1HRV3

Hrv14/sdz 35-682 complex
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
236
structure length
236
Chain Sequence
GLPTTTLPGSGQFLTTDDRQSPSALPNYEPTPRIHIPGKVHNLLEIIQVDTLIPMNNTHTKDEVNSYLIPLNANRQNEQVFGTNLFIGDGVFKTTLLGEIVQYYTHWSGSLRFSLMYTGPALSSAKLILAYTPPGARGPQDRREAMLGTHVVWDIGLQSTIVMTIPWTSGVQFRYTDPDTYTSAGFLSCWYQTSLILPPETTGQVYLLSFISACPDFKLRLMKDTQTISQTVALTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title SDZ 35-682, a new picornavirus capsid-binding agent with potent antiviral activity.
pubmed doi rcsb
source organism Human rhinovirus 14
molecule tags Virus
molecule keywords HUMAN RHINOVIRUS 14 COAT PROTEIN (SUBUNIT VP1)
total genus 38
structure length 236
sequence length 236
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1995-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1hrv300
4CDWB 1QQP3 3ZFFB 1AR72 1D4M3 1D4M2 2RMU2 4YVWA 1RUE2 1QQP2 2HWC1 5ACA3 1HRI2 3NAPB 4GB31 1RUH2 1PO23 2RS11 5AC93 3J8F2 1AL22 2HWB1 1F8VA 3VBHB 3CJIC 1OHFA 1RUF1 5C8CB 4CDQB 1COV3 4Y4YA 3LOBA 2BUKA 1ASJ2 1IHMA 3ZFGB 1OOPC 1AR71 5DDJ3 5J96B 4FTEA 1R081 2ZZQA 4N53C 2MEV3 4PDWB 4Q4Y2 3DPRB 2WS93 4IV1C 5ACA1 1RUH3 2XBO1 2R063 5FOJB 1BBT2 1MEC1 3M8LA 2HWD2 4NWVA 1PGW1 3JD72 3VBUA 5BNPA 1E57A 3VBHC 4JGYA 2XBO2 4RHV3 1VBA1 2XPJA 1RUJ3 5K0UC 4N53A 3VBRB 1OOPA 5JZGB 3VBRC 2GSYA 3J8F3 1WCDJ 1C8NA 4FTSA 1QJU2 4CEWB 4Y5Z0 2MEV1 1PO12 1RMU2 1RUE3 4Q4X2 3VBSC 3VDDA 4RS5C 1AR73 4GH4B 1AR91 4CDUC 5BNOA 5CFDB 1H8TB 1ND2A 1BMV2 1TME3 2HWF2 1POV0 2ZTNA 4CDUA 5BNOC 2MEV2 5J98B 1ND2C 2ZAHA 2RS31 1RUF3 3TN93 1TMF1 1X36A 1AL23 5FMOS 1QJY3 1PO22 2RM21 1RVF1 1HRI3 1MQTC 5AC91 1QJY1 3ZFGC 1BBT3 5BNNA 4CEWC 1C8M1 3TN91 4WM7C 5CFCB 2Y26A 1MQTA 1VBB3 3ZFFA 1R091 4PDWC 2WS92 4RS5B 2WZR2 5AC92 4CDXC 2R042 1HX6A 4FTBA 1HRV2 4PDWA 1H8TA 1ZBE1 3NAPC 1RUD1 4IV3C 1AYM2 4JGYC 4YVSA 1RUD3 4WM7A 1ND3B 4QPGC 1BEV2 1FMD1 4RHV1 4QPIC 2TBVA 2WFF2 2HWD3 2X5IB 1VBB1 1OOPB 2RMU3 4GH4A 2BBVA 1EV13 1AR63 1AYN1 1VBC1 1RUH1 1RVF3 4Q4W3 1V9U1 1B35C 1RHI1 5CFDA 5BNOB 2RS32 4JGYB 1VBE1 4SBVA 3JBG2 5D8AA 5DDJ1 4YVSC 1VBC2 3S6PA 5C8CC 3CJIA 4N43B 1ASJ3 5K0UB 1VBD1 5CFCA 2RR11 4Q4V2 1R093 3JB4C 1C8M2 2FZ1A 1R082 4RS5A 4NWWA 1VRH3 4Q4Y3 1V9U2 1VAKA 3VBOA 2RM23 1M06G 1NCRB 5ACA2 1VRH1 1RUC1 2HWC3 1B35B 4RR3A 1NCQA 2RMU1 1TMF2 1VBD3 5A32B 3VBHA 1CJDA 1PGL1 1VBA2 4BCUA 1QJX2 2XBO3 1RUE1 1R1A3 1AL0G 1PGW2 1RHI3 3VDDB 3VBFA 1RHI2 1V9U3 1NY71 1PIV1 1ZBA2 1FOD2 4AEDB 5ABJB 1AYN3 1ZBE3 2R062 1AR61 4WM8B 2BFUS 4CDUB 1AR92 5CFDC 5C9AB 1RUG1 1AR82 1RUI2 1AYM3 1MEC3 1RUC3 1PVC2 1PVC3 1HXS1 1MEC2 4IV3B 1DDLA 2RS12 4Q4Y1 1EAH2 5D8AB 1Z7S3 4CDWC 1NY72 1PIV2 1R083 5K0UA 4CDXA 1FOD3 1BMV1 4GH4C 1NOVA 1ASJ1 2WZR1 3ZFFC 1B35A 3NAPA 1NA1A 1HQNA 1NCQC 1QJX3 3VBOB 3TN92 2VQ0A 5C9AC 4RQPC 1Z7S1 5L7OC 3J8F1 3CJIB 4IV3A 4RQPA 5JZGA 1RUJ1 1TMF3 4QPIA 1AR62 4CDWA 1QQP1 2HWC2 1K5MC 2HWD1 3ZFGA 4YVWB 1RUG3 1AR83 1W39A 1RB8G 1RUG2 4IV1A 1POV1 2HWF1 2HWE2 1TME1 1AR81 2HWB2 3DPRA 2R061 5C9AA 1NA1C 1PIV3 4Q4V3 5A33A 2WS91 1QJZA 4FSJA 1QJU1 1ND2B 3JD73 2FZ2A 2QQPA 2RS52 5C4WA 1A6CA 2RS53 5D8AC 3VBUB 5BNPB 1VBA3 5L7OB 5CFCC 4QPGA 1ZBA1 2BFUL 2X5IC 4CDXB 1C8M3 3VDDC 3VBSA 4YVWC 2HWB3 1HRI1 4GB32 2X5IA 4RR3B 4GB33 2PLV2 5ABJC 1R1A2 1RUI1 1PVC1 2RS33 3ZFEB 2RR13 5FMOL 4JGZB 2WLPA 2WWSA 5BNNB 1EAH1 1GFF2 1VBD2 2R041 1COV1 1PGL2 1MQTB 1RMU1 4Q4X1 1PO11 4CEWA 1EV12 5LK7B 3VBFB 2PLV3 4EJRA 5ABJA 2WFF3 4Q4W1 4WM8C 4CEYC 2PLV1 1VRH2 1SMVA 1NCRC 4CEYB 1EV11 4IV1B 1D4M1 1AYN2 1EAH3 4YVSB 1Z7S2 3VBOC 3ZFEA 1POV3 4RFT0 2BPA2 5C4WB 4GMP0 5A33B 3JBG3 5C4WC 2DF7A 1RUI3 4N43C 4JGZC 1HRV3 4QPIB 1BEV1 1FMD2 4CDQC 1K5MB 1X33A 4QPGB 4WM7B 1ND3A 4Q4W2 2R071 1TME2 4Z92B 1VBB2 2RR12 5GKAC 1ZBE2 3DPRC 1QJX1 1ZBA3 1PO13 2HWE3 1RMU3 4Q4X3 1NA1B 2RM22 3VBSB 3ZFEC 1VB4A 2WZR3 1NCQB 1COV2 2HWE1 4CDQA 3FBMA 1FOD1 2RS51 5A32A 1VBE2 1VBE3 4JGZA 1BBT1 1R092 1CD3G 4RQPB 1RUD2 4RHV2 1FPN1 5L7OA 1RVF2 3VBFC 2RS13 1PO21 3VBUC 1F2NA 5BNPC 1AL21 1HRV1 1QJY2 1FPN3 1VBC3 1K5MA 5BNNC 1HXS3 3JBG1 1RUF2 1AYM1 1AUYA 5JZGC 1NCRA 4GMP3 4WM8A 4CEYA 1AR93 2GH8A 1FMD3 1RUJ2 4RR3C 5DDJ2 4LLFA 4AEDA 1HXS2 1H8TC 1FPN2 3JD71 2R073 2WFF1 1OPOA 1QJU3 2R072 5C8CA 4N43A 3HAGA 1NG0A 3JB8A 1R1A1 4Q4V1 1RUC2 1BEV3 3IDEA 2R043 1VB2A 4N53B 3VBRA 1ND3C 4GMP1 2IZWA 2HWF3 3ZXAC 4AEDC
chains in the Genus database with same CATH superfamily
1OKQA 4E8CA 5JXJA 3TEZA 3U37A 2H0BA 3ZFFB 4KI5M 1D4M3 3V56A 1D4M2 1DZQA 1U5XA 4K3UA 1RUE2 2W92A 3OEAA 2HWC1 2QKDA 3EBRA 4GB31 2Y6KA 4WV8A 5JLVA 2AEZA 3OBAA 2CV6A 4YW7A 5L73A 2BRTA 2EIBA 1F8VA 1TZOA 3PL0A 1UY4A 1UN1A 3AMPA 3U0ZA 2QQMA 4EE2A 1OHFA 1RUF1 3T2TA 3GZUC 4LK7A 4CDQB 5A3OA 3MIBA 4AGGA 5EHDA 4KGGA 4H7MA 3AL5A 3ZM8A 2DUQA 1ASJ2 1W9SA 1IHMA 1N3OA 1E5SA 1D2QA 1JYCA 1SBFA 3RJRA 1Q8QA 1GWKA 4M4PA 3VD7A 3CF6E 1JTZX 1GNHA 4QQHA 1UPIA 2JDZA 2ZA9A 1D2SA 2DCYA 3RYPA 2EALA 4PDWB 5FTTC 4WZFA 3D3AA 3SCFA 3G7DA 2WS93 3AKPA 1VP6A 2FDJA 3KCYA 4LA3A 4Y33A 5FV3A 5IVEA 4PCRA 1YNAA 2GC2A 4FPCA 3KVAA 3S7EA 2JD9A 4A6OA 5JMOA 1FNZA 3QCWA 4LKFA 4XABA 4GXLA 3ZDVA 3AP9A 2WT2A 2XVLA 1V6JA 5LRSA 5FZKA 1OD3A 2HWD2 2I45A 2ZGRA 2QVSB 2ZGOA 3MGUA 3VBHC 2VOVA 4NUBA 5C70A 4ET7A 1QJFA 4K7JA 2CGPA 1IOAA 2WO7A 2JE9A 2XOMA 2ZKLA 3GHMA 4N53A 3J4UH 4Y3OA 2QQUA 4BQ3A 1M4WA 4TLGA 4CU7A 2F17A 2E7QA 2VW1A 4IEUA 2YFZA 4HLTA 3RQ0A 4JCKA 2JE8A 3OSDA 1H2LA 2V4VA 4N7IA 5IW0A 3SCGA 4CXXA 1QOOA 2HEYF 2MEV1 1PO12 1RMU2 1RUE3 2D6KA 2VBDA 1ZZ8A 5DPNA 2H6CA 4BQYA 1JOBA 2PMWB 4GH4B 4RN5A 3WNPA 4AHZA 1AR91 2LRPA 5F32A 5BNQA 4AI8A 3BTZA 3ZYGA 5F8PA 4GD4A 1ZRRA 2ZMNA 1QIQA 3R4SA 4Y4RA 4MOAA 1TG7A 4KNCA 1G9BA 2WNOA 1O8PA 2MEV2 1ND2C 2DVFA 5JXGA 5GZFA 2QCSB 4DUWA 3TN93 1NYWA 1DGRA 2CHHA 5FMOS 5IHRA 2GMPA 1QJY3 2LUWA 3MLLA 1UX7A 2RM21 2EIEA 2ZBJA 2JD4A 1N3PA 2J1SA 3E5UA 1OA2A 5AC91 1BYHA 3AM2A 3IM0A 2MPFA 3POBA 4XIOA 4BB3A 5BNNA 4FOVA 2PYTA 1V0AA 2Q8CA 3ZYFA 1RIRA 5GLVA 1R091 3GJAA 4LJHA 4XPVA 3WT3A 3K3OA 1HW5A 2HKXA 3BTYA 2B9UA 4INDA 3OOXA 3MIEA 2W52A 1OSGA 4FTBA 2W9XA 3AL6A 1YQCA 4O9EA 1YIFA 1DZTA 4JTOA 1ZBE1 3DGTA 2VE1A 4HOOA 4JRAA 5JOZA 2LALA 2AR6A 4V2VA 2YC4A 3QLQA 4MGYE 5F1RA 2ZS6B 4R9BA 4ZXEA 4ARYA 2K0GA 2RJLA 2BERA 1YI7A 4HKWA 2O8QA 1S0CA 5DZGA 3I3QA 4WM7A 3WW2A 1D0GA 2ARXA 3I59A 4ZZ8A 1N1SA 3AZVA 4M01A 2WYSA 3C7OA 4QPIC 1YYNA 4QKDA 1FI2A 1ULDA 3THCA 1VMHA 2FMDA 4BE3A 2TBVA 3EB7A 4DMIA 2HWD3 3OBZA 2WZEA 3WDTA 1OKOA 4YZ3A 1IS4A 5JSRA 2BBVA 1ZNPA 1UL9A 2XJPA 3J7NA 4XF4A 1AR63 2ZGUA 1G9DA 4AVVA 3DCQA 3GDBA 3KLSA 1VBC1 1RUH1 3J7HA 3NJXA 4EN6B 1BVVA 3H8RA 1R1ZA 4Q4W3 1YQ8A 1V9U1 2G9FA 3D6EA 1RHI1 1UX6A 3PNAA 2PTMA 4META 5GLZA 1OI6A 5BNOB 5I8SA 5G04L 3N7JA 5HPOA 1F4AA 4J1XA 5FZIA 2JE7A 1KS4A 4PF1A 3R05A 2VNOA 3PURA 2QNKA 5C8CC 1PMIA 5FZGA 3U75A 3R4DB 4N43B 1ASJ3 4NJ4A 5K0UB 3KWVA 4GQ7A 4NRPA 3MF6A 2VCCA 4IE7A 2PXJA 3OGJA 3PIGA 5DAVA 2Q30A 3MW2A 1WLTA 4BQ4A 4FFFA 3U14A 2A6XA 1YIPA 3AKSA 2JG9A 1HV0A 2WA3A 3USSA 1R082 1SLIA 3WF4A 4NWWA 4QGMA 4IETA 5BXXA 4K1ZA 2JIGA 2XJQA 3LQCA 4Q4Y3 4FPKA 3VZOA 4QXCA 3O1UA 2FDKA 3VBOA 2W08A 1M06G 2X10A 2WNUB 5A7PA 4CCDA 3I4IA 3RMYA 5K9YA 5A1LA 3IDAA 5M0TA 3T0BA 4IDZA 2JDNA 4PQQA 2RMU1 4D3WA 5IFTA 1SBEA 5APAA 3FUOA 1W28A 4CCKA 5A32B 1D7PM 1C3HA 3VBHA 4OZXA 3CZJA 5FY7A 4XQ4A 3KQ4B 4WVMA 1CAWA 1W06A 1YI9A 4EN9B 2Y6JA 5KBFA 4LPLA 1WMXA 5F6KA 5BUVA 2HEVF 2VTFA 2XBO3 3W5NA 1ZZ6A 2NPIA 1NXD1 5FZ8A 2VMFA 3WLUA 1BKZA 4BQ1A 1NQJA 2QJVA 1U0AA 2E26A 3VBFA 1UYYA 2QDNA 1W8TA 4OFGA 3WVJA 2J42A 1F5FA 4W8JA 1LEMA 4XFIA 4D6RA 3VKOA 4YM3A 5ABJB 3BTAA 1AYN3 4QPYA 4HSLA 4DINB 4RGKA 2BFUS 3N9PA 2Q5TA 3PVBB 1H2NA 1PMJX 4XZUG 2V09A 4O7XA 4QAWA 3DN7A 4NIAA 1IG0A 4EWEA 3AJZA 4MHRA 4Q26A 1LESA 5C9AB 1TE1B 4LOSA 3MIHA 4CP0A 2YBSA 3O1MA 4FQ4A 4XYXA 3BUCA 2ZGNA 4E2GA 1RUC3 1JXNA 2W1WA 3KM5A 4FPHA 5JVVA 1XC6A 3I2FA 4XVHA 5FKBA 1BLZA 2XJRA 4QGLA 4I0AA 2RS12 3WZ1A 3B02A 2GZWA 3DECA 2O1QA 3CLPA 3HT2A 1NY72 4K8FA 4Y26A 5FMCA 1S4CA 2BTVC 1XE8A 3QH7A 4P08A 5FP4A 5L9BA 1R083 3AYEA 2WNVC 4YSFA 1NOVA 3H9AA 4CXYA 3LB9A 1J3PA 1DZRA 4Q0PA 4RGAA 3ACLA 4XAEA 4XJUA 1QH6A 3BYWA 1UWWA 1O4YA 1NCQC 4R52A 1GWLA 1QHDA 3BCWA 1S0EA 2HBUA 4RQPC 4HANA 4WVVA 2VVDA 4UAPA 1Z7S1 3OG2A 1UKGA 4L2NA 2CWMA 1AJKA 1LOAA 3WUDA 1NLQA 2ZX4A 4OZOA 4E2SA 2BNOA 4Y1XA 4IEQA 5JZGA 4I3GA 2XONA 1TMF3 1AR62 5FY9A 4Y1ZA 3RYRA 3ACGA 2YC0A 4CCMA 2ZEWA 2KA3A 2VZUA 4FFHA 3NW4A 1QQP1 4XQDA 1IQAA 3WDYA 1VLNA 3KVBA 2FCVA 4FOWA 4IV1A 2HWF1 3TWIA 1TME1 3VUOA 2HWB2 3C2UA 3POIA 1Y4WA 3KMHA 3HN3A 2AGSA 4M3CF 4FP2A 4HKLA 4Q4V3 5A33A 1O4TA 4FXKB 1J3RA 3K48A 1S55A 1JUHA 1CVNA 1WBLA 3JD73 2EAKA 3KQRA 5LK5A 3VHPA 2KR2A 3PUHA 5EPAA 4LBNA 2RS52 1EPWA 1GP5A 3I7DA 1A6CA 2RS53 5C4WA 3ZKUA 1HV1A 2GNDA 4TN7A 4I3PA 3TAYA 3ZIWA 1EYBA 1GYKA 1Y9QA 1LULA 1JW6A 2VNGA 1DBNA 3M70A 5CFCC 2XKOA 5FPVA 3RZZA 4N90A 1VAVA 5FZLA 5F9TA 4BK4A 5FWEA 4QPGA 4QHOA 1O3TA 2CAUA 1ZBA1 4H14A 5FMDA 1ZRIA 1UW8A 4CDXB 5J1XA 3Q8BA 4GALA 1LODA 2A73B 4DUXA 4XUPA 3H1MA 2HWB3 1MR5A 4L8QA 2CY6A 4GB32 4LKDA 5JWPA 1NXMA 2HYKA 2IUWA 4RR3B 4ZPIA 4R9AA 1ENSA 2VOTA 4PJYA 4UFLA 4AR2A 1G9CA 3K4DA 2D6LX 2JEMA 4W6YA 3MF9A 4XBNA 4YFZA 5ABJC 4FQZA 5DAPA 5C3OA 4XW3A 2YGMA 3EYPA 3H3LA 1DHKB 4X6RB 5FMOL 1SEFA 2HLEA 2D6MA 5A7NA 2OUHA 2WLPA 2WO1A 2NMNA 4O61A 2EIGA 5BNNB 1RINA 4NIGA 3T0DA 3HNYM 3MW3A 3PUQA 1UIKA 4EN0A 4XDQA 2VQUA 5AFBA 1RMU1 5A80A 5LK7B 1QNWA 1AF9A 4RYDA 5FZHA 4JC1A 3ZYBA 2Y33A 4CUBA 5FDBA 2Y0OA 4J1WA 2RG4A 2BV4A 3LA3A 2WNVB 3POYA 2E32A 3PU8A 1ZRFA 2ADDA 1LHWA 2WC2A 2WFF3 2JDYA 4FPYA 2AH2A 3NVCA 4NN0A 4Y5SA 5FZ6A 1JZ8A 3ZXKA 1FAYA 3LA7A 4AVCA 2DFCA 2PLV1 1NCRC 2ZCWA 3H7YA 1EV11 1UOFA 1YFXA 4K8RB 4JVAA 2OKXA 1BJQA 4CU9A 1YJLA 4L9BA 4XCBA 3ACIA 2GMEA 2JKXA 2ZHKA 4YM1A 3ZXLA 1H1AA 2RJ2A 3HN1A 2I2SA 4BWOA 2VZRA 3N7LA 1QEXA 4YARA 5J36A 3Q8AA 4RFT0 4GJYA 1H1MA 1DYPA 1PZ8A 1YEWA 3IDBB 5IVYA 5FO8B 4YLZA 1N3QA 1W8WA 4N9IA 1UIJA 4COUA 2FQPA 2RVAA 3FLPA 1FMD2 2W47A 3DKQA 4UWDA 2R0HA 2K2SA 3H8XA 3N3HA 1ND3A 1JN2P 4Q4W2 2BDRA 5ISLA 1QKQA 1TME2 1ULEA 2ORXA 3KCXA 4QX7A 1PVXA 1VBB2 3HPNA 3LDRA 1IKQA 3E97A 4FT8A 5LWBA 4W65A 2OIIA 2UWBA 4QQ2A 3E6BA 1ZRDA 5LA9A 4D6SA 1NZIA 1FXZA 2VZOA 2GNTA 4IERA 4Q4X3 4C8DA 4B7EA 4M00A 4IEOA 4PIYA 5KWRA 1OVPA 2FBEA 4HBNA 1NZCA 2XDVA 4DZGA 1VB4A 1J59A 1S1AA 3DF0A 4P9XA 1MS9A 2Q8EA 1LAJA 1RTVA 4FPFA 5JOYA 3I3MA 2WINB 2BVBA 5A32A 4ZS3A 1VBE3 5FK8A 1CD3G 2P4EA 4AHXA 3ZX7A 4KBBA 1RVF2 1X7NA 3LF7A 3VBFC 5L7OA 1H1IA 1W2OA 1H2KA 3K51A 3VKMA 3BU0A 1SDWA 3WSOA 4Q27A 3NL1A 2LW8A 3UYJA 1VBC3 3ILFA 1CIWA 1GWMA 5E88A 3R6SA 3RWKX 4Q8LA 5A6XA 1GQHA 1RUF2 5FZDA 1OH3A 1RYYA 1ALYA 4XJWA 5FZOA 4HVQA 2ZGQA 1CAUA 5EV7A 3T1LA 3KS7A 1TNRA 3VHRA 4GMP3 5FYUA 1GQGA 3W9AA 2BNMA 4KWKA 3VD3A 3WF2A 3AB0A 3NV2A 3ZYRA 3I2OA 2BOJA 1V00A 2XVGA 4AEDA 2WSVA 2DURA 3GCXA 2CDPA 2XXZA 2AZ5A 1NAEA 2Q1ZB 1GNZA 4DXRA 1LB2A 1CPNA 1V6KA 2R072 2WFF1 5FREA 5T5PA 3P3PA 2ZGPA 4I02A 4ZU4A 4N43A 3HAGA 4XFGA 2DYCA 2JDPA 1H6YA 2W68A 2ZPXA 3HMYA 3JB8A 2XLAA 3OEBA 4FOQA 4Q4V1 3RWNA 5J48A 2EVXA 3C7EA 4LLOA 3WCSA 5FY1A 2BGCA 3OJBA 3ZMNA 1CX1A 2DU1A 4DNYA 4YW3A 2GMMA 3N35A 5JCTA 3OD4A 4MSVA 3VBRA 1ND3C 4GMP1 2Z2SB 2IZWA 4TTGA 3I2HA 3LIGA 1ULPA 2Y6GA 3KB5A 4O9GA 3SCHA 3ACFA 4K1YA 4MZUA 5FZ3A 4AEDC 4WVZA 1IPSA 1QQP3 2UWCA 2ZGKA 2RMU2 3VL8A 3ABZA 1PO23 3USUA 5AC93 1AXYA 1ZA4A 3K4ZA 1AL22 4QQPA 3WEZA 1RC6A 3LA2A 3M3IA 4J25A 2HWB1 5F5AA 1HB1A 1W3VA 2WO3A 1GUIA 4AVBA 3LE0A 4ZXKA 5TSWA 3CJIC 4MXWA 3IIAA 2VGDA 1JYTA 2G9ZA 1X82A 2IXKA 1CAVA 5EJ1B 5FO7B 4Y1UA 4WZCA 5C8CB 5FUPA 5FMBA 2CAVA 4Y4YA 5I0TA 2PQSA 4XILA 1STMA 5A1AA 4ZHNA 4PLMA 5IJRA 3O12A 2G9GA 2Z42A 3ZFGB 3I59B 4GKXA 1AR71 5LBCA 1QDOA 5J96B 5KR7A 1MACA 1VE0A 1JU4A 1R081 2EXJA 3LCPA 4N53C 5K8SA 1X9TA 5CBLA 4LKEA 3WG2A 1I6XA 4XMIA 3DPRB 4IV1C 2R32A 4OI2A 1XNBA 4D8MA 3D0JA 4LHKA 1IS6A 4IEVA 2XBO1 5T5OA 1XOYA 5T5JA 4IEPA 3KGZA 1DF0A 2WL1A 4XCAA 4FAHA 1QOSA 3WHUA 2W46A 4Q1PA 1WCUA 2ORZA 3M7AA 3MLKA 3ZDSA 5JI9A 4NWVA 1PGW1 2JWPA 4QKBA 1GZ9A 1S0GA 3WNKA 4ITCA 4QX0A 3OUJA 2BOIA 2ZZJA 3LDKA 4GWNA 4QXBA 4KQ7A 4AEKA 2XBO2 4HSJA 4IEYA 4P9GA 5HCHA 1JI6A 1RXFA 2A3WA 4Z2WA 1VBA1 1LRHA 2XPJA 3ZYHA 2YDEA 1LU1A 4B4PA 1OOPA 1KDMA 3LEMA 1C8NA 1VIWB 1CAXA 3POSA 3FX3A 4CEWB 5LEJA 4FTSA 2GAUA 4Y5Z0 5DN2A 1LTEA 3UKVA 2Y64A 4LBQD 2ZEZA 3AMHA 5EFUA 5F7UA 3Q8FA 3CDZB 3E5QA 1ODMA 2J1EA 5T50A 3MUZ1 3WF3A 5BV6A 1W3XA 4M3CB 1BMV2 4EN7B 5FZ9A 2A3YA 2D3RA 3C7GA 4NVPA 4E8DA 3ZXEA 2HWF2 3WNOA 1MZ6A 2VOXA 1POV0 3QOPA 2EA7A 2P34A 1WKYA 3O0VA 4C90A 1RUF3 2VMCA 1HB3A 1O3RA 3BPZA 1TMF1 1HN0A 1W04A 2XJTA 3WNXA 5IK8A 4YWAA 5FZCA 3ITQA 2E6VA 3IAPA 4COVA 5FQ0B 1JMUB 3I2DA 4DRVA 4Z07A 1HRI3 1MQTC 1OXCA 1ZREA 1QJY1 1Q8SA 4YZ2A 1OFNA 2DWRA 3IIIA 1XNTA 4CEWC 3R0RA 4CPBA 1Y9MA 2OA2A 2Y26A 5FYHA 1O4ZA 1VBB3 2W91A 4PDWC 4BH9A 5EJ3A 3ZOIA 2YG0A 4OI0A 2WRAA 2WS92 4QD2A 1T6BX 4P9LA 1WW5A 4M4RA 2R042 3PJYA 3MIGA 2A6ZA 4PDWA 4Y22B 1H8TA 3ZSLA 1RL3A 3KV4A 4A45A 4OUSA 2F4LA 2Y60A 2EXIA 5FR3A 3M2MA 1SFYA 1GZWA 3T0AA 5L19A 5L9RA 4EYUA 3AFGA 3MLJA 5FK7A 5IVVA 2WN2A 5T52A 4JGYC 4QX2A 2Z69A 4BK5A 5DXDA 1C57A 1HIXA 1EPZA 2AREA 1CZVA 1JODA 1RGSA 4XEZA 1I9RA 3S7IA 2VOKA 2Y34A 4QM8A 4UW6A 4X6QB 2WZPP 2BJSA 3H8UA 5FXWA 4D7TA 2C26A 3A0KA 1DQ2A 5EYYA 5FZ7A 2WFF2 5KHGA 1ULFA 5A7WB 3C3VA 2X5IB 5DABA 3TRSB 2RMU3 2YU2A 1XQNA 3H0OA 2R1DA 4QHZA 2EAAA 5KHJA 4N7UA 4NHMA 2ZGLA 1PX3A 3VLBB 3DKWA 1UY0A 1GOHA 3OBRA 3ME2A 2ZAAA 2X8KA 3AJYA 3KHCA 4UW4A 2WIIB 1NUKA 1ZM1A 2F4PA 2QQOA 3KZ4C 4JGYB 3S30A 3WG3A 2C5DA 4U2AA 1UU5A 3JBG2 5DDJ1 3LEKA 5D21A 5LA2A 4LHNA 3MZHA 3ZKYA 2W3JA 3N7MA 4AI2A 3HOBA 3GBGA 2JX9A 4JHTA 1I1EA 4LULA 2WA4A 4CSWA 2OYZA 4CU8A 4KG8A 3N9QA 1VBD1 1IGOA 1XXNA 1J1TA 1R093 4CU6A 4FOYA 4RS5A 5GLTA 3AK0A 3RDIA 1RJ7A 3IT8A 1VRH3 3AC0A 3KHBA 1W8OA 4B7KA 1O59A 1OURA 2W1QA 4AEJA 1S0FA 2BWCA 1EUUA 2XVKA 2RM23 1GNYA 3NNLA 5F3CA 3AYDA 2ZABA 4D6QA 3LFIA 2UY9A 5FPBA 4CPBD 2WQ4A 5E89A 3WD5A 5FYCA 3IPVB 4UT5A 4MGZE 5FP8A 3MIFA 4AQ2A 1PZ7A 1W6QB 1HB2A 4MHUA 1UF2C 1IPJA 3WG4A 4AEMA 5CA6A 4XBQA 3WXPA 5C8WA 2Y6LA 3OUIA 1CJDA 1YC61 1JYIA 3ACHA 1GQPA 3NJYA 4EQVA 3V0BA 4AI9A 1BZWA 1RUE1 1DQ6A 4LE4A 4NAMA 1W6OB 3AP6A 1QU0A 3OY8A 1R1A3 4H55A 4ISRA 2UYAA 4S2FA 3WCRA 5C71A 1AL0G 1NT0A 3BALA 3GF6A 4PLNA 3VDDB 2YGLA 1RHI2 3ZSMA 3BTXA 2B45X 1U12A 1NY71 3ZN4A 3IN9A 2VUCA 5GM0A 2WNVA 5FRAA 4XJ9A 2Q0AA 1H30A 2GC0A 1ZBE3 3NO8A 1AR61 1AXZA 2BQPA 2XUMA 3NNFA 4KG0A 4WM8B 2XJVA 5T54A 1F5JA 5B4XA 1DG6A 1S0JA 5H9RA 3WP3A 4CDUB 4CP9B 4BXFA 1Z0HA 5FZBA 5JOXA 4AF9A 2BYVE 5I0DA 2WN3A 4B29A 4B4QA 5LB6A 3MICA 4PI0A 2VQTA 1AYM3 5D2AA 3CEWA 4SLIA 3RI9A 2FDHA 2WJSA 1PVC2 3MPBA 1PVC3 4H2AA 5CKQA 3SH5A 3WW4A 1MEC2 4AQSA 2XJUA 4FO9A 4JKMA 4XHBA 1BK0A 4XUNA 3X29B 4AFDA 2ID4A 3ASIA 1OLMA 3MO4A 4UF0A 2QFEA 3I3DA 2C0ZA 1DYKA 4CTEA 1Z7S3 5BYNA 4KGQA 1VMJA 2W1SA 3W59A 4CDWC 4ZY9A 4Q0VA 4DOUA 2YMZA 1OF4A 4O65A 2DCZA 4WVWA 4AFAA 4UBGA 2A1XA 5HV0A 1YXWA 2C4XA 2ZKNA 1TEIA 5JIUA 4JZRA 1A8DA 2P37A 4CDXA 1FOD3 1ULCA 1XJAA 3I2JA 4HVRA 1S0IA 1ASJ1 1D4VB 5EYXA 4XFBA 5FYYA 1PNFA 2EXHA 3CJXA 4HPKA 1VJ2A 2B4KA 5KC5A 3CO2A 2GDFA 1O5LA 1TVGA 1QJX3 4EROA 3VBOB 2WQZC 5DG2A 1WMDA 3UETA 2YB7A 1OF3A 4EZHA 1Q43A 5A6YA 2KXLA 4XBLA 1J3QA 1GZTA 3ZIXA 1WWYA 2CNAA 1US2A 2ZHLA 4K40A 3SLIA 1WLWA 2D98A 2R30A 3ZPYA 3N9NA 2VZ1A 4LK6A 4MGIE 4QPIA 4ES8A 4UF0B 1T2XA 4XUTA 3ZN5A 2FCTA 2P2KA 4NIIA 3M4FA 4HN0A 1K5MC 2HWD1 1LHVA 2KM2A 1G8WA 1KFUL 3V65A 1RUG3 1W39A 4BLJA 1RB8G 1RUG2 4E4ZA 2C9KA 1HQWA 4TLFA 1W99A 3NJVA 2OPKA 3SHRA 2VTXJ 4LBMA 3C7HA 3VKFC 3CKHA 1XPWA 2R061 4YG6A 2FDIA 2WYFA 4FVVA 2BNNA 3GYDA 3POJA 3S57A 1O3QA 1NA1C 4PI2A 5LZ6A 2WS91 4R9CA 1QXRA 4PIZA 3LZZA 5F37A 4OHZA 2CGOA 3DXTA 5E8AA 3MV01 4LUKA 1WW7A 3ZMOA 1SLAA 4ZONA 4LIVA 3H50A 1W6MB 1JYVA 3VBUB 1W2UA 2D6NA 2O8OA 5BNPB 4P02B 4LO6B 1CZSA 5L7OB 1LJ7A 2JB8A 3AKRA 4PIXA 4NHLA 4W50A 3M3CA 1HJFA 4BJ0A 5JMCA 4EV0A 2WZ8A 2VM9A 4Q0QA 3LKJA 1SBDA 4QPWA 5F3IA 4AVSA 2BFUL 2ADEA 4OI1A 5AFEA 4CA9A 2JENA 2WFPA 3GZEA 4YVWC 4F3JA 1APNA 1LR5A 4XC9A 2WWJA 3BPSA 3ZR5A 3CHXA 1E5RA 1QXJA 5DZFA 3BU7A 2WSUA 2AACA 2VC9A 4H3WA 5AVAA 3RI8A 2D6OX 2PAMA 4PT6A 1G9AA 1V6LA 2D3PA 3O7OA 4YW1A 2RR13 3I2GA 2CU5A 3IMMA 4NE9A 5F6LB 4I01A 4FAGA 5LA1A 4MGTA 3RZKA 2BGPA 2E63A 4G4FA 3VD4A 4A4AA 3FHIB 1JYNA 2P17A 4FPEA 4LUMA 1VBD2 3DYPA 3K4AA 4LEJA 1PGL2 2YZ4A 1LOGA 1MQTB 3ES1A 3RVHA 4CEWA 2F6BA 4B1LA 2E31A 3VBFB 3B7MA 1HB4A 4MH0E 1U5IA 3U78A 5C33A 5ABJA 5FPUA 4Q4W1 1PMHX 2DVAA 1VRBA 2YY1A 4XXAA 5F3EA 4XAAA 3O0XA 4CEYC 1J1LA 2Y6FA 2JDKA 3ILNA 1LECA 2JG9C 3QACA 3D4KA 3TYJA 5GLWA 5G05L 1D4M1 3LD8A 1MS3A 3ZLIA 2VO5A 4DS0A 1GICA 3AMMA 3K3NA 5CADA 3UJQA 1PHMA 2TUNA 1RJ8A 1OVSA 3J7LA 3ZFEA 3KF5A 1POV3 3RGBA 1J58A 2IXJA 3SEPA 4BIFA 2UWAA 1K42A 3VGIA 4FPLA 4E27A 1O7FA 3B9CA 2VH9A 2XHNA 5JXHA 4CCOA 4JGZC 2NYYA 3VL9A 5I0SA 1K5MB 5J3UA 5CNAA 3T08A 5CB7A 2G4IA 1UMZA 2D7FA 2R071 2ZHMA 4Z92B 4ATEA 1DQ0A 1Y3TA 2E33A 4QXKA 5JXIA 3OPTA 1A8MA 1ZZBA 2I07B 1XU1A 5IAVA 2BBAA 3SXWA 3AKQA 1PK6C 4LA2A 1MS4A 1QJX1 4PF5A 1YRZA 4Y22A 3VHNA 1NA1B 2VCMA 4XJAA 1AX0A 3KT1A 1YWKA 2PHTA 2RM22 3VBSB 3RG0A 1NCQB 1TQ5A 4HG6B 1YFWA 1COV2 2ENRA 2HWE1 2PQQA 3HIFA 4BQXA 4CDQA 1FOD1 3DL3A 2DBNA 1J84A 1UZWA 1OLQA 2JB4A 4JGZA 1BBT1 4XQWA 1R092 3B5LB 1RUD2 1WZXA 1FPN1 1ENRA 1TNFA 4OCTA 4AOCA 1F2NA 4QDSA 1AL21 5LATA 1HRV1 1QJY2 2VMEA 2YFUA 1O6UA 3OGSA 1K5MA 2E7TA 4QDQA 2BVVA 5LASA 3JBG1 1XE7A 1RUOA 2DBIA 4JDNA 3EXUA 4QQOA 4OVEA 5F39A 3ECQA 1PK6B 2Z79A 3T30A 1CN1A 3A21A 2DCTA 4CEYA 2DUOA 3BKZA 1AR93 2GH8A 4IEZA 3OGGA 4IE6A 4UW5A 1OH4A 3JZVA 4ASKA 4L97A 2E51A 2NZ9A 5DDJ2 1EUTA 1X50A 2GU9A 4G3YC 4K6BA 4OHYA 3KSCA 4YG0A 1Q56A 2EIDA 3TEWA 1OQEA 4Q8KA 2WAOA 4GWJA 2LTNA 3IB3A 2RJKA 1RUC2 1N1VA 3AZZA 3BB6A 3FHQA 1OPMA 3HBZA 3IBMA 3OF1A 3U11A 3WQBA 2VUJA 3IDEA 3F95A 2JDAA 2R043 4MGKE 3IMNA 4MO3M 5FPXA 1W9WA 5A3TA 3O1TA 2PHLA 1ZVFA 4P5HA 3WQ0A 1AR72 3JQWA 3PVNA 3U10A 1REEA 1VR3A 4FXGB 4YVWA 4BM8A 4GWMA 4W4ZA 5ACA3 1HRI2 4NROA 2RS11 1XNCA 3UT0A 1QXPA 3HNMA 2WDBA 3MFAA 3GBFA 4OMCA 4RFRB 4CP9A 3VBHB 4G9SB 3POEA 4HZFA 4EWAA 4QDRA 1DGRN 4NPRA 4RSUA 4IQPA 2L9LA 3ZVXA 1JYWA 1X9PA 1ZZ7A 4LBOA 4OQ8A 1PZ9A 2VNVA 1W6PB 2XH6A 5JI7A 3CU7A 2WABA 3RJ2X 1BCXA 4COZA 5F2WA 4QKFA 5EP9A 5DDJ3 2ET1A 4FTEA 1ULGA 3BVCA 4YRDA 2ZZQA 1URXA 2VUAA 4COWA 2AYHA 1CIYA 5A7WA 4Q4Y2 2VXRA 4RD7A 4D7SA 2YROA 5FPLA 4ATFA 1W2TA 4BZ4A 5ACA1 2ZGSA 3FL7A 1JHJA 5BPXA 5EWSA 3VN4A 4URAA 4HL0A 2R063 3AYAA 5EZWA 2MNGA 2A6YA 5FYBA 4JQTA 3UJOA 1SLLA 2OZJA 4BXSV 3GNEA 2WNUA 2UU8A 4BOWA 2VECA 3UGGA 1G6NA 3NJZA 5EJZB 3VBUA 3AZWA 5BNPA 1SZBA 2FHRA 3FLTA 4JGYA 1L7LA 3PIJA 5SV8A 1UZYA 4LO4B 4XHXA 5BY5A 1RUJ3 4LR4A 5K0UC 2SBAA 2WQ8A 4GIQA 4HXCA 3VBRB 2JKBA 2VJXA 5HBAA 3HNBM 1ENXA 2PFWA 2GH2A 1W0PA 3AFKA 2GSYA 3J8F3 1WCDJ 5HXMA 2XKPA 4IEXA 3FJSA 3O1SA 4QX8A 1UOGA 2XLFA 3WP5A 2DUPA 1DQ1A 4HPKB 4Q4X2 3KCCA 3LSDA 1AR73 1KEXA 1W8NA 2PHFA 3GZAA 3WF0A 4CDUC 5BNOA 3LOIA 4JV4A 1ND2A 3SNMA 5FYIA 3I3EA 4R4XA 4Q5OA 2W0XA 5CZKA 4Q1RA 2QQVA 5A3UA 4OQ9A 3SEEA 5J98B 5E1RA 3CIHA 2WBKA 2ZAHA 4Z82A 1DYOA 5JIAA 4AW7A 2VULA 5L36A 2IVJA 3VDCA 3BIEA 4E2QA 4QM9A 5IATA 1X36A 3NSTA 4UBHA 1AL23 1C5HA 2WT0A 5JPMB 2O0OA 1PO22 1J83A 1IZ3A 2YPJA 4R4ZA 4ASLA 2Q8DA 4HN1A 1DGWX 3BN6A 3ZFGC 3JU9A 1BBT3 3GM8A 3A0NA 3AP7A 2GC3A 3NMBA 3P6BA 3WOGA 3ETQA 4CUCA 2ZGMA 1CPMA 3POGA 1O3SA 1MQTA 1I5PA 4YW5A 3ZFFA 2VBPA 4RL7A 3QH6A 4K9SA 3ROUA 2V5YA 2WZR2 3JUUA 1BQPA 1YQ5A 4L0PA 1HX6A 5AVPA 5AC92 2YV8A 2OZ6A 1HRV2 3R4UA 4LBKA 2DVBA 1GBGA 5LBFA 3ZXDA 2PHDA 4PBPA 2ZHNA 5KXBA 3HD8B 2B46X 1MPXA 4I0WB 4BHPA 1RUD1 1LNSA 1CQ9A 1AYM2 3DXUA 2Q1FA 2V73A 3SH3A 5DAWA 2W5FA 2YHJA 4XTPA 3FE5A 3OD0A 4ES9A 1UYXA 5DMYA 4DUVA 2CSGA 3KV6A 3OYWA 4CRQA 3PMSA 3WHTA 5B4NA 1ND3B 5CYYA 1VAMA 1KS5A 1WD3A 4QPGC 1FMD1 3WG1A 2YBKA 4RHV1 2NQYA 2RE9A 4QXHA 3T3YA 2VR4A 4L99A 4MLOA 4UFIA 1ZX5A 2EF6A 1VBB1 1XNDA 4W6WA 4GH4A 3KT4A 1Q8OA 5SV5A 1H4HA 1W8HA 1CAXB 5FYTA 5KHKA 2C24A 1XB9A 5LW9A 5C3QA 2QZ2A 4ONUA 1W9FA 2HYXA 5FAXA 1RVF3 3VV1A 3O1RA 4LBJA 3LPGA 1B35C 4GWIA 4XF1A 1IS3A 1ST8A 1NE6A 3FZ3A 5FBZA 4UXAA 1JHNA 1XYNA 3M3OA 4AQTA 1VBE1 1KXGA 1JOJA 1IG3A 4YVSC 1WLCA 4IEWA 4LO7A 2B7YA 1GP4A 1VBC2 2GALA 3S6PA 1OUXA 3CJIA 2GN7A 1XYOA 4XE9A 3WP4A 3KV9A 3TEXA 4UFMA 1BXHA 1O91A 4EZ4A 1IKPA 1HDKA 1L7QA 5KC6A 2R16A 2VMIA 2R6QA 4A7KA 1CX4A 1LGBA 1DGLA 2RR11 4Q4V2 4EN8B 5CFCA 4XJ8A 4UI9L 2FZ1A 2VL4A 1X8EA 3EJKA 4XUQA 4BA6A 1Q3EA 4AHWA 3VZJA 2IC1A 4P9IA 1UD1A 3KT7A 4AE2A 3RFRA 3WQ7A 2VMDA 1NCRB 5ACA2 1GU3A 1VRH1 1CR7A 2PN5A 5HCFA 1B35B 3C7FA 4OYUA 2EXKA 3UKNA 1YJKA 3MI8A 1VMFA 2CYFA 4RR3A 1V70A 5EXOA 4F7ZA 1TMF2 1OMIA 3NNMA 1VBD3 2VBBA 5C3RA 2FDFA 5IFPA 2HJIA 1C5IA 4FP3A 2TNFA 1PGSA 4MXWB 1KGYA 3RPQA 5FOBB 2E9QA 1WGPA 3SC7X 1EP0A 3Q8EA 1SLTA 5FY0A 1CAUB 1QJX2 2OW4A 2D6PA 3RYKA 3WDVA 1AHSA 1F31A 4AFMA 2SLIA 4NPMA 1LOFC 2FMYA 2PELA 4N9HA 2FCUA 1A78A 4CVUA 1U5ZA 2XLGA 4YW2A 3HT1A 5FZOB 1FOD2 3B93A 3WQ1A 1UU4A 4AEDB 4AGRA 4C91A 5JSPA 3N36A 2Y6HA 5GZGA 5FO9B 2VPVA 2ET7A 1LENA 1W9TA 5CFDC 1AR92 1US3A 1WCSA 3W21A 2QBXA 4EWDA 3SKJE 1LCLA 1RUG1 3ELNA 3ETPA 1SLCA 3AMNA 2VCBA 4JTNA 1S2BA 4MVTA 1AR82 2ZMKA 4ISQA 3U1XA 4LXLA 1PNGA 3GHNA 3USUB 4DPNA 1MEC3 4DXSA 5HCAA 4OMDA 3UESA 3T1MA 3WR0A 1HXS1 2VZ3A 4JQRA 5KXDA 5EQUA 3OUHA 2C6SA 5IUQA 4JDOA 2OX0A 5CVRA 1EAH2 4XF3A 2W39A 3URFA 1UY2A 2XWJB 4A42A 1PIV2 4JX0A 3JCIA 5I8YA 2OPWA 5GALA 2Q8OA 5K0UA 4Y5TA 3LDBA 3ATGA 4GH4C 4IW3A 3AP5A 5FXXA 4Q0SA 2ZX2A 5FBJA 1AVBA 1MS0A 1OA3A 4OHWA 3B69A 3ZFFC 1MZ5A 2DU0A 3NAPA 4DRRA 1NA1A 2QQNA 3BIWE 3POWA 2P3IA 5CG9A 4HMZA 5C9AC 4M3CE 3SMHA 2QQLA 4DQAA 2VCAA 4XFCA 4QB2A 4AI0A 4Y1VA 3MFCA 5C5UA 2ZX3A 4RQPA 1P8JA 3PTRB 3PMEA 1OQDA 4LIUA 3PLQA 4AXOA 2G19A 4CDWA 5FQ0A 4XACA 4Z2AA 3VKLA 4LHSA 1H4GA 1C1FA 4IGOA 4ZU5A 1ULOA 1ONAA 3WNNA 2DTYA 1F35A 3P1IA 2HWE2 3H42B 4V2WA 4XURA 2P6CA 2VMGA 4NRQA 1GP6A 2ZEYA 4I30A 5D1IA 1LKNA 1SHWB 1W90A 1FV2A 5LCWL 4A41A 3ORJA 5C9AA 5I93A 3OGVA 1PIV3 1VALA 2VXJA 3ZSEA 5I91A 2VU9A 5HV4A 4FSJA 1CWPA 2QQJA 2VZPA 1QJU1 1YFYA 1GOGA 1OFSA 1WMFA 4Y20A 5A3MA 2QQPA 1S0DA 4S2GA 2QQKA 2RDRA 5D8AC 1JZ3A 5FYVA 3I2IA 1VBA3 3VZLA 3VB9A 1Q8VA 1SFNA 1K45A 1UQXA 4IGQA 5KXEA 4CCJA 3OGRA 1OBNA 2ZACA 3J26N 3UV9A 4AG4A 5A1FA 1QF3A 1E5IA 2YC2A 4XZPA 5LEKA 2ZMLA 2WAAA 3LIHA 3FBYA 3H1WA 3POFA 4UFHA 4UOJA 1JZ6A 2A3XA 1S2EA 1WD4A 4CP2A 4NRMA 1C8M3 5T3NA 3WNLA 2O14A 2ES3A 3M1HA 1PK6A 4OULA 1DQ4A 3GBWA 3WY6A 1G7YA 4AHYA 3TEYA 1HRI1 1K12A 4IE0A 1GOFA 1V6MA 5IVFA 1KFXL 1LHNA 1ZRCA 1UYZA 3RZHA 5LA0A 1R1A2 5I0RA 3MV11 1RUI1 2D5HA 3D8CA 1I5ZA 1FATA 2RS33 3VZMA 5K4LA 3MYXA 5IWFA 3JXSA 3SISA 4GZ9A 3WDUA 2R1BA 1HJGA 4QX3A 1S2KA 3ES4A 5FLHA 1H6XA 3F2ZA 4TXWA 1OUSA 2WWSA 3I2KA 1GZWB 5IK5A 4JHZA 1COV1 4AAPA 5CG8A 4Q4X1 4BIOA 1WMEA 1EV12 3UGHA 4KWLA 4D94A 1JZ7A 1O5UA 1UMIA 2IXIA 2ZOEB 4LTAA 5FYZA 3U4SA 2PLV3 1N1TA 4CCNA 4M0NA 3ZN6B 2XG3A 2X09A 3B9IA 4WM8C 3WF1A 1VRH2 2AEYA 2IFWA 3E5XA 3INAA 3WNMA 4AI1A 2VMHA 4CEYB 2XMLA 3HQRA 3I8TA 2QUOA 3IKWA 1UZZA 1AYN2 2Y0IA 2KD7A 3IDCB 4AZZA 3HQUA 3DYOA 1YLLA 1W8ZA 5C4WB 2BPA2 1MS8A 4OUMA 2P3JA 1R64A 3PDQA 5FYSA 5DAQA 2VQAA 3WP6A 1NKGA 4PBOA 4E4SA 3OPWA 1RUI3 4QPIB 4CXWA 5A3LA 1GZCA 1IS5A 1UY1A 1X33A 2GNMA 3LEIA 4OUEA 4QPGB 4YGCA 5FLJA 4WM7B 4ZKTB 4CCLA 4L11A 4QU1A 2BWAA 3KGLA 2BU9A 3NNGA 3A23A 5GKAC 5H9SA 4RGGA 5DG1A 3DPRC 3SH4A 3SKVA 5F2SA 3T09A 1ZBA3 4DXTA 2A75A 2ARBA 1RMU3 2BGOA 3AYCA 4YGEA 4ZZ5A 2RHPA 3FMGA 2BZDA 3ZFEC 3DV8A 4OLLA 1UY3A 4XF0A 4C0BA 3B00A 4BPZA 3LFMA 4FPJA 3FBMA 1V6IA 3JQXA 2RS51 2B9VA 4A6SA 4AFBA 1YUDA 1VBE2 2J1TA 3VZNA 1O8SA 4RA0A 5FP9A 1AXKA 2ERFA 3AX4A 1JH5A 1UXXX 3GXUA 2I74A 5KXCA 2GNBA 1QOTA 2WWUA 1PO21 3E6DA 4MX3A 5FY5A 3THDA 3WUCA 1ZYBA 1WCKA 3BOWA 3RNSA 4CYDA 5A3PA 4Z8BA 4UYBA 3KF3A 5ANQA 4D69A 3QBQA 3TNPB 3ZYJB 1HXS3 2RDSA 5FFOC 4R9DA 5A6QA 1AUYA 5JZGC 5IK7A 1NCRA 5I8TA 1SG3A 3I49A 4WM8A 5FZ0A 1WA6X 3AKTA 3MDPA 2TEPA 3AMQA 3MHZA 4M0HA 2RV9A 4ZS2A 4U36A 4B4RA 1WUVA 2Q1MA 1FMD3 1MZFA 4RR3C 5F5IA 3Q9OA 4I0BA 3S0MA 2FDGA 4LLFA 4CP1A 3CNAA 3K46A 4CE8A 4Y20B 5HI0A 1H8TC 1QGLA 3I97A 1FPN2 2JJ6A 2IFRA 3JD71 4FCAA 4Z1VA 2W94A 4TZDA 1OPOA 1QJU3 3HBKA 4BQ5A 3N7KA 1W0NA 5FPAA 3WW1A 5C8CA 4NO4A 3MPPG 1HKDA 2BEOA 5CIRA 4AK3A 1WCQA 1VB2A 2QE3A 2VD7A 4YFWA 2A5ZA 4N53B 3NWKA 1SFPA 2HWF3 4B8EA 4K21A 4YW6A 1GV9A 1KQRA 1W03A 5JUVA 3THTA 1OQ1A 3OY8B 5A70A 4CDWB 3VHOA 2B39A 1GANA 4XFFA 4JDMA 4UFKA 3U4XA 3NQHA 1POQA 1QQP2 3GGLA 2IXLA 2VZVA 3QD6A 3NAPB 5LY1A 1RUH2 3W20A 5K7PA 1Z78A 3J8F2 3W5MA 4GULA 2PAKA 4DY5A 3MIDA 3WV6A 3RMXA 4HFSA 1ODNA 4CUGA 5FUNA 1C28A 5DUXA 1XSQA 1XU2A 3FWEA 4YYOA 3LEGA 3D5OA 1CONA 4XUOA 3AP4A 5FP3A 5C6CA 3HEIA 3ZYIB 1COV3 2CTVA 3E6CC 2PAEA 4N8MA 2BUKA 4V1PA 1JZ5A 3FN9A 3LOBA 4S2HA 2JG8B 4R8HA 2AENA 4C1XA 4OHVA 1OOPC 1Y7BA 1HLCA 1W8FA 1YO8A 2ARCA 5LBEA 5JAXA 4KU8A 4P9YA 5FLIA 4BDVB 4AWDA 2MEV3 3L2YA 2JIJA 2ZXQA 4QWNA 4A7YA 5CEHA 2JG9B 1SLBA 2G1MA 2P6HA 2VZSA 2DDUA 5CKMA 1RUH3 5FOJB 1CESA 1Q5OA 4ORFA 2HBTA 4QHBA 1BBT2 1MEC1 3M8LA 1Y43B 4P00B 3RZLA 4J6GA 5LBBA 4DO0A 3APBA 5JR2A 3JD72 2R0FA 4HK8A 1MVEA 1Y9GA 1JZ4A 1E57A 2P3KA 5LRRA 5FP7A 4QQLA 5T55A 3ZSKA 2W2IA 4AYUA 1W6NB 2PHWA 1DIWA 4RHV3 2PHUA 2NLRA 4QGNA 1REFA 4KH9A 3UGFA 1WBFA 2R7EB 4JRLA 4AQ6A 1XYPA 2VW0A 4E4DX 5JDBA 3PU3A 3CL1A 5JZGB 2W87A 1GKBA 1OD5A 4S2DA 3VBRC 2ZX0A 2OXBA 2JDHA 4QB1A 1QJU2 3T2QA 4XMAA 1REDA 5ANNA 3ZXFA 3ALQA 1PM4A 2DCKA 4GA9A 3VBSC 4RS5C 3VDDA 1NLSA 2B42B 3PJQA 2WT1A 5E6HA 5CFDB 1H8TB 1KDKA 1DU3D 3AXDA 1TME3 3AXEA 1H8VA 1JOPA 5HCBA 3BI3A 4HKOA 5FXZA 5FYMA 3CZUA 5JR7B 3VDAA 2ZTNA 3A4UA 3MBWA 4GAZA 4NPLA 1CZTA 4CDUA 1JU3A 3EQEA 4E4HA 5BNOC 2V5DA 4UW3A 2RS31 5LY2A 2VAUA 2DCJA 4QU2A 1OC1A 4QX1A 2XQXA 5H9PA 4P9JA 5GLUA 3ST7A 4XDPA 3ENRA 1LHOA 4JAAA 3M3QA 4NR1A 2YBPA 4IL7A 1RVF1 4PQ9A 2DTWA 3FUQA 1T6GC 4OI4A 4CCCA 3O1PA 2LM3A 3P3NA 4Y24A 5FZ1A 4FI9A 3NV4A 4BQ2A 1C8M1 2VY0A 3TN91 4WM7C 5CFCB 4MADA 5JSOA 1A3KA 4A3XA 5GZCA 3K2OA 3GJBA 2C1FA 1LGCA 1ZA7A 3AZXA 3L2HA 4I09A 4P5YA 4RS5B 5GZDA 2HEWF 4CDXC 3VD5A 2WNUC 3IZOA 4M3CA 1PX4A 2QQIA 4DIQA 5FJKA 5FUIA 1MS5A 1NE4A 3NAPC 4LHLA 5J37A 1V6NA 1XRUA 4IV3C 4XFAA 4HETA 5I0UA 1G86A 4BMEA 1FYUA 2NMOA 4YVSA 1RUD3 2DFBA 2B8MA 4B1MA 4TWTA 2RDQA 1JYXA 4NHKA 4NHXA 2E53A 2ARAA 4MUVA 2J1VA 2K46A 1OT5A 1KRIA 3TOJA 1BEV2 2YU1A 3I54A 4LMFA 5E16A 3RRDA 3H7JA 1HQLA 4HVOA 4LE3A 5C7GA 3RZMA 4UFJA 3LAGA 1FV3A 1OOPB 1NX9A 4F8AA 2OT7A 5ERLA 2WKKA 3IAQA 1GMMA 1H9WA 1EV13 3VKNA 1QH7A 4LKSA 3GZTB 2EICA 2JDUA 1AYN1 1JBCA 2BP6A 5A3WA 1W2AX 5FY4A 5FCCA 3P5BA 5FZFA 2XB6C 2XL9A 1SCSA 2A6VA 5CFDA 4DB5A 5JOWA 3T2OA 4AFCA 1RITA 2IXCA 2RS32 3ZYPA 1XSRA 2VZQA 4SBVA 3H1YA 5D8AA 3SITA 1W05A 3WW3A 2WR9A 2H0VA 1XNAA 1W8UA 2QTWB 3KD4A 2CWSA 1MS1A 5JPNB 1YCIA 3ILRA 2XWBB 2D44A 2NM1A 3EMRA 3G6JB 1GSLA 1H2MA 3JB4C 2J7MA 2ETEA 5DAXA 4KWJA 1C8M2 4YPJA 4LO8A 2X05A 3VZKA 4DXZA 1FX5A 4D0QA 5A3NA 5FZEA 2XR4A 3FLRA 4C1WA 2C9AA 5EIYB 2Y38A 1V9U2 1VAKA 2H6BA 4LT5A 1OLME 2JXAA 4YZ4A 5IVCA 4Q2FA 1KJRA 2DVDA 4LNVA 4XOGA 1RUC1 1G9FA 2HWC3 4XTMA 2Y8KA 1XE0A 4TSVA 1NCQA 4BISA 2X29A 4Y1YA 2YXSA 4A44A 1F4HA 3H8OA 2P5BA 4JKKA 4DFSA 4CZSA 1W2NA 5A6ZA 4CCEA 5IT6A 4BLIA 4MV2A 1PGL1 4A2UA 3ZSJA 1LOFA 2QQWA 3U07A 3LWCA 3FFZA 1VBA2 1XNKA 1DLCA 4BCUA 2XGXA 3T4VA 4L92A 2VW2A 2JG8A 4BYYA 1PGW2 1RHI3 1UOBA 2XUEA 1V9U3 3OTFA 3OBTA 1PIV1 4FPOB 1ZBA2 2W1UA 3HQXA 4HT1T 3LGRA 4IGPA 2R062 1JS9A 5FXVA 4YM2A 3FC0A 1FT9A 2GP5A 4YZ1A 1RUNA 3D0SA 2OQ6A 3TB0A 5IK4A 1W6QA 1C1LA 1DCSA 1N47A 1RUI2 1WLDA 2GC1A 2J1RA 3H3UA 3NRUA 3THPA 1ACCA 2X53S 4FPGA 2XL7A 3GCWA 1XBFA 1OA4A 3CQOA 4IE4A 4IV3B 4XF9A 1DDLA 2D43A 2DV9A 1K5JA 2IWGB 2N7GA 2VTXA 1DLLA 2D3SA 2IVIB 3A7QA 4LO5B 4MYEA 4Q4Y1 5D8AB 5DUUA 3FFQA 3LPFA 3NV3A 3T4HB 1IQDC 5GZEA 1DGWA 4GKYA 1I3HA 3DEMA 1ZZ9A 2JDMA 1UZVA 1CJPA 4FFIA 5J7MA 3BODA 3PTYA 1BMV1 1AX1A 2FD8A 5B2GB 5C3PA 4E9KA 5A7QA 2WZR1 1UMHA 4NMIA 1B35A 3PUSA 4TYSA 5CAZA 1HQNA 3S5AA 3HWJA 3NNJA 1MZEA 3TN92 4AL9A 2VQ0A 2PHRA 1QNYA 3PUIA 3HR9A 1B09A 4KMQA 1JUIA 3OPZA 4NHYA 5FZMA 3O0WA 5L7OC 3J8F1 2A71A 1UCXA 1UU6A 4LOTA 4A7ZA 1CAWB 1BVP1 3CJIB 3J7MA 4K20A 2UURA 4IV3A 3DYMA 2JG8C 1RUJ1 3MW4A 3V0AA 1AJOA 3PUAA 2GP3A 2HWC2 1W9YA 5A7OA 3ZFGA 4IUGA 4AVTA 1SCRA 5FWJA 3Q8CA 4YVWB 1AR83 3L9JT 1DQ5A 4XIKA 5F5QA 1POV1 1LHUA 2OUJA 1AR81 5H9QA 5FPZA 1UZ0A 2B5HA 5FKCA 1LEDA 2YYOA 3S5QA 3DPRA 3FHAA 4QT6A 4KL1A 3ON7A 2V4AA 2VVEA 2OVUA 1K3IA 2P1BA 1UO9A 3NKTA 1QJZA 1VPHA 3W58A 1JZ2A 4ASMB 3UL2A 3UKTA 4PLOA 1ND2B 4B3NA 1WW6A 3EO6A 2FZ2A 4COYA 2VOWA 3RSJA 1N1YA 1QY4A 3ZXJA 5IVBA 2UYBA 1L3JA 2VNRA 2XHKA 4NAOA 3WX5A 4QMAA 1MVQA 2UY8A 1A34A 1RXGA 1UAIA 2WUHA 4DY3A 5F3GA 3K75B 4H7LA 2NP0A 3CBNA 3T2PA 4NIDA 5KHIA 1ZZCA 5C3SA 1SQ4A 2MHFA 4AGVA 1EY2A 3A22A 3MUY1 3AZYA 5KHHA 2X5IC 2Z5WA 3ZN6A 3VDDC 2OQ7A 3J9SA 2QZ3A 3PHMA 4NOTA 3V64A 3VBSA 5C5TA 1UKRA 1UPSA 4BMBA 4DEVA 1UXZA 2R49A 1W0OA 1NLRA 2X5IA 3O14A 2J22A 5CU1A 3N9MA 3BOPA 1FNYA 1LOCA 4QX5A 4GB33 2PLV2 4Q29A 1BK1A 3DUIA 4A3ZA 4P9WA 1Q8PA 3OCPA 1AZDA 2WO2A 2AUYA 1PVC1 3AVSA 3ZFEB 4PHZA 4YW4A 1GR3A 3E1F1 1QJEA 1LOEA 4JGZB 2RDNA 4IESA 2Z4FA 4LORA 3WDWA 1KJLA 4BQWA 3B94A 1EAH1 3B01A 3CMGA 4KBZA 1GFF2 1UYPA 2Q4SA 2IXHA 2R041 1OLRA 3D82A 4FFGA 4OHXA 4URTA 4FBFA 4YZ5A 5IYYA 2J1UA 4LQRA 1CGPA 1PO11 4XDOA 4XETA 2JICA 4W6XA 2PHXA 4EJRA 2V72A 1KD7A 4YNIA 5DUWA 1H0BA 1NQDA 3TNQA 1QWRA 2E7AA 3V0AB 3M3EA 1V6OA 1YFUA 4AAXA 3C8XA 5DUVA 4X8NA 1SMVA 2XQRA 3NV1A 3O1OA 4HK9A 5T5LA 2CDOA 2ZGTA 4IV1B 4DEQA 2ATFA 4AI3A 3NKGA 1YQ2A 5CISA 3B3QE 3SQOA 4IE5A 5DZEA 5HXVA 1EAH3 4YVSB 1Z7S2 2K9ZA 1QDCA 4CUAA 3VBOC 3RZGA 4LBQB 1LGNA 3LSEA 1SACA 3VDBA 4GMP0 4Q0UA 2QDRA 1X8MA 4BU2A 5A33B 2XJSA 3JBG3 2ZX1A 5F5CA 1SPPB 5C4WC 2W95A 2YUEA 2D97A 1W6PA 1D0HA 2DF7A 5DQ0A 3WDXA 4N43C 1YHFA 4XXPA 5IVJA 1HRV3 1BEV1 3BGAA 4X8PA 4CDQC 2HH9A 5FIXA 5IAXA 4YGBA 4WVMB 2D93A 4IXLA 3V0BB 4MGQA 2RR12 1ZBE2 3H3ZA 1PO13 5J09A 2HWE3 3HVDA 1F9KA 2VUDA 4KU7A 4AVAA 3O1VA 3ZXGA 2WZR3 3IPVA 5A7SA 4KWUA 4MGSA 1KITA 5FZ4A 4ARXA 3ZPOA 1C4RA 2OS2A 4HONA 4WBBA 3OYWB 4RQPB 3PVEA 4RHV2 1PM7A 3N4MA 1CAVB 2AC1A 2A70A 2A7AA 3KV5A 2LS6A 2RS13 4YG3A 4XFHA 3VBUC 2JECA 4C0HA 5BNPC 3AVRA 2D40A 2LROA 4YM0A 1W6OA 1BHGA 1FPN3 2CGNA 4JKLA 5FZAA 2PA7A 5GJ6A 2ZJCA 3EHKA 5BNNC 1ENQA 2VVFA 2WLQA 4LITA 3N9LA 1QMJA 1SDDB 3IWZA 3OB8A 4D7YA 1AYM1 2ILMA 3HJRA 3I3BA 3PVOA 3MEPA 4YGDA 1YQ6A 4ZU7A 1H9PA 3RZJA 1F15A 5FY8A 1S0BA 2ZEXA 3RS6A 1DP0A 1WA4A 2D5FA 1GLHA 2GN3A 1AX2A 3VD9A 3WINE 3UNPA 1RUJ2 1DFQA 2VZTA 2YPDA 3UK9A 4NIHA 1HXS2 2BW8A 2DVGA 4LBLA 1IPKA 1UNBA 1WW4A 1W6MA 1L7RA 2R073 2VG9A 1U5YA 1SPPA 1E5HA 1NG0A 5FJHA 1R1A1 5CKNA 3ZR6A 4F83A 1BEV3 1HN1A 2NN8A 1UOJA 4MG2A 4LBQA 1W6NA 5L9VA 2WNEA 3GALA 3K77A 4MXVA 2P3YA 4P14A 3ZO0B 4XJZA 1LOBA 2J1AA 4QKNA 3ZXAC 1LU2A 4I2OA 3N9OA 4QB6A 3O5SA 4GJZA 2CL2A 2A6WA 3TBDA
chains in the Genus database with same CATH topology
1OKQA 2H0BA 3ZFFB 1D4M3 3V56A 1D4M2 1DZQA 1U5XA 4K3UA 1RUE2 2HWC1 2QKDA 3EBRA 4GB31 4WV8A 5JLVA 2CV6A 5L73A 1F8VA 1UN1A 3AMPA 3U0ZA 1OHFA 1RUF1 3T2TA 3GZUC 4CDQB 3MIBA 4AGGA 4KGGA 4H7MA 2DUQA 1ASJ2 1IHMA 1N3OA 1D2QA 1JYCA 1SBFA 3RJRA 1Q8QA 3CF6E 1JTZX 1GNHA 4QQHA 1UPIA 2JDZA 2ZA9A 1D2SA 2DCYA 3RYPA 2EALA 4PDWB 5FTTC 4WZFA 3SCFA 3G7DA 2WS93 3AKPA 1VP6A 3KCYA 4LA3A 4PCRA 1YNAA 2GC2A 4FPCA 3S7EA 1FNZA 3QCWA 4GXLA 3AP9A 2WT2A 2XVLA 1V6JA 5LRSA 2HWD2 2I45A 2ZGRA 2QVSB 2ZGOA 3MGUA 3VBHC 2VOVA 4K7JA 2CGPA 1IOAA 2JE9A 2ZKLA 3GHMA 4N53A 3J4UH 1M4WA 2E7QA 2VW1A 4IEUA 3RQ0A 4HLTA 4JCKA 4N7IA 1H2LA 3SCGA 1QOOA 2HEYF 2MEV1 1PO12 1RMU2 1RUE3 2D6KA 1ZZ8A 2H6CA 5BNQA 4GH4B 4AHZA 1AR91 4AI8A 3ZYGA 1ZRRA 2ZMNA 3R4SA 4KNCA 1G9BA 2MEV2 1ND2C 2DVFA 5GZFA 2QCSB 3TN93 1NYWA 1DGRA 5FMOS 2GMPA 1QJY3 2LUWA 3MLLA 2RM21 2ZBJA 2JD4A 1N3PA 3E5UA 1OA2A 5AC91 1BYHA 3AM2A 3IM0A 2MPFA 4XIOA 5BNNA 4FOVA 2PYTA 1RIRA 5GLVA 1R091 4XPVA 3WT3A 1HW5A 2HKXA 2B9UA 4INDA 3MIEA 2W52A 1OSGA 4FTBA 4O9EA 1YIFA 1DZTA 4JTOA 1ZBE1 3DGTA 4JRAA 5JOZA 2LALA 2AR6A 3QLQA 4MGYE 5F1RA 2ZS6B 4R9BA 2K0GA 2RJLA 1YI7A 4HKWA 2O8QA 1S0CA 5DZGA 4WM7A 3WW2A 1D0GA 2ARXA 3I59A 1N1SA 3AZVA 4M01A 4QPIC 1YYNA 4BE3A 1FI2A 1ULDA 2FMDA 2TBVA 4DMIA 2HWD3 3WDTA 4YZ3A 1IS4A 5JSRA 2BBVA 1ZNPA 1UL9A 2XJPA 4XF4A 1AR63 2ZGUA 1G9DA 4AVVA 3KLSA 1VBC1 1RUH1 4EN6B 1BVVA 1R1ZA 4Q4W3 1V9U1 2G9FA 3D6EA 1RHI1 1UX6A 3PNAA 2PTMA 4META 5GLZA 1OI6A 5BNOB 5I8SA 3N7JA 4J1XA 2JE7A 1KS4A 3R05A 2VNOA 2QNKA 5C8CC 1PMIA 3R4DB 4N43B 1ASJ3 5K0UB 4GQ7A 3MF6A 3OGJA 2Q30A 3MW2A 1WLTA 2A6XA 1YIPA 3AKSA 2JG9A 1HV0A 2WA3A 3USSA 1R082 1SLIA 4NWWA 4QGMA 4IETA 5BXXA 4K1ZA 4Q4Y3 2XJQA 3VZOA 4FPKA 3VBOA 2W08A 1M06G 2WNUB 3I4IA 3RMYA 5K9YA 2RMU1 4D3WA 1SBEA 3FUOA 5A32B 1C3HA 3VBHA 4OZXA 4XQ4A 4WVMA 1CAWA 1YI9A 4EN9B 5KBFA 5BUVA 5F6KA 2HEVF 2XBO3 1ZZ6A 2NPIA 1NXD1 3WLUA 1BKZA 4BQ1A 1NQJA 2QJVA 1U0AA 3VBFA 2QDNA 4OFGA 3WVJA 1F5FA 1LEMA 4XFIA 3VKOA 4YM3A 5ABJB 3BTAA 1AYN3 4QPYA 4HSLA 4DINB 2BFUS 2Q5TA 3PVBB 1H2NA 2V09A 3DN7A 4EWEA 3AJZA 4Q26A 5C9AB 1LESA 1TE1B 3MIHA 4CP0A 4FQ4A 4XYXA 2ZGNA 4E2GA 1RUC3 1JXNA 3KM5A 4FPHA 5JVVA 2XJRA 4QGLA 4I0AA 2RS12 3WZ1A 3B02A 2GZWA 2O1QA 3CLPA 3HT2A 1NY72 4K8FA 4Y26A 2BTVC 1XE8A 3QH7A 1R083 3AYEA 2WNVC 4YSFA 1NOVA 3H9AA 3LB9A 1J3PA 1DZRA 4Q0PA 4RGAA 3ACLA 4XJUA 1QH6A 1O4YA 1NCQC 4R52A 1QHDA 3BCWA 1S0EA 4RQPC 4HANA 4WVVA 2VVDA 1Z7S1 1UKGA 4L2NA 2CWMA 1AJKA 1LOAA 3WUDA 2ZX4A 4E2SA 2BNOA 4Y1XA 4IEQA 5JZGA 4I3GA 1TMF3 1AR62 4Y1ZA 3RYRA 2YC0A 2KA3A 3NW4A 1QQP1 4XQDA 1IQAA 3WDYA 1VLNA 4FOWA 4IV1A 2HWF1 3TWIA 1TME1 3VUOA 2HWB2 3C2UA 3KMHA 2AGSA 4M3CF 4FP2A 4HKLA 4Q4V3 5A33A 1O4TA 4FXKB 1J3RA 3K48A 1S55A 1JUHA 1CVNA 1WBLA 3JD73 2EAKA 3KQRA 5LK5A 3VHPA 4LBNA 2RS52 1EPWA 3I7DA 5C4WA 1A6CA 2RS53 4E2QA 1HV1A 2GNDA 3ZIWA 4I3PA 3TAYA 1EYBA 1GYKA 1Y9QA 1LULA 1JW6A 2VNGA 1DBNA 3M70A 5CFCC 2XKOA 3RZZA 4N90A 1VAVA 5F9TA 4QPGA 1O3TA 2CAUA 1ZBA1 4H14A 1UW8A 4CDXB 4GALA 1LODA 2A73B 3H1MA 2HWB3 1MR5A 4L8QA 2CY6A 4GB32 5JWPA 1NXMA 2HYKA 4RR3B 4R9AA 1ENSA 4PJYA 1G9CA 4YFZA 2D6LX 2JEMA 4W6YA 3MF9A 4XBNA 5ABJC 4FQZA 4XW3A 2YGMA 1DHKB 4X6RB 5FMOL 1SEFA 2D6MA 2OUHA 2WLPA 2NMNA 2EIGA 5BNNB 1RINA 3MW3A 4EN0A 1UIKA 4XDQA 5AFBA 1RMU1 5LK7B 1QNWA 1AF9A 5FDBA 4JC1A 2Y0OA 4J1WA 3LA3A 2WNVB 3POYA 1ZRFA 2WC2A 1LHWA 2WFF3 4FPYA 2AH2A 3NVCA 4NN0A 3ZXKA 1FAYA 3LA7A 4AVCA 2DFCA 2PLV1 1NCRC 2ZCWA 3H7YA 1EV11 1YFXA 4JVAA 1BJQA 1YJLA 4L9BA 2GMEA 2ZHKA 4YM1A 3ZXLA 1H1AA 3HN1A 2I2SA 4BWOA 3N7LA 4YARA 5J36A 4RFT0 1H1MA 1DYPA 1PZ8A 3IDBB 5FO8B 4YLZA 1N3QA 4N9IA 1UIJA 4COUA 2FQPA 3FLPA 1FMD2 2R0HA 2K2SA 3N3HA 1ND3A 1JN2P 4Q4W2 1QKQA 1TME2 1ULEA 3KCXA 1PVXA 1VBB2 4FT8A 1IKQA 3E97A 4W65A 2OIIA 2UWBA 4QQ2A 3E6BA 1ZRDA 1FXZA 4IERA 2GNTA 4Q4X3 4B7EA 4M00A 4IEOA 4PIYA 5KWRA 2FBEA 4HBNA 1NZCA 4DZGA 1VB4A 1J59A 1S1AA 3DF0A 4P9XA 1MS9A 1RTVA 4FPFA 5JOYA 2WINB 2BVBA 5A32A 1VBE3 1CD3G 4AHXA 3ZX7A 4KBBA 1RVF2 1X7NA 3VBFC 5L7OA 1H1IA 1H2KA 3K51A 3VKMA 1SDWA 4Q27A 3NL1A 1VBC3 3ILFA 1CIWA 3R6SA 5E88A 4Q8LA 1GQHA 1RUF2 4XJWA 1ALYA 4HVQA 2ZGQA 1CAUA 5EV7A 3T1LA 3KS7A 1TNRA 3VHRA 4GMP3 1GQGA 3W9AA 2BNMA 4KWKA 3AB0A 3NV2A 3ZYRA 1V00A 2XVGA 4AEDA 2WSVA 2DURA 2AZ5A 2Q1ZB 1GNZA 1LB2A 1CPNA 1V6KA 2R072 2WFF1 5FREA 5T5PA 3P3PA 2ZGPA 4I02A 4ZU4A 4N43A 3HAGA 4XFGA 2DYCA 2W68A 2ZPXA 3HMYA 3JB8A 4Q4V1 5J48A 2XLAA 4FOQA 3RWNA 2EVXA 4LLOA 3WCSA 2BGCA 3OJBA 3ZMNA 2DU1A 4DNYA 4YW3A 2GMMA 3N35A 5JCTA 3OD4A 4MSVA 3VBRA 1ND3C 4GMP1 2Z2SB 2IZWA 3KB5A 4O9GA 3SCHA 4K1YA 4MZUA 4AEDC 4WVZA 1QQP3 2UWCA 2ZGKA 2RMU2 3VL8A 1PO23 3USUA 5AC93 1AXYA 1ZA4A 1AL22 4QQPA 1RC6A 3LA2A 3M3IA 2HWB1 4AVBA 4ZXKA 5TSWA 3CJIC 4MXWA 3IIAA 2VGDA 1X82A 2IXKA 1CAVA 5FO7B 4Y1UA 4WZCA 5C8CB 2CAVA 4Y4YA 5I0TA 4XILA 4PLMA 3O12A 2G9GA 2Z42A 3ZFGB 3I59B 4GKXA 1AR71 1QDOA 5J96B 1MACA 1R081 2EXJA 4N53C 3LCPA 5K8SA 5CBLA 3WG2A 1I6XA 4XMIA 3DPRB 4IV1C 2R32A 4OI2A 1XNBA 3D0JA 4LHKA 1IS6A 4IEVA 2XBO1 5T5OA 5T5JA 4IEPA 3KGZA 1DF0A 2WL1A 4FAHA 1QOSA 3WHUA 4Q1PA 3MLKA 3M7AA 3ZDSA 5JI9A 4NWVA 1PGW1 1GZ9A 1S0GA 4ITCA 2ZZJA 4GWNA 4KQ7A 4AEKA 2XBO2 4HSJA 4IEYA 4P9GA 2A3WA 4Z2WA 1VBA1 1LRHA 2XPJA 2YDEA 1LU1A 4B4PA 1OOPA 1KDMA 3POSA 1C8NA 1VIWB 1CAXA 5LEJA 3FX3A 4CEWB 4FTSA 2GAUA 4Y5Z0 1LTEA 3UKVA 4LBQD 3AMHA 5EFUA 3E5QA 5T50A 5BV6A 4M3CB 1BMV2 4EN7B 2A3YA 2D3RA 4NVPA 3ZXEA 2HWF2 1MZ6A 2VOXA 1POV0 3QOPA 2EA7A 2P34A 3O0VA 4C90A 1RUF3 1O3RA 3BPZA 1TMF1 2XJTA 3WNXA 2E6VA 4COVA 5FQ0B 3I2DA 4Z07A 1HRI3 1MQTC 1ZREA 1QJY1 1Q8SA 4YZ2A 1OFNA 2DWRA 4CEWC 3R0RA 2OA2A 2Y26A 1O4ZA 1VBB3 4PDWC 4BH9A 5EJ3A 4OI0A 2WS92 4QD2A 4P9LA 1WW5A 2R042 3PJYA 3MIGA 2A6ZA 4PDWA 4Y22B 1H8TA 3ZSLA 1RL3A 4OUSA 2EXIA 3M2MA 1SFYA 1GZWA 5L19A 3AFGA 3MLJA 5T52A 4JGYC 2Z69A 5DXDA 1C57A 1HIXA 1EPZA 2AREA 3S7IA 1RGSA 4XEZA 1I9RA 2VOKA 4QM8A 4UW6A 4X6QB 2WZPP 3H8UA 4D7TA 3A0KA 1DQ2A 5EYYA 2WFF2 5KHGA 1ULFA 3C3VA 2X5IB 3TRSB 2RMU3 1XQNA 3H0OA 2R1DA 5KHJA 2EAAA 4N7UA 4NHMA 2ZGLA 3VLBB 3DKWA 3OBRA 3ME2A 2ZAAA 2X8KA 3AJYA 4UW4A 2WIIB 1ZM1A 2F4PA 3KZ4C 4JGYB 3S30A 3WG3A 2C5DA 4U2AA 1UU5A 3JBG2 5DDJ1 3MZHA 4LHNA 3N7MA 4AI2A 3GBGA 2JX9A 1I1EA 4LULA 2WA4A 2OYZA 4KG8A 1VBD1 1IGOA 1XXNA 1J1TA 1R093 4FOYA 4RS5A 5GLTA 3AK0A 3RDIA 1RJ7A 3IT8A 1VRH3 4B7KA 4AEJA 1S0FA 2BWCA 2XVKA 2RM23 3AYDA 2ZABA 2UY9A 2WQ4A 5E89A 3WD5A 3IPVB 4MGZE 3MIFA 4AQ2A 1PZ7A 1W6QB 1UF2C 1IPJA 3WG4A 4AEMA 5CA6A 4XBQA 3WXPA 5C8WA 1CJDA 1JYIA 3V0BA 1BZWA 1RUE1 1DQ6A 4LE4A 1W6OB 3AP6A 1QU0A 3OY8A 1R1A3 4H55A 4ISRA 2UYAA 4S2FA 3WCRA 1AL0G 3BALA 3GF6A 4PLNA 3VDDB 2YGLA 1RHI2 2B45X 1U12A 1NY71 3ZN4A 3IN9A 5GM0A 2WNVA 5FRAA 4XJ9A 2Q0AA 1H30A 2GC0A 1ZBE3 3NO8A 1AR61 1AXZA 2BQPA 2XUMA 4KG0A 4WM8B 5DUXA 2XJVA 5T54A 1F5JA 1DG6A 1S0JA 5H9RA 3WP3A 4CDUB 1Z0HA 5JOXA 4AF9A 2BYVE 4B29A 4B4QA 3MICA 1AYM3 3CEWA 4SLIA 3RI9A 2WJSA 1PVC2 3MPBA 1PVC3 3WW4A 4AQSA 3SH5A 1MEC2 2XJUA 4FO9A 4XHBA 3X29B 4AFDA 3ASIA 2QFEA 2C0ZA 1DYKA 4CTEA 1Z7S3 5BYNA 4KGQA 3W59A 4CDWC 4DOUA 4Q0VA 2YMZA 4AFAA 4WVWA 2DCZA 4UBGA 1YXWA 2ZKNA 1TEIA 5JIUA 1A8DA 2P37A 4CDXA 1FOD3 1ULCA 4HVRA 1S0IA 1ASJ1 1D4VB 5EYXA 4XFBA 1PNFA 2EXHA 3CJXA 4HPKA 1VJ2A 5KC5A 3CO2A 2GDFA 1O5LA 1QJX3 4EROA 3VBOB 2WQZC 5DG2A 1WMDA 1Q43A 2KXLA 4XBLA 1J3QA 3ZIXA 2CNAA 2ZHLA 3SLIA 4K40A 3ZPYA 1WLWA 2D98A 2R30A 4MGIE 4QPIA 4ES8A 3ZN5A 2P2KA 3M4FA 4HN0A 1K5MC 2HWD1 1LHVA 1G8WA 2KM2A 1KFUL 3V65A 1RUG3 1W39A 4BLJA 1RB8G 1RUG2 4E4ZA 1HQWA 4TLFA 2OPKA 3SHRA 4LBMA 3VKFC 2R061 4YG6A 4FVVA 2BNNA 3GYDA 1O3QA 1NA1C 2WS91 4R9CA 1QXRA 4PIZA 3LZZA 4OHZA 2CGOA 5E8AA 3ZMOA 4LUKA 1WW7A 1SLAA 3H50A 1W6MB 3VBUB 1W2UA 2D6NA 2O8OA 5BNPB 4LO6B 5L7OB 1LJ7A 4PIXA 3AKRA 4NHLA 3M3CA 5JMCA 4EV0A 4Q0QA 3LKJA 1SBDA 2BFUL 4OI1A 5AFEA 2JENA 2WFPA 4F3JA 4YVWC 1APNA 1LR5A 1QXJA 5DZFA 3BU7A 2WSUA 4H3WA 5AVAA 3RI8A 2D6OX 2PAMA 1G9AA 1V6LA 2D3PA 3O7OA 4YW1A 2RR13 4FAGA 5F6LB 4I01A 2E63A 4G4FA 3FHIB 2P17A 4FPEA 4LUMA 1VBD2 4LEJA 1PGL2 2YZ4A 1LOGA 1MQTB 3ES1A 4CEWA 2F6BA 3VBFB 3B7MA 4MH0E 1U5IA 5C33A 5ABJA 4Q4W1 2DVAA 2YY1A 4XXAA 4CEYC 3O0XA 1J1LA 3ILNA 1LECA 2JG9C 3QACA 3D4KA 3TYJA 5GLWA 1D4M1 1MS3A 4DS0A 1GICA 3AMMA 5CADA 3UJQA 1PHMA 2TUNA 1RJ8A 3ZFEA 1POV3 1J58A 2IXJA 4BIFA 2UWAA 3VGIA 4FPLA 4E27A 1O7FA 3B9CA 2VH9A 4JGZC 2NYYA 3VL9A 5I0SA 1K5MB 5J3UA 5CNAA 5CB7A 2G4IA 1UMZA 2D7FA 2R071 2ZHMA 4Z92B 4ATEA 1DQ0A 1Y3TA 4QXKA 1A8MA 1ZZBA 2I07B 1XU1A 3SXWA 3AKQA 1PK6C 4LA2A 1MS4A 1QJX1 4PF5A 1YRZA 4Y22A 3VHNA 1NA1B 4XJAA 1AX0A 3KT1A 1YWKA 2PHTA 2RM22 3VBSB 3RG0A 1NCQB 1TQ5A 1YFWA 1COV2 2ENRA 2HWE1 2PQQA 3HIFA 4CDQA 1FOD1 3DL3A 1OLQA 4JGZA 1BBT1 4XQWA 1R092 3B5LB 1RUD2 1FPN1 1ENRA 1TNFA 1F2NA 1AL21 1HRV1 1QJY2 1K5MA 2E7TA 2BVVA 3JBG1 1XE7A 1RUOA 4QQOA 4JDNA 3EXUA 4OVEA 3ECQA 1PK6B 2Z79A 1CN1A 2DCTA 4CEYA 2DUOA 1AR93 2GH8A 4IEZA 3OGGA 4UW5A 3JZVA 4L97A 2E51A 2NZ9A 5DDJ2 4G3YC 1X50A 2GU9A 4K6BA 4OHYA 3KSCA 4YG0A 1Q56A 1OQEA 4Q8KA 2LTNA 2RJKA 1RUC2 1N1VA 3AZZA 3BB6A 3HBZA 1OPMA 3IBMA 3OF1A 3U11A 2VUJA 3IDEA 2R043 4MGKE 3IMNA 5FPXA 2PHLA 1ZVFA 4P5HA 3WQ0A 1AR72 3JQWA 3PVNA 3U10A 1REEA 1VR3A 4FXGB 4YVWA 4BM8A 4GWMA 5ACA3 1HRI2 2RS11 1XNCA 1QXPA 3MFAA 3GBFA 3VBHB 4G9SB 4HZFA 4EWAA 1DGRN 4NPRA 4RSUA 4IQPA 3ZVXA 1ZZ7A 4LBOA 1PZ9A 1W6PB 2XH6A 5JI7A 3CU7A 3RJ2X 1BCXA 4COZA 5DDJ3 2ET1A 4FTEA 1ULGA 4YRDA 2ZZQA 1URXA 2VUAA 4COWA 2AYHA 4Q4Y2 2VXRA 4RD7A 4D7SA 2YROA 4ATFA 4BZ4A 5ACA1 2ZGSA 5BPXA 5EWSA 3VN4A 4HL0A 2R063 3AYAA 5EZWA 2MNGA 2A6YA 3UJOA 1SLLA 2OZJA 3GNEA 2WNUA 2UU8A 4BOWA 2VECA 1G6NA 3NJZA 3VBUA 5BNPA 3AZWA 2FHRA 3FLTA 4JGYA 5SV8A 1UZYA 4LO4B 4XHXA 5BY5A 1RUJ3 4LR4A 5K0UC 2SBAA 4GIQA 3VBRB 2JKBA 5HBAA 1ENXA 2PFWA 2GH2A 1W0PA 3AFKA 2GSYA 3J8F3 1WCDJ 2XKPA 4IEXA 3FJSA 2XLFA 3WP5A 2DUPA 1DQ1A 4HPKB 4Q4X2 3KCCA 3LSDA 1AR73 2PHFA 3GZAA 4CDUC 5BNOA 3LOIA 4JV4A 1ND2A 3SNMA 4R4XA 2W0XA 4Q1RA 5J98B 5E1RA 4AW7A 2ZAHA 4Z82A 5JIAA 2VULA 5L36A 4QM9A 1X36A 3NSTA 4UBHA 1AL23 1C5HA 2WT0A 5JPMB 2O0OA 1PO22 1IZ3A 2YPJA 4R4ZA 4ASLA 4HN1A 1DGWX 3ZFGC 3JU9A 1BBT3 3A0NA 3AP7A 2GC3A 3WOGA 3ETQA 2ZGMA 1CPMA 1O3SA 1MQTA 4YW5A 3ZFFA 4RL7A 3QH6A 4K9SA 3ROUA 2V5YA 2WZR2 3JUUA 1BQPA 5AVPA 5AC92 1HX6A 2YV8A 2OZ6A 1HRV2 3R4UA 4LBKA 2DVBA 1GBGA 3ZXDA 2PHDA 4PBPA 2ZHNA 5KXBA 3HD8B 2B46X 4BHPA 4I0WB 1RUD1 1CQ9A 1AYM2 2V73A 3SH3A 2YHJA 4XTPA 3FE5A 3OD0A 4ES9A 3OYWA 4CRQA 3PMSA 3WHTA 1ND3B 1VAMA 1KS5A 1WD3A 4QPGC 1FMD1 3WG1A 4RHV1 2NQYA 2RE9A 4L99A 4MLOA 1ZX5A 2EF6A 1VBB1 1XNDA 4W6WA 4GH4A 3KT4A 1Q8OA