A 1BZWA 1JBCA 2ZABA 1WLDA 5KC5A 3E5QA 1XYNA 2LS6A 3ZXFA 1GR3A 2D3SA 3N9LA 3PUIA 3DPRA 4UAPA 1SCRA 1N3QA 1NQJA 4BPZA 2ZMNA 2F17A 5FXZA 2UU8A 4QKNA 2D6MA 1RUD1 1GP5A 2D6LX 1RUC1 4IV1A 1QEXA 1MS4A 3ZLIA 1NCQC 3HT2A 5GM0A 5FLHA 3D0SA 1OOPB 4KWKA 5L19A 5FMOS 1QHDA 5JOWA 4TTGA 1EAH2 2OUHA 5DDJ3 5FPXA 3O7OA 4KMQA 1VR3A 2WZ8A 1LHOA 1WLCA 1LGBA 4R9CA 2WFF1 3NL1A 5F5QA 2C5DA 5FZ1A 2WZPP 3WNXA 3FX3A 1F2NA 5IK5A 4NPMA 4CPBD 2VD7A 3H50A 4FQZA 5H9SA 3RVHA 4FPCA 3CKHA 1LB2A 2Y8KA 3FL7A 4FTBA 4E9KA 2IFWA 4I3PA 4CP0A 4HN0A 3OGGA 3PUQA 4CSWA 3DYOA 2CGNA 1W06A 1ZZ6A 2JG9A 3LSDA 3AB0A 2WYSA 5KBFA 2JG8C 4IE7A 4AEDC 4MVTA 5KHKA 1NX9A 2VBBA 3TNPB 2QQOA 2EAAA 3OY8A 5EPAA 3K3OA 3RQ0A 1C8M2 3JD72 1F31A 3HQRA 2VJXA 1G8WA 1NA1A 5LW9A 1BBT3 5KHIA 1KGYA 1GWLA 1J84A 1EPZA 4RGGA 5DZEA 2EXIA 1FYUA 4ZS3A 2ZKNA 1FATA 2H6CA 5D21A 3TYJA 1WLTA 4MYEA 4YVSB 1XE8A 3FBYA 3WCSA 2OX0A 5JLVA 1O91A 1VLNA 1ZX5A 3UJOA 3OF1A 2V4VA 3H8RA 2RMU3 1JHJA 1OOPC 4FFHA 1W3VA 4AFAA 2XDVA 3VHPA 4YVWC 4CP2A 3WF2A 4HL0A 2OQ6A 4CP9B 2P1BA 3CL1A 1RVF2 2D6OX 4AI2A 4RHV3 1HW5A 1T6BX 2VNOA 4K9SA 1WCSA 3FZ3A 2VMCA 1Y7BA 2VZRA 1MZFA 1RUF1 3MV11 1AL21 3VBHC 2DFCA 1U5YA 3S0MA 2XUEA 3ZXGA 5CZKA 3ZMOA 1UYYA 1UOBA 4K6BA 1AXKA 5FY5A 2DV9A 3N35A 4XAEA 3VBFA 3WDXA 1D2QA 1ZREA 2J1AA 3IPVA 5B4XA 2IXIA 4XAAA 4LK7A 4NPLA 5KXEA 5C5UA 1JOJA 4Z07A 3LCPA 4GAZA 4WM7A 1RHI3 4FSJA 1KFXL 4IGOA 4FI9A 2QVSB 2W52A 4LKEA 2E33A 3W58A 3BU0A 3JBG3 3VKMA 1PO21 3EQEA 4LBMA 1G7YA 4Y5SA 3R4UA 2JDUA 3KVBA 2XBO3 4EN8B 4CP1A 4AL9A 2XB6C 3POJA 4GMP1 3ZXAC 3LF7A 1AX2A 2AEYA 2GC0A 4FP3A 4NHYA 4YVSC 4JKLA 3FHQA 3NNLA 4ATEA 5J48A 2QQKA 1NYWA 2RG4A 2Q30A 4CEYB 4PDWB 2IFRA 1JUHA 3ZN6B 4XJ9A 5K0UA 4YG0A 3V0AB 2K2SA 4XFAA 4XIOA 3SNMA 3ACGA 3KVAA 5DQ0A 4OYUA 2IXLA 4WZCA 1W9SA 1POV0 1SPPB 4P9IA 3RS6A 3UKVA 3AYCA 5B4NA 2HWF2 3RMXA 3VD5A 1A8MA 1AZDA 4LEJA 4OI1A 3BVCA 2CU5A 1SLLA 1ENRA 3IB3A 1O4ZA 4META 2VE1A 3RWNA 3VBRC 1G9CA 3A7QA 3GHNA 5JIUA 5CFDB 3KF3A 1ONAA 4N8MA 4MXWB 5FZ0A 1VIWB 4JZRA 5FTTC 2IWGB 3T0AA 3VBSC 4Z92B 1W6MA 1ZBA3 1OLME 1HJFA 1R082 4IDZA 1W3XA 5A80A 4LKSA 4RA0A 3GCWA 1RUJ2 4NIAA 4EWAA 1TMF3 3UGFA 3N7JA 3UGHA 3OTFA 4HPKA 3O1OA 2QQPA 4AFCA 1ZBE3 4AHZA 1CZVA 4R4XA 2NZ9A 2WN3A 3DF0A 3VZJA 2D6NA 3OGVA 4E2GA 4OI0A 3WLUA 3MFAA 5FDBA 4Y24A 3UL2A 4Y22A 1NZIA 1Y3TA 2PAKA 1RJ7A 2VZTA 5FZBA 5JR2A 3AYDA 1LCLA 5F5CA 3ZFEA 2XONA 1IS6A 1PMHX 1EPWA 1WW6A 4CTEA 1RUD3 5C6CA 1G9FA 4CEYC 4XMAA 4O65A 1RUC2 4WBBA 2PFWA 2VQTA 4XUOA 5FXWA 2A6VA 3SQOA 1PVXA 4JX0A 1VRH1 3K4AA 4CXXA 4BMEA 4DQAA 1VAVA 1K12A 3AKTA 1QQP3 3IT8A 4YGEA 3RJ2X 1W2OA 2B39A 2ZA9A 4JHTA 1WZXA 3S30A 2XHNA 4IL7A 2VG9A 3HEIA 5IVJA 2XOMA 3MFCA 3D0JA 3DKWA 1F4HA 2WFF2 2VTFA 4OZOA 3WG1A 3WY6A 5D8AB 1AR81 3I2OA 2YV8A 2RS33 5FO7B 3WG3A 1UYZA 1DU3D 2ZGPA 5L7OA 1NG0A 5JMOA 3B00A 1V00A 4ITCA 1W6OB 2D3PA 4IXLA 4IUGA 4Y33A 4FPEA 2PLV1 4CEWB 2WAOA 2R071 1CAWA 2VBDA 4M3CA 5CA6A 4OQ8A 1KFUL 1TNRA 1MS0A 2CWSA 5IVBA 5DZFA 5GZFA 3A0KA 3EMRA 2UYBA 2WNUC 1U5ZA 3KT7A 4TXWA 4GA9A 4M3CF 3WDUA 2D6KA 2RJKA 3AZXA 4A6SA 4W6XA 3WW1A 5JI7A 2IVIB 4WV8A 2WA3A 3S57A 2D5HA 2WQ4A 5JIAA 3G6JB 4FPKA 4CPBA 1OT5A 2ZX4A 3E6CC 3ALQA 1NCQA 1ULPA 1OVSA 4BQ2A 1IHMA 1COV1 1LULA 3VL9A 2EVXA 2Y6LA 1OBNA 4LITA 4TLGA 1PHMA 4RL7A 4XCBA 3ME2A 1YQ8A 1S0GA 4CDXB 2AH2A 3AYAA 4YZ3A 4LBQA 2QQVA 1JHNA 4IE5A 5F9TA 2I45A 2XJRA 3ZSLA 1AX0A 3AJYA 1HB2A 2P3YA 3BTAA 2R041 1X8MA 1YLLA 1LENA 3K48A 5EWSA 1FV3A 1UIJA 2DF7A 3P5BA 3PTYA 3T1MA 1W2UA 4JTNA 2JICA 1OPMA 2C24A 3OUIA 2JG8A 4AEDA 1J83A 3CDZB 1DLLA 4OVEA 2X09A 1RUF2 3P3PA 4LBOA 5A1AA 1AL22 4XXPA 1UO9A 5I0SA 4IEYA 2HWD1 4CEWC 4TN7A 2XJTA 3MEPA 2ZJCA 4GZ9A 2E7TA 2YMZA 1QMJA 4QB6A 2VCCA 2YY1A 3FUQA 3B9IA 5FXXA 4E8CA 1YIPA 2W9XA 5BNOB 4HKLA 5IWFA 4HBNA 4F8AA 3OD0A 3KV5A 4QX8A 1H1AA 4B29A 4ZZ8A 4H55A 4E27A 3ZYPA 5HXMA 1NZCA 4IE0A 3ZN4A 4BQXA 1IZ3A 4Q4V1 4LLFA 3O0WA 5BPXA 2JIGA 5B2GB 1ZRDA 1IKPA 3LAGA 5A33B 1H1IA 1WBFA 3CJIB 4RR3C 3S7EA 1PO22 3TNQA 4XFHA 4B4RA 1W04A 5AVPA 1XE0A 2K0GA 3AVRA 2YC0A 3FN9A 4QQPA 5J3UA 4LHNA 4D0QA 1ODMA 4O9GA 4YVWA 1OQEA 4YW4A 4MH0E 2A70A 1EP0A 4OHWA 3WDVA 4QQLA 4TZDA 2WJSA 3LIHA 2V5DA 4Y1XA 2ZGKA 1V6MA 4CU7A 5K8SA 1MVQA 1W8NA 3URFA 1FAYA 4XC9A 5DPNA 1ND3C 1YFUA 5F6LB 4P5YA 2R061 4D8MA 4NRPA 4Q4X2 5FJKA 4CU6A 3VBHA 3J26N 3IBMA 5JXIA 1G9BA 3ILNA 4BZ4A 5C7GA 5FP9A 4JKKA 1OF3A 1VBB1 3JQXA 4UF0B 3A22A 4KQ7A 4AAXA 1UF2C 2H6BA 2RDQA 3THCA 4XUTA 1MQTC 3KGLA 3ETQA 2R30A 3SITA 1UN1A 1SLCA 3KT4A 1A34A 3VDBA 4AWDA 1YFWA 1N3OA 1RL3A 4Y1UA 3TBDA 1OH3A 2PHWA 3M3QA 1JS9A 2ZX3A 4JC1A 1GP4A 1O4YA 2BVVA 1LODA 5F6KA 1WMDA 2DCYA 4OUSA 1H2KA 5FBZA 3A0NA 2AACA 4XYXA 5EJ3A 2VC9A 3NAPC 1NCRB 1QJFA 1CWPA 2GU9A 1O5UA 4U36A 3DV8A 5FYBA 2PAMA 2EIGA 2ZZJA 4YVSA 2TNFA 4YW2A 1WW5A 2XJPA 2P6CA 4MZUA 2B8MA 5BNNB 1GU3A 1Q8PA 3OOXA 2FDFA 1MEC3 3CJIC 2PMWB 4HANA 3AP7A 3I54A 4HK9A 5DUUA 1VBC2 5EZWA 3SCHA 1CIYA 3Q8BA 3NNGA 1UZYA 3ORJA 5J37A 3KV4A 1SFNA 1FNZA 4LXLA 4C91A 1EV11 2E32A 2W1QA 3A23A 4JKMA 4BDVB 5JSPA 1QH6A 4DXZA 1EY2A 2BBVA 5JI9A 2NYYA 2A6XA 3R0RA 3RJRA 4I2OA 3EO6A 4BK4A 2HWC1 2QTWB 3APBA 2AGSA 5LATA 2JDHA 2XJUA 1YI7A 4D69A 1VRH2 1C1LA 2VZPA 2XWBB 3J4UH 3K46A 4N43B 2VZUA 3K3NA 4NPRA 3FJSA 2IUWA 3P6BA 4QDSA 2KD7A 3VBRA 5KXBA 3L9JT 1GWMA 3CZUA 1S55A 2QNKA 1CZSA 3POSA 1IOAA 2B7YA 2ZTNA 3VBSA 4K40A 4X6QB 2ADEA 1W9TA 2VW2A 3ON7A 3POEA 5FMCA 3ZSJA 5CAZA 1AR82 2P5BA 5FYVA 3T08A 4EN7B 3BI3A 3WSOA 3S7IA 1OD3A 4Q5OA 1XXNA 1OHFA 2YBSA 3ETPA 5F3IA 3WP3A 1R091 4I30A 2PLV2 1H2LA 2R073 1WMFA 4D7YA 1NCRC 3SCFA 3B7MA 4MGSA 3B01A 2DDUA 2J7MA 5F39A 2JX9A 5FUNA 5BNPA 4JDNA 2VL4A 2ZGLA 1OFSA 4XZPA 3M7AA 1H9WA 4NAOA 5FZFA 1VMJA 2BGPA 1CJPA 1XNKA 1XYOA 2A3XA 4CEYA 4MGTA 3KHBA 1V6NA 1UZ0A 1DZQA 3IZOA 3AL5A 2RJLA 1QGLA 4IE4A 4QXKA 2HKXA 5FQ0A 1GFF2 4YARA 2JJ6A 4DO0A 1COV2 1HKDA 3O14A 3H1MA 1REFA 2ZHKA 4DY5A 2GP3A 3NQHA 5DAPA 2ZBJA 3I97A 4LO8A 4QPWA 2GNBA 3U78A 1AR61 3X29B 3IMMA 5E8AA 1PIV1 3FLPA 4FPHA 5I0UA 3AMHA 2Q5TA 1AR91 5FZ6A 4BA6A 2WZEA 1JYWA 4YGBA 4BLIA 5LEKA 3BODA 2PELA 5CIRA 2R042 3VBOA 2JKXA 4AHXA 3AXEA 4NAMA 3MO4A 5EYYA 3TRSB 3VKLA 3ATGA 1UU5A 1WCKA 3B93A 4RQPC 3M8LA 4ZXEA 3KV9A 2B9VA 1HDKA 4AQSA 1K5JA 2WNUA 2X29A 4YG6A 2C26A 2E31A 2ZOEB 4R52A 3U37A 1S0JA 2HWD2 4QMAA 3RFRA 1NOVA 2AC1A 4XACA 2BFUL 1J59A 3RNSA 1DZTA 4Q0QA 4HETA 2ZAAA 3PUAA 1G86A 3ZYBA 4XF9A 1DF0A 1ULDA 2ARXA 4YM3A 2P37A 2YUEA 3C8XA 3HN1A 3LEIA 4BQ3A 4CCKA 2D43A 3O1RA 1MS9A 4UW6A 2BGOA 3B94A 2OQ7A 4YM1A 1K42A 5EYXA 5FYMA 3UJQA 2VZQA 5HBAA 4AK3A 1MR5A 2BP6A 5IVCA 3TN93 4JQRA 2J1SA 1PGSA 5AVAA 2ZGMA 2DU0A 5CG9A 4PQQA 5FP4A 4ZU5A 4NIHA 3LEKA 3VBUB 2WNVB 2XKPA 2EIBA 3LGRA 4WVMA 4LKFA 5FP7A 4CDUA 5T5OA 5E6HA 1GANA 3AZWA 3T30A 2ES3A 5CU1A 1Q43A 3O5SA 1MS5A 1R1A1 2R062 2D6PA 3VZLA 4NMIA 4PHZA 4Q4Y3 5JCTA 4UT5A 1ND2A 3ZSEA 1DQ1A 4CEWA 1D4M1 3LB9A 3VZNA 1VBB2 4LBJA 1YXWA 3ZIXA 1ZZ9A 2ENRA 2CL2A 2QQMA 2BOIA 3AKQA 3ELNA 4N53C 4QX1A 4W4ZA 5FPZA 5FPBA 5FYYA 4CXWA 2IXHA 1W8FA 4YRDA 2FZ1A 4DXRA 1BVP1 3LFIA 1O7FA 3NW4A 3UT0A 4LTAA 3DGTA 1RINA 1SBFA 2CDPA 2CSGA 3U0ZA 4QKBA 4QB1A 1ASJ3 4RR3A 3OYWA 3UK9A 4BIFA 4GB33 5C3OA 2HBUA 1F9KA 3B5LB 3RZKA 2W2IA 2I74A 1OUXA 1PMIA 2R7EB 3WNNA 4AAPA 4B3NA 5IHRA 5IJRA 4E2SA 1E5HA 4LORA 2RS53 1KD7A 4LR4A 1F35A 5A7SA 4YG3A 2PTMA 3H8XA 3C3VA 2WSUA 4WVZA 5CKMA 5A7WB 3ZO0B 5IVYA 4R9BA 2V5YA 4YZ5A 3QLQA 4W6WA 2IXCA 1ND3A 1PK6A 5FY0A 4EN0A 2GDFA 1LU2A 1N1TA 3LA3A 2P4EA 3VBUC 4ZZ5A 5FR3A 5L9BA 4CU8A 1EV12 3L2YA 1LU1A 3QACA 1GNHA 4QU1A 4YM0A 3TEWA 3WQBA 3O1SA 1MQTA 2HWC2 3FHAA 1X36A 4A7ZA 5F2SA 2V73A 2ZZQA 5I91A 4IESA 3BGAA 3WUCA 2HEVF 5JZGB 1NY71 3J8F1 1Z7S2 4DRRA 5EP9A 5IFTA 1GZ9A 2BOJA 1QOTA 1W8HA 2XXZA 5T54A 4NHLA 4SLIA 4V1PA 3HBKA 3EBRA 2B9UA 3NAPA 4XUQA 1OMIA 1DQ2A 4ZY9A 1OD5A 3RG0A 2DURA 2HWB1 2NMOA 3U4XA 1XE7A 1WA6X 1LOBA 4TSVA 4EN9B 1UOFA 5SV8A 4DXTA 1YYNA 2JE9A 3O1MA 1BK1A 3ZXKA 3JXSA 1R092 2PQQA 4BHPA 1ZVFA 3J7NA 3OBZA 3MW2A 2UWBA 4Q27A 5FYIA 3H1YA 3A21A 4CDQA 2WO1A 3U4SA 4A6OA 5FLJA 3HR9A 4BISA 1RIRA 5JXHA 1QJX1 1BKZA 5FO9B 2DCKA 3I2FA 1JYTA 3LWCA 3UGGA 5IVVA 4YLZA 4P9YA 5FZMA 2XPJA 1EUUA 4HSJA 1HXS3 2WWJA 1RUE1 1WW4A 5CFCB 1UY4A 5C4WA 2RVAA 4MGIE 3HWJA 2WABA 5CISA 5A7QA 2FDKA 5AC91 1QY4A 1BMV1 1C8NA 3WHUA 3IKWA 1RMU3 2DVAA 3NNFA 3USUA 4AYUA 4JRLA 4RS5C 3ZSKA 3VDDA 1AR63 2AZ5A 3WP6A 1PIV3 1VBD3 5CEHA 3MLLA 1HB3A 1OA3A 4CRQA 1MZ5A 3CBNA 4IEQA 1AR92 2EF6A 2FCTA 5JSOA 4JAAA 5FCCA 4QDRA 4WM8A 1IS4A 1QIQA 3RPQA 2Q1ZB 1AR71 2O8OA 4PBOA 3ZFGC 4LE3A 3RSJA 3QD6A 4NIGA 3KCCA 3LQCA 3DYPA 4BM8A 4KL1A 3VHRA 2LUWA 2W0XA 2V09A 1Q56A 1JZ8A 2OZ6A 3C7FA 2EIDA 1K5MB 1VB2A 4Y5Z0 1IPJA 4GH4B 1JH5A 2CGOA 3DYMA 2W08A 4YZ1A 2Q8OA 4AQ6A 3OBRA 3WW4A 1JYCA 4URAA 3VZOA 2DTWA 5EJZB 2W46A 1OFNA 4UBGA 4AI9A 4COUA 1SBEA 4Q4W2 5FZOB 3OUJA 4D6RA 2WO3A 4JGZA 4M3CE 3O1UA 4MHRA 1C3HA 1WCUA 4P9LA 3TEYA 2C6SA 1NE4A 2Z69A 3ES4A 4CDWA 4GQ7A 1SLAA 1EAH3 2JDKA 4LUKA 4XF1A 5I0TA 3T09A 2I2SA 5L9VA 1QJU1 1D4VB 1UCXA 2A6ZA 2QQJA 3KT1A 3TWIA 1APNA 1BXHA 2PQSA 5FUPA 3WHTA 5JDBA 1CONA 3C7OA 4SBVA 1LGNA 4XF0A 3T2TA 1LOEA 1UKRA 3UKNA 5HV0A 3Q9OA 1HRV1 5ABJB 1PGL1 1PM4A 5ACA1 1LOFC 3UETA 1W99A 2NLRA 2RHPA 4JQTA 1STMA 4CYDA 5FZGA 3V56A 4RQPA 2GAUA 1PX3A 2JE8A 4HONA 1JZ2A 1H1MA 3CHXA 4C8DA 3WOGA 1GNYA 1R1A2 3ZIWA 4IEXA 2P3IA 1W9FA 2J42A 5FK8A 1OC1A 5JOXA 1D4M2 3WD5A 5A1LA 1ULGA 1C8M3 1C1FA 3JD73 2ZCWA 1KS5A 4A3ZA 4YZ4A 5DABA 1UKGA 3Q8FA 4GH4C 4G9SB 3MLKA 4ZS2A 3WXPA 5JXJA 4MGQA 1PMJX 4M00A 1ZZ7A 4BE3A 2VAUA 2Q4SA 5FYCA 5CADA 5FZ7A 2G1MA 2JB4A 3GXUA 5BUVA 3KGZA 1X82A 3USSA 2V72A 1W6QA 2VU9A 3M2MA 1PO11 4JVAA 1J3RA 3A4UA 3PLQA 1LJ7A 3KSCA 1A78A 1V6JA 2O8QA 4XBQA 1YRZA 5FYZA 4B1MA 2ZS6B 5FKCA 4DUXA 1JTZX 4AI3A 2Y60A 1WUVA 1SDWA 1RVF3 5IK8A 1BCXA 2Q1MA 4HN1A 2ZX2A 3ACFA 4EJRA 4Z2WA 2CAUA 3ZX7A 3GGLA 4P9XA 3OG2A 3INAA 1J1TA 3OUHA 5FZEA 4DPNA 3VLBB 1O59A 5FV3A 3VB9A 2VXJA 2YC4A 4OHVA 4QQ2A 1ENQA 5A1FA 4N53A 1CAVB 1RYYA 1AUYA 5C5TA 1AX1A 3ZKYA 4FQ4A 1FI2A 4PBPA 1IG0A 5J96B 1NY72 3J8F2 1C5HA 5GALA 4B4PA 2DU1A 4E4DX 1ENXA 3LIGA 1D0GA 3KCXA 4RD7A 3D6EA 2FMYA 4O7XA 1CAXB 2BRTA 2WRAA 3PMSA 4OMDA 1QJY1 4KBZA 2XVGA 4O61A 5C71A 1QH7A 5ERLA 1LHUA 4JRAA 4QQHA 4IERA 1W90A 2WA4A 5LA1A 2HWB2 2D5FA 5C8CB 3GJBA 1DQ0A 5J98B 4J1XA 3V0BB 5AFEA 3OEAA 3ZMNA 4PIYA 1XNCA 3W20A 1QOSA 2NN8A 5FZ8A 4ZHNA 1OF4A 2YC2A 1QU0A 3FE5A 5I8TA 1ENSA 2VMIA 4LIVA 4GJZA 3RWKX 4PLOA 3ZYIB 1QJEA 5HCAA 2AUYA 3HAGA 3RGBA 2J1VA 1W05A 2VUAA 4QXCA 2XGXA 1POQA 4QQOA 4Q4X1 4QGMA 1QJX2 2D97A 2R0HA 5FXVA 2OS2A 1LKNA 2W3JA 5A70A 2GP5A 4QM8A 4QT6A 2D44A 2IC1A 4BU2A 3AMQA 3WR0A 2YBKA 4AQ2A 4CA9A 5CBLA 5L9RA 4BQ1A 1QF3A 1SFPA 2A73B 1RUE2 5J1XA 5IYYA 3ZSMA 3HQXA 2JIJA 1AYN1 1SFYA 1XBFA 1Z0HA 1TQ5A 1WWYA 2HWF3 3DECA 4O9EA 4X6RB 3ZFFB 1Y4WA 5AC92 4E4SA 2WZR1 1BMV2 4FTEA 4D6SA 1FT9A 1GWKA 3BTZA 3CU7A 2ARBA 5GZGA 5ANNA 2H0BA 4CCLA 1J58A 3FFQA 4XJAA 2PHUA 5FIXA 3FBMA 1SDDB 4A45A 1BQPA 5LEJA 5A6ZA 4F7ZA 2LROA 4QGLA 4N7UA 5JR7B 3NJVA 1R083 3QH7A 4AZZA 5KXCA 2A5ZA 2X8KA 3GDBA 1RUJ3 2GC2A 3FFZA 4I0WB 4OUEA 4EZHA 1UZWA 2WNEA 1AR72 4XETA 2ZXQA 1BEV1 3WDTA 3WP4A 4XTPA 2YFUA 4DEVA 3WP5A 1AXZA 3PMEA 5FPUA 1W8OA 1VBC1 2DVFA 2GMMA 2P3JA 2VUJA 1QWRA 4QU2A 4NJ4A 2ZGOA 3HVDA 4FCAA 4BJ0A 2VXRA 5CVRA 5FUIA 4P9JA 4UW4A 2I07B 3FLRA 3MIEA 3OPZA 1I6XA 2ZHMA 4Q0UA 3NJYA 4C0HA 4L8QA 4ES9A 1W0PA 3EB7A 3KCYA 1AVBA 1HX6A 1RUC3 4PDWC 2RM21 4PIXA 4CE8A 4TYSA 2BQPA 2IXKA 2JDAA 2X53S 4QGNA 4WZFA 1CZTA 3RZMA 4AEMA 4KWJA 3OJBA 3LA2A 4RS5A 1JYVA 4CCMA 2FDJA 1C57A 1BYHA 1QJU2 4LOTA 5L73A 4QX3A 2WFF3 1UD1A 3GZAA 2VTXJ 1TG7A 4BH9A 3MF9A 3PIGA 4EYUA 3OD4A 3ZFFC 1CGPA 2OPKA 1YI9A 1SLBA 3AP9A 5LBCA 1RUG1 5FYTA 1S0IA 2HYXA 2V4AA 1HRV2 4IEZA 1POV1 1PGL2 4IEPA 2GZWA 5ACA2 2EALA 2VOWA 3R4DB 3ZFGA 1R1ZA 3N7MA 1BK0A 1IQAA 1B35B 1GNZA 1UX7A 1PM7A 1UYPA 2BNNA 3GALA 4L11A 5CFDC 1J1LA 4FPYA 4BQYA 1ALYA 4PJYA 5F37A 4AVTA 2QZ3A 1UU6A 2F6BA 3O1TA 3JUUA 4IW3A 3QBQA 5C9AB 4MO3M 5FO8B 2D40A 5E89A 4XILA 4JV4A 2EXKA 2RR11 3GJAA 5BYNA 2D93A 1ULOA 2WS91 1VRBA 5IFPA 2RDNA 2ZKLA 4NHKA 5A3OA 2BERA 4YSFA 5F3CA 2MEV1 5F2WA 1TME1 2Q8DA 1XSRA 3ZXJA 1UXXX 1YFYA 5HXVA 1JZ5A 1S1AA 2ZMLA 4XF4A 2QCSB 4HSLA 1FXZA 3LOBA 5LA2A 1VBE1 4GALA 1W6PA 2IVJA 2G9ZA 1SBDA 3RYKA 3ZDSA 5SV5A 4B7KA 2CV6A 3N7LA 4AEJA 1PO12 1VALA 2A7AA 3GZTB 2WDBA 4Y20A 2YU1A 4OUMA 1LOFA 4XVHA 3N7KA 4CUAA 3DL3A 3PU8A 4IV3B 4AGVA 1H30A 2O1QA 2J1RA 2R16A 1RUNA 5D8AC 2YBPA 4JGYB 1N3PA 2RV9A 3C7GA 1O6UA 2Y38A 2XG3A 4QKFA 3T0BA 2ET1A 4A7YA 1RUI2 2JE7A 2ZACA 4GIQA 1RUF3 5LWBA 1CAUA 4R4ZA 1AL23 1JOPA 3PU3A 1DDLA 4AG4A 5KHHA 1DYKA 2YFZA 2VZSA 2VH9A 2ZGUA 4FPFA 4K1YA 5F5IA 2QDNA 4YW5A 5TSWA 2VZ1A 2GNDA 4NOTA 3SKJE 3SKVA 3U75A 4GH4A 1U0AA 1MACA 1KJRA 4IETA 3KF5A 5C9AC 4HOOA 4Q1PA 4XTMA 1FMD1 1O8PA 2RJ2A 2N7GA 3OB8A 4QPGB 4LNVA 3ACLA 5FREA 4EZ4A 4AEKA 4QPIB 2G4IA 1YQ5A 2ETEA 4H14A 4URTA 1MS3A 1QJY2 5IAVA 4F83A 4HVRA 2RS11 3B02A 4D6QA 1NLSA 3E1F1 2DWRA 1PO23 1OOPA 3LOIA 1W0OA 3F2ZA 2VNVA 2A6YA 5F1RA 5I0DA 3MBWA 3IAPA 4XEZA 4ORFA 5KC6A 5JSRA 4GMP3 5A32B 1REEA 4CCDA 4E4ZA 3IDCB 4M0HA 2Q8CA 2WYFA 4L2NA 5FZ9A 4CDXC 4CUBA 2R6QA 1QNWA 1OKOA 2XVKA 2ZGSA 4YNIA 1QDOA 4N7IA 2W87A 1WKYA 5IUQA 3V64A 3W21A 2ZGNA 4H7MA 4LK6A 1L7LA 3JB4C 4BK5A 4Q4X3 3CLPA 2K46A 4M01A 3VZKA 4ASLA 5KHGA 4FFFA 2NQYA 2DUQA 3I3QA 5LZ6A 1W6NB 3POYA 1UMHA 1I9RA 4XUPA 4XZUG 4ISQA 2CWMA 1FV2A 4GD4A 1HQNA 4MGZE 1AYN2 2J1TA 4EROA 2WZR2 1I3HA 1UW8A 4BQ4A 1Q8VA 3LDKA 3OPWA 3AFKA 5FK7A 2BPA2 1M06G 4UFMA 5BNOC 1NQDA 2IZWA 5FFOC 1PNFA 3H42B 3E6BA 2CHHA 4YW1A 2E51A 2P3KA 4ASKA 3RYPA 4FVVA 4QPGC 2HWE1 4QPIC 1FOD1 2WUHA 4MOAA 3OCPA 5KHJA 1JMUB 3SC7X 1W0NA 4OMCA 1BEV2 2VMHA 5C3RA 1YEWA 4LO5B 5LY1A 1VBC3 3RZJA 1LAJA 2ZX1A 5AFBA 3HBZA 4N90A 3WNLA 4Y1YA 1CX4A 3GF6A 4LOSA 3DKQA 1GV9A 4CP9A 2SLIA 4D94A 3K51A 3ECQA 2VVFA 4UW3A 1OLRA 1UL9A 3LKJA 1O3RA 1IKQA 3NV1A 1S4CA 2WL1A 5A3UA 5LASA 1SMVA 2WLQA 5FZHA 5A7OA 3PVBB 2RM22 3GZEA 2TUNA 2Y64A 1DYOA 5HPOA 5D1IA 3R6SA 1VRH3 1Z7S1 1BLZA 3DCQA 1OSGA 3HMYA 2GN7A 5DUVA 2WQZC 5A3MA 1GOHA 3N4MA 1PZ8A 3DPRB 1S0CA 1RB8G 3I8TA 3JB8A 4X8PA 5C3SA 1FPN1 2HBTA 1Y9MA 2HH9A 3MDPA 2GSYA 1DFQA 1LTEA 4GKXA 2JWPA 1L7RA 1Y43B 4KGGA 4NHMA 1AR83 4P9WA 5G04L 5HCHA 4IV1B 3WT3A 5I0RA 1V9U1 1HRI1 2G9FA 2XL7A 1RUG2 1KRIA 1KDMA 1POV3 2XHKA 2VMFA 3HNBM 3OSDA 1VJ2A 4NVPA 4S2HA 4ZKTB 3RZGA 3WG4A 2PLV3 1QDCA 2DFBA 2FQPA 3H0OA 5FMOL 2E9QA 5A3PA 3CZJA 4L99A 3WDYA 1PVC1 3GBGA 4D7TA 1CVNA 3VKFC 1GP6A 1X9PA 3HIFA 4H3WA 1UMZA 3DXTA 1UY2A 3ZR6A 1XB9A 5BNNC 3J7HA 5DAVA 2RR12 3THDA 2WS92 4PDWA 1HB4A 1NUKA 3ZN6A 2EAKA
chains in the Genus database with same CATH topology
2CYFA 2GN3A 3V0AA 3AK0A 2JG9B 2MEV2 1TME2 2WC2A 1LRHA 3AJZA 1COV3 3SH3A 3RRDA 2R32A 4RGAA 1VBE2 3ZVXA 4AVVA 2G9GA 1SLIA 5LRRA 3ZFFA 4ISRA 1NE6A 3U10A 1VBA1 4AHYA 1NA1B 4K7JA 3AZYA 1DGWA 4N43C 3WX5A 2JD4A 5E88A 3MPPG 2R043 2BW8A 5CFDA 1QXPA 1AYM1 1OQDA 3THPA 2D98A 3MIFA 4MXWA 3W59A 3DUIA 1CPNA 4LO4B 4YW3A 1LR5A 3BCWA 1KDKA 3NV2A 4PIZA 4FOVA 5E1RA 2P34A 3GHMA 4S2DA 4W65A 1F5FA 2JXAA 2VVDA 3EHKA 2HWD3 4FT8A 5GLZA 3VZMA 5K9YA 3I7DA 4NO4A 3M3OA 1SQ4A 2XL9A 2NMNA 4LBLA 5C33A 2JDZA 2PHRA 1GSLA 4INDA 4Q4W1 3JQWA 1Z78A 1FMD2 4Q4V3 1DG6A 3PVOA 4G4FA 3IWZA 2RS12 4GULA 4X8NA 4QD2A 2JG9C 4JCKA 1O3SA 4N9HA 3BOPA 3O0XA 3IPVB 2VOXA 3ROUA 1PGW1 3H7YA 3PNAA 4HMZA 1DQ5A 3NO8A 5D8AA 4WM7B 1LGCA 3HD8B 3AX4A 2XWJB 2P2KA 4Q0SA 2GC3A 2R063 1W6OA 1RUH2 1A3KA 5DDJ1 3WVJA 1DGLA 3PVNA 4DRVA 3KZ4C 3MIHA 1V6IA 1WD3A 4ATFA 1VBB3 3M3CA 2JECA 1OI6A 3NKTA 3AYEA 5C9AA 1GZWB 2VW0A 3FHIB 5K0UB 1LHWA 3EJKA 4FAGA 4JDOA 2P17A 3KD4A 1JYIA 1TEIA 3SLIA 1VB4A 2Z42A 3AFGA 4KG8A 3FUOA 3W9AA 5GJ6A 2HWE2 2YZ4A 2KXLA 1FOD2 1QOOA 4CDXA 1N1YA 4WVWA 4OZXA 4LT5A 1SLTA 1F8VA 1NXMA 1BBT1 1S2KA 2AENA 5J36A 1CPMA 4COVA 1URXA 1W6MB 3JU9A 2WNVC 4FPGA 3N3HA 1EV13 2XUMA 1GQGA 4RSUA 4Q0VA 3DN7A 2W39A 2WIIB 1V6OA 4OI4A 2ZGTA 2YDEA 2HWC3 4HPKB 4A3XA 2RMU1 4AI1A 3I59B 2CY6A 1RITA 1HLCA 1Z7S3 4LHLA 4GWNA 1C4RA 2DUOA 2WT2A 4Y22B 3WZ1A 2GC1A 4RFT0 3ZFEB 4I09A 5BNOA 1FPN2 3B9CA 2QKDA 4RHV1 4B7EA 1IS5A 4FBFA 1AXYA 3IMNA 5J7MA 1V9U2 1HRI2 1YJLA 4A7KA 4BWOA 5IT6A 2YROA 1CESA 2KA3A 4YGCA 4KNCA 1R093 3ILFA 2WFPA 2ZGQA 2A6WA 1PZ9A 3AP6A 5A33A 3CJIA 3U07A 5KWRA 1ZZ8A 2Y0OA 3MF6A 1PVC2 5H9QA 3H1WA 1O3TA 1MVEA 4XPVA 5EV7A 1DGWX 1GQHA 4LBNA 5L7OB 5LK7B 4LLOA 1RHI1 4XDQA 3RI8A 4COWA 2XJSA 3D8CA 2R1BA 4UW5A 5T3NA 1H4HA 3RI9A 4N9IA 4PLMA 1CAWB 1ZRCA 2DVBA 2Y0IA 3M1HA 2XBO1 3AP5A 4XOGA 1W6NA 2R49A 4EV0A 3M3IA 4AVSA 1VAKA 4R9DA 3U11A 2WKKA 2GH2A 1QXRA 4OHZA 2R0FA 5JZGC 4NR1A 1VBA2 5EXOA 1AR93 1NCQB 4NN0A 4Y4YA 2R1DA 2WT0A 3BPZA 4XXAA 5I8SA 1AYM2 5T5JA 1WBLA 1NCRA 4YM2A 3KM5A 4C1XA 3NWKA 5BXXA 1XU2A 2OUJA 3CF6E 1OA4A 2DUPA 2C9AA 3PVEA 4LBQB 1RTVA 5DG2A 4B4QA 1ZRFA 5BNNA 5JAXA 4YYOA 1OQ1A 1XNBA 1ZZBA 2E63A 5JPMB 2GMPA 3VKNA 2BVBA 1ZBA1 2MPFA 4IEWA 2SBAA 4Q4W3 3NV3A 5L7OC 2JG8B 1TMF1 1V70A 2DTYA 4OULA 1CN1A 3O12A 1YJKA 3VL8A 1ZBE1 3ZYRA 2WLPA 1JN2P 4Q26A 3AMPA 2FZ2A 5CFCC 4L92A 1FNYA 4N43A 3SMHA 4AXOA 4C0BA 4QHBA 3H8UA 5L36A 4I0AA 4AGGA 3C2UA 1GYKA 1PGW2 3ZN5A 2OVUA 1S0EA 3E97A 1D0HA 1QJZA 1UIKA 4HKOA 4AVAA 2EA7A 3ZXEA 3AKSA 1CJDA 5FAXA 4C90A 1KQRA 3ZYJB 5HI0A 3MIDA 2QDRA 1QQP1 3BOWA 1R1A3 1W39A 2DVDA 4XE9A 5DDJ2 3MIGA 1DGRA 1IGOA 1O3QA 1D4M3 4YVWB 3RDIA 2ET7A 3FWEA 2RS31 5CNAA 3KS7A 2NPIA 1K5MC 1WGPA 3MICA 4AFDA 4FAHA 1Q5OA 5JOYA 1H2MA 2A71A 3VBHB 2H0VA 1C28A 5H9PA 4XIKA 2NP0A 3MPBA 4LBKA 3WV6A 1SACA 2ATFA 4C1WA 4FOYA 4LBQD 4CZSA 3P3NA 1H4GA 3ILRA 4Q8KA 4XJWA 3WDWA 4GMP0 4GWMA 1EYBA 3WQ1A 2VOKA 4DNYA 5EFUA 2NM1A 1BBT2 3FLTA 2F4PA 4EWDA 5T5PA 5ABJC 4HKWA 4I0BA 1RUI1 4QPYA 2GNTA 2Z5WA 1PZ7A 3NJZA 4LE4A 1LEDA 1V6KA 2PHTA 2RMU2 4HK8A 1C5IA 2PHLA 4MSVA 4COZA 3J8F3 4AVBA 1I5ZA 2BFUS 2EXJA 5T55A 4XQWA 5A3LA 3GNEA 3M70A 1RGSA 4Q29A 2VNGA 4P14A 4UXAA 1LOGA 1YCIA 2XLAA 4FO9A 4RHV2 2OYZA 4P9GA 1FX5A 2HWB3 1H9PA 2ZAHA 3BU7A 4KGQA 1CQ9A 2PAEA 2HEYF 3OGJA 3VBRB 1X8EA 1GLHA 5DZGA 1S0BA 3VBSB 1IPKA 3VBUA 2WNVA 4IQPA 3L2HA 3CJXA 1XU1A 3RZZA 1RHI2 1QJX3 1S0FA 2PA7A 5BNQA 2DCJA 4XFBA 3JBG2 3JCIA 3M4FA 4AFMA 4AI8A 1RUE3 5GLUA 2XBO2 1LHVA 2XKOA 2QFEA 1Q8OA 4LO7A 3ENRA 5AC93 3AZZA 5BNPB 2DCZA 2VQ0A 3QOPA 1AJKA 1GZWA 2VNRA 3RMYA 2ZX0A 4Q8LA 3SH5A 2GALA 4DY3A 3ZXDA 5FQ0B 4YZ2A 1HQWA 1ZYBA 3V65A 1JXNA 1UX6A 3AZVA 2B42B 1VP6A 2K9ZA 5GZDA 4KBBA 1AR73 4TLFA 1WCDJ 3MYXA 1H2NA 5C8CC 3B69A 3WCRA 1PNGA 4OI2A 4L97A 3NV4A 4XHXA 1JW6A 3TOJA 2XJVA 3VBOB 1DZRA 2QZ2A 3THTA 1WA4A 4XF3A 1ZBA2 1WMEA 4MLOA 1Y9QA 2VGDA 2ILMA 2GNMA 3MZHA 1TMF2 3GZUC 2WNUB 1MZEA 3RYRA 5IK7A 2PYTA 1ZBE2 1MEC1 4DOUA 1RC6A 3I59A 4HVQA 4K20A 1QJU3 1I1EA 5JZGA 3PJQA 1YHFA 4XQDA 5GLWA 5BNPC 1H8TB 4XFGA 1HRV3 4JDMA 5ACA3 1RUD2 4MUVA 5JVVA 1SEFA 2BYVE 3VHNA 1LEMA 1QQP2 4MGYE 4BYYA 2QJVA 4KG0A 1H8VA 4H7LA 1HIXA 1N1VA 4OLLA 4WVVA 4KH9A 4WVMB 4CDUB 5J09A 1SCSA 4M0NA 3ZPYA 4MGKE 4PCRA 3SH4A 2RS32 3PHMA 4FTSA 2VW1A 3WQ7A 2TEPA 3MGUA 1DYPA 3VBOC 2E53A 4YFZA 1ND2B 3SXWA 4U2AA 3VV1A 2QE3A 2BNOA 4Q0PA 5CFCA 2PHDA 3BALA 2YXSA 3EXUA 2RE9A 3MLJA 4BLJA 2DYCA 3SHRA 1PO13 4HFSA 4HVOA 4LA2A 3SCGA 1BVVA 5DXDA 2HJIA 1D2SA 3IM0A 4YGDA 4TWTA 4Z82A 1H8TC 4RR3B 3OYWB 2LALA 3ST7A 1RUI3 3KMHA 3R4SA 4HLTA 1ZA4A 1B35C 1OPOA 3AKRA 3GBWA 3PJYA 4KU7A 3POWA 3VUOA 1NLRA 1K5MA 4FXKB 2YGLA 4I02A 1ND3B 1PK6B 3QH6A 2OZJA 4COYA 5JOZA 2MNGA 4CDUC 1YUDA 3NVCA 4Q1RA 1VAMA 1XQNA 3AKPA 5CB7A 3WW2A 1QJY3 5I93A 4AI0A 4FOQA 1MQTB 2BTVC 1YWKA 2WWSA 2ZGRA 3IIAA 3GYDA 4BIOA 2XLGA 1CR7A 2ERFA 3IN9A 4HZFA 1HV0A 2JENA 1XYPA 1ND2C 1OA2A 4XW3A 3VN4A 1ULCA 2CGPA 2BEOA 4DINB 2XLFA 4LA3A 3AMNA 3WG2A 2CNAA 1X33A 1DBNA 1N1SA 1XRUA 3NAPB 5ABJA 3OBTA 4FPJA 5DG1A 4BMBA 3I2DA 4JTOA 4IV3C 1RUH1 5T5LA 4GKYA 2TBVA 3ES1A 3CEWA 1KJLA 1AJOA 3JZVA 4JGYC 5HCBA 3TN91 4CDQB 1AYN3 4UBHA 3E5XA 4OHYA 2WZR3 2AYHA 1S0DA 2OIIA 4B8EA 1A6CA 4AW7A 1XNDA 1ZRRA 1UU4A 5IK4A 1WLWA 1PK6C 1LECA 2BUKA 3BIWE 4BOWA 4Q4Y1 5C4WB 2X5IB 3UV9A 4KWLA 4FXGB 4K21A 5GZCA 2PHXA 3USUB 1BEV3 4PF5A 5GKAC 3VDDB 5LK5A 1H0BA 1Q8SA 3H9AA 5BY5A 2B5HA 4ASMB 3ASIA 4KU8A 1V6LA 3KQRA 4OFGA 4G3YC 1IS3A 3MIBA 4WM8B 4ES8A 1ASJ1 1ZNPA 3R05A 2EXHA 3AXDA 2KM2A 3J9SA 2VOVA 4GB31 3NSTA 5LRSA 1GKBA 2RM23 3KB5A 1RJ8A 2QUOA 2B45X 2Z79A 5K7PA 2RS51 4DZGA 1CIWA 1CAVA 1WW7A 1MEC2 2ZPXA 2LTNA 2WT1A 4DB5A 4CDQC 1G6NA 2IXJA 2O0OA 2YHJA 4D3WA 1CD3G 1RUG3 4JGZB 1CAXA 2GH8A 3H7JA 1HQLA 4Q2FA 4CDWB 1GBGA 1OLQA 3LZZA 5I8YA 3HT1A 1AL0G 1KXGA 4XJ8A 1JUIA 2A3WA 1X7NA 5C8CA 2C0ZA 2VQAA 1MS1A 5C4WC 3V0BA 1AHSA 1J3PA 2X5IC 4Z1VA 3TAYA 1YO8A 3VHOA 2RR13 3VDDC 2WS93 3NKGA 4RQPB 2XH6A 4YFWA 2MEV3 3LA7A 1TME3 2E6VA 4AHWA 4WM8C 3D4KA 2R072 1VBE3 4IEOA 1ULEA 4K1ZA 2UYAA 3WINE 3MI8A 3QCWA 2HEWF 4XFIA 2OA2A 3OY8B 4AFBA 4EN6B 5JPNB 2BNMA 1O5LA 3DPRC 1UPSA 4AF9A 1NXD1 4IEVA 3S6PA 1HXS1 4PQ9A 3D82A 1F5JA 5C8WA 4IV1C 3FMGA 5JWPA 4JGZC 3ZYGA 1HV1A 1W6QB 3MW3A 3H3UA 2CAVA 1RMU1 4CDWC 1YNAA 4MXVA 1VBD1 2FBEA 5HCFA 2UY8A 1TE1B 2VVEA 1GICA 2A75A 1QKQA 4FOWA 1MS8A 3M3EA 1FMD3 2AREA 2BWAA 1OKQA 2LM3A 3WW3A 1GZCA 3IDBB 2AR6A 1KS4A 2RS13 4N53B 5CG8A 3H3ZA 3G7DA 4S2FA 3VBFB 1MZ6A 2JKBA 1ZZCA 3AM2A 1UPIA 1LHNA 4A2UA 4E2QA 2MHFA 2ZHLA 1M4WA 5H9RA 2XJQA 4J6GA 4MX3A 1H8TA 4QM9A 4XFFA 4ZU7A 1DQ6A 1NA1C 4FPLA 5FOJB 3CNAA 3O0VA 4Q4V2 4DMIA 4XMIA 5GLVA 1EAH1 1B35A 1RUH3 4IEUA 3SISA 2VECA 2PN5A 4K8FA 4LUMA 3TN92 5GZEA 3UKTA 3AP4A 3FC0A 2YPJA 4LULA 1U12A 1BJQA 5GLTA 1S2BA 4D7SA 4MV2A 2UY9A 3KLSA 1J3QA 4BCUA 2VPVA 3TB0A 4XJUA 2UWCA 1Q8QA 1YFXA 4Q4Y2 3LSEA 4EWEA 4I01A 4XFCA 4AVCA 2HWE3 3WQ0A 1U5XA 4W6YA 1FOD3 1QXJA 1T6GC 3AMMA 1C8M1 3JD71 2VMGA 5JMCA 1YIFA 2Y26A 3VBFC 2PHFA 1N47A 3IDEA 4XHBA 4R8HA 1RUOA 4NWVA 3VKOA 4IV3A 1WD4A 1DQ4A 2VY0A 1Q3EA 4WM7C 2FHRA 3GBFA 1X50A 4JGYA 1ASJ2 4GB32 4OHXA 2E7AA 5DUWA 1LOAA 4R9AA 2GMEA 4XBLA 1U5IA 2RS52 4F3JA 4FP2A 4LO6B 4NWWA 4L9BA 2D3RA 1RVF1 1FPN3 2OW4A 4K3UA 3VGIA 5FOBB 4Y26A 3MW4A 1LOCA 3E5UA 2DVGA 4DS0A 1G9AA 1V9U3 1HRI3 2WINB 4QPGA 5K0UC 5T52A 4AE2A 4QPIA 3N36A 4GXLA 4RS5B 2A3YA 1B09A 2BWCA 1A8DA 2ZHNA 1UZZA 2YGMA 4Y1VA 2UWAA 1O4TA 3ZXLA 4DFSA 5BV6A 1PVC3 1DHKB 2HYKA 4LHKA 3BB6A 4XBNA 5A32A 4XJZA 3T1LA 3B3QE 2BGCA 1ZM1A 4QX5A 2D7FA 3D5OA 2W68A 2ZMKA 4PLNA 1QNYA 3ZFGB 1E57A 3WUDA 3JBG1 2DCTA 2FMDA 4M3CB 1TNFA 4ZU4A 1UAIA 2JEMA 2C1FA 3I4IA 4HT1T 5DUXA 1AF9A 4AGRA 2Z2SB 1LESA 4FPOB 4J1WA 1G9DA 5E16A 1VBA3 2YYOA 1KITA 2E7QA 2WSVA 4AQTA 4Y1ZA 3ZFEC 1AYM3 1HXS2 1W6PB 2XVLA 2B46X 2X5IA 2CTVA 2HWF1 4ONUA 4S2GA 5T50A 1DIWA 1REDA 5KXDA 2UURA 1RMU2 4Y20B 1AR62 4ZXKA 1PIV2 1VBD2 4XQ4A 2VULA 1ULFA 3E6DA 5FLIA 1R081 1DGRN 4P5HA 1RUJ1 1L3JA 4AEDB 4I3GA 1CAUB 2Q0AA 3CO2A 5FRAA 1BZWA 1JBCA 2ZABA 1WLDA 5KC5A 3E5QA 1XYNA 3ZXFA 1GR3A 2D3SA 3DPRA 1SCRA 1N3QA 1NQJA 4BPZA 2ZMNA 2UU8A 2D6MA 1RUD1 2D6LX 1RUC1 4IV1A 1MS4A 1NCQC 3HT2A 5GM0A 5FLHA 3D0SA 1OOPB 4KWKA 5L19A 5FMOS 1QHDA 5JOWA 1EAH2 2OUHA 5DDJ3 5FPXA 3O7OA 1VR3A 1LHOA 1WLCA 1LGBA 4R9CA 2WFF1 3NL1A 5F5QA 2C5DA 2WZPP 3WNXA 3FX3A 1F2NA 5IK5A 3H50A 4FQZA 5H9SA 4FPCA 1LB2A 4FTBA 4E9KA 2IFWA 4I3PA 4CP0A 4HN0A 3OGGA 2CGNA 1ZZ6A 2JG9A 3LSDA 3AB0A 5KBFA 2JG8C 4AEDC 4MVTA 5KHKA 3TNPB 2EAAA 3OY8A 3RQ0A 1C8M2 3JD72 1F31A 1G8WA 1NA1A 1BBT3 5KHIA 1EPZA 4RGGA 5DZEA 2EXIA 1FYUA 2ZKNA 1FATA 2H6CA 3TYJA 1WLTA 4MYEA 4YVSB 1XE8A 3FBYA 3WCSA 5JLVA 1O91A 1VLNA 1ZX5A 3UJOA 3OF1A 2RMU3 1OOPC 4AFAA 3VHPA 4YVWC 4CP2A 4HL0A 3CL1A 1RVF2 2D6OX 4AI2A 4RHV3 1HW5A 4K9SA 2VNOA 1WCSA 3FZ3A 1Y7BA 1MZFA 1RUF1 1AL21 3VBHC 2DFCA 1U5YA 3S0MA 3ZXGA 3ZMOA 4K6BA 1AXKA 2DV9A 3N35A 3VBFA 1ZREA 3WDXA 1D2QA 3IPVA 2IXIA 5KXEA 1JOJA 4Z07A 3LCPA 4WM7A 1RHI3 4FSJA 1KFXL 2QVSB 2W52A 3W58A 3JBG3 3VKMA 1PO21 3EQEA 4LBMA 1G7YA 3R4UA 2XBO3 4EN8B 4CP1A 2XB6C 4GMP1 3ZXAC 1AX2A 2GC0A 4FP3A 4YVSC 4ATEA 5J48A 1NYWA 2Q30A 4CEYB 4PDWB 2IFRA 1JUHA 3ZN6B 4XJ9A 5K0UA 4YG0A 3V0AB 2K2SA 4XFAA 4XIOA 3SNMA 2IXLA 4WZCA 1POV0 4P9IA 3RS6A 3UKVA 3AYCA 2HWF2 3RMXA 1A8MA 1AZDA 4LEJA 4OI1A 1SLLA 1ENRA 1O4ZA 4META 3RWNA 3VBRC 1G9CA 3GHNA 5JIUA 5CFDB 1ONAA 3VBSC 4MXWB 1VIWB 5FTTC 4Z92B 2IWGB 1W6MA 1ZBA3 1R082 4RA0A 1RUJ2 4EWAA 1TMF3 3N7JA 3OTFA 4HPKA 2QQPA 4AFCA 1ZBE3 4AHZA 4R4XA 3VZJA 2NZ9A 3DF0A 4E2GA 2D6NA 4OI0A 3WLUA 3MFAA 5FDBA 4Y24A 3UL2A 4Y22A 1Y3TA 2PAKA 1RJ7A 3AYDA 1LCLA 3ZFEA 1IS6A 1EPWA 1WW6A 4CTEA 1RUD3 5C6CA 1G9FA 4CEYC 4XMAA 1RUC2 4WBBA 2PFWA 2A6VA 1PVXA 1VRH1 4BMEA 4DQAA 1VAVA 3AKTA 1QQP3 3IT8A 4YGEA 3RJ2X 2B39A 2ZA9A 3S30A 4IL7A 2VG9A 3MFCA 3D0JA 3DKWA 2WFF2 3WG1A 3WY6A 5D8AB 1AR81 2YV8A 2RS33 5FO7B 3WG3A 1DU3D 2ZGPA 5L7OA 1NG0A 3B00A 1V00A 4ITCA 1W6OB 2D3PA 4IXLA 4FPEA 2PLV1 4CEWB 2R071 1CAWA 4M3CA 5CA6A 1KFUL 1TNRA 1MS0A 2CWSA 5GZFA 3A0KA 2UYBA 2WNUC 1U5ZA 3KT7A 4GA9A 4M3CF 3WDUA 2D6KA 2RJKA 3AZXA 4W6XA 3WW1A 5JI7A 4WV8A 2WA3A 2D5HA 2WQ4A 5JIAA 3G6JB 4FPKA 2ZX4A 3E6CC 3ALQA 1NCQA 1IHMA 1COV1 1LULA 3VL9A 2EVXA 1PHMA 4RL7A 3ME2A 1S0GA 4CDXB 2AH2A 3AYAA 4YZ3A 4LBQA 5F9TA 1JHNA 2I45A 2XJRA 3ZSLA 1AX0A 3AJYA 3BTAA 2R041 1X8MA 1YLLA 1LENA 3K48A 5EWSA 1FV3A 1UIJA 2DF7A 3PTYA 3T1MA 1W2UA 4JTNA 2JICA 1OPMA 2JG8A 4AEDA 1DLLA 4OVEA 4LBOA 1RUF2 3P3PA 1AL22 4XXPA 5I0SA 4IEYA