1HRV3

Hrv14/sdz 35-682 complex
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
236
structure length
236
Chain Sequence
b'GLPTTTLPGSGQFLTTDDRQSPSALPNYEPTPRIHIPGKVHNLLEIIQVDTLIPMNNTHTKDEVNSYLIPLNANRQNEQVFGTNLFIGDGVFKTTLLGEIVQYYTHWSGSLRFSLMYTGPALSSAKLILAYTPPGARGPQDRREAMLGTHVVWDIGLQSTIVMTIPWTSGVQFRYTDPDTYTSAGFLSCWYQTSLILPPETTGQVYLLSFISACPDFKLRLMKDTQTISQTVALTE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN RHINOVIRUS 14 COAT PROTEIN (SUBUNIT VP1)
publication title SDZ 35-682, a new picornavirus capsid-binding agent with potent antiviral activity.
pubmed doi rcsb
source organism Human rhinovirus 14
molecule tags Virus
total genus 38
structure length 236
sequence length 236
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1995-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1hrv300
4LLFA 2HWE1 1RUD2 3VBOC 1AR61 1RMU2 3ZFEA 2PLV1 1M06G 1VBB3 1ZBA1 1BEV1 3CJIB 1RUJ3 1HX6A 5C8CA 1OHFA 2BPA2 2R041 5DDJ2 4RS5B 1EAH1 4WM8C 5BNPC 1TMF3 5BNNC 1FPN1 1AUYA 1AL0G 4YVSC 1EV11 2HWE3 4CDUC 1AR63 2WS91 1AR71 2PLV3 1RUG1 1ZBA3 1Z7S2 1BEV3 2RR12 4QPGC 1NA1C 5CFDA 1NCRB 2HWC1 2R043 1HXS1 2ZAHA 4Y5Z0 2ZZQA 3VBOB 1NCQC 4RHV2 5FOJB 1EAH3 1POV0 1FPN3 3VBSA 1EAH2 1RUI2 1ASJ1 1QQP1 2MEV2 1EV13 1MEC1 2WS93 1AR73 1EV12 3M8LA 3CJIA 4WM8B 5BNPB 1RUG2 2HWC3 5BNNB 1HXS3 5K0UB 4YVSB 4CDUB 1K5MA 1X36A 1NA1B 4RR3A 1ASJ3 1QQP3 1HRI1 2R063 1MEC3 3VBFA 1NCQB 5ABJC 1RB8G 5D8AC 5GKAC 1PGL1 4Q4W1 5A32A 1B35B 1C8NA 1BBT1 3HAGA 3JBG2 1A6CA 1HRI3 4Q4V3 1V9U1 3ZFEC 4IV3A 4CDWA 1HRV1 1RVF1 4Q4W3 4YVWB 2R072 1BBT3 5ABJB 1OPOA 4QPGA 3ZFFA 5D8AB 5ACA2 1PGW2 3VBRC 5AC91 1AYN1 3ZFGA 1V9U3 1C8M1 1NCQA 1HRV3 1V9U2 1RVF3 4CDXA 4AEDC 4BCUA 2HWD3 2GSYA 2WFF1 1VBC1 2BUKA 3ZFEB 2GH8A 1TME1 1AYM2 1PIV1 3VBSC 5C8CB 2RS32 1COV2 1ZBE2 1AYN3 2TBVA 4Y4YA 5AC93 4RQPC 3VBUC 1PO21 1C8M3 1IHMA 1VAKA 4GB31 2QQPA 2WLPA 1E57A 3JD72 4N43A 2RM22 1RUH2 1RHI1 3VBRB 2RS53 1PO11 1VBC3 2WFF3 1K5MC 1AL23 1RUF1 2XPJA 5CFDB 5D8AA 2WFF2 1TME3 4PDWA 1PIV3 2WZR2 4RR3C 1R1A2 1FOD2 1PO23 4GB33 2WWSA 1QJX1 4JGYA 1CD3G 1RHI3 3VBSB 4FTSA 1ND2C 3JB8A 4Z92B 4RQPB 3VBUB 4Q4X3 1PO13 1AR81 1RUF3 1RUF2 1VBB2 1RUJ2 5JZGC 4GMP1 2IZWA 4WM7A 1K5MB 1QJX3 1QJY1 4IV3C 4CDWC 3VBRA 4CEYA 4RR3B 1TMF2 3VBFB 1AR83 2HWE2 3ZFFC 1CJDA 1AR62 1AR82 2PLV2 5CFCA 1ZBA2 1BEV2 1FMD1 1ND2B 3ZFGC 4AEDA 1H8TA 2R042 4GMP3 5A32B 1BMV1 3IDEA 1QJY3 3ZXAC 4FSJA 4CDXC 2BBVA 2HWB1 5JZGB 1FPN2 4RQPA 3VBUA 1F2NA 1VRH1 2R061 1R091 4IV3B 4CDWB 2WS92 1AR72 2XBO1 1RUE1 1FMD3 4QPIA 2HWC2 1HXS2 4NWWA 4QPGB 3ZFFB 4N43C 1VBA1 3ZFGB 2HWF1 2HWB3 4IV1C 1VRH3 4Q4V1 1ASJ2 5BNOC 1QQP2 1R093 2R062 1MEC2 1VBD3 1VBE1 5J98B 2XBO3 1RUE3 4PDWC 1ND2A 4CDXB 1DDLA 1OOPC 3VDDA 4JGYC 4GMP0 1VBA3 3J8F3 2HWF3 5JZGA 3TN91 1HRI2 4Q4V2 1VBE3 4N43B 1PVC1 1RUC1 3NAPC 1PGL2 1NOVA 4Q4W2 4IV1B 4WM7C 2HWD1 5BNOB 2RS11 4FTBA 1BBT2 4PDWB 4CEYC 1ND3A 3TN93 1OOPB 2BFUL 4JGYB 4Q4Y3 5CFCC 1PVC3 1RUC3 1HRV2 1RVF2 1H8TC 2RS51 4N53A 2RS13 1AL21 2HWD2 3NAPB 3JB4C 5A33A 5AC92 1AYN2 4WM7B 1VB4A 1R081 1C8M2 5C4WA 4QPIC 4CEYB 4IV1A 4Q4X1 5BNOA 3LOBA 4RFT0 4CDQA 2RS52 1VBC2 4GH4A 5FMOL 4CEWA 1AL22 5CFCB 4AEDB 1TME2 1PIV2 1H8TB 1OOPA 1R083 1PO22 4GB32 1QJU1 2RMU1 1RHI2 2X5IA 2DF7A 1D4M3 1RUD1 3VDDC 1RMU1 4Q4X2 1F8VA 1PO12 3NAPA 4QPIB 4JGZA 4NWVA 5LK7B 5L7OC 1QJU3 1QJX2 2RMU3 2FZ2A 2RMU2 1RUD3 1RMU3 1VB2A 1X33A 2RR11 1Z7S1 1ND3C 3VBHC 3VDDB 1NG0A 3FBMA 4RHV1 5DDJ3 5C9AC 1QJY2 1QJZA 1HQNA 1RUI1 2MEV1 4N53C 5K0UC 1VBD1 2RR13 1Z7S3 5L7OB 4EJRA 1FMD2 1BMV2 4RHV3 2BFUS 5C4WC 3J8F1 1RUI3 1MQTA 1ND3B 2MEV3 3DPRC 2HWB2 3VBHB 4CDQC 1VRH2 1B35C 5C9AB 4GH4C 4CEWC 1R092 1RUG3 1VBD2 4FTEA 2XBO2 1RUE2 4N53B 3JBG1 4RS5A 5A33B 2X5IC 1VBA2 3J8F2 2HWF2 4YVWC 5L7OA 4Q4Y1 5C4WB 1VBE2 4JGZC 5FMOS 1AR91 1NCRA 2R071 3DPRB 3S6PA 2ZTNA 1GFF2 4CDQB 3JBG3 4GH4B 3VBOA 4CEWB 5ACA1 1PGW1 3VBHA 1SMVA 3TN92 2FZ1A 5C9AA 1WCDJ 4Q4Y2 1AR93 1PVC2 1RUC2 4WM8A 5BNPA 5BNNA 2R073 2X5IB 5C8CC 1AR92 2VQ0A 5K0UA 4YVSA 2RS12 4CDUA 5ACA3 1AYM1 4JGZB 1NA1A 1COV1 1ZBE1 2RS31 1NY71 3JD71 2RM21 5CFDC 1RUH1 3DPRA 1D4M1 1B35A 2Y26A 1AYM3 2WZR1 2RS33 1COV3 1MQTC 1ZBE3 1R1A1 1FOD1 1NY72 1R082 1POV1 3JD73 2RM23 3CJIC 1RUH3 1W39A 4YVWA 1D4M2 5ABJA 1VBB1 2WZR3 4RS5C 1RUJ1 1R1A3 1FOD3 5DDJ1 1POV3 3VBFC 4SBVA 5J96B 1QJU2 1NCRC 1MQTB 1TMF1
chains in the Genus database with same CATH superfamily
2EIGA 3DXTA 3B5LB 2Y64A 4P9JA 4HG6B 2P1BA 2ZX2A 1JZ6A 3BIEA 4Y1YA 1O5LA 1X8EA 1M06G 2PHDA 3KT1A 3V0AB 1BEV1 3CJIB 1JMUB 3J4UH 2BW8A 2HJIA 5K7PA 1OHFA 1O6UA 2R041 1IG0A 3IBMA 5CU1A 1E5SA 2GC2A 4OLLA 2JG8C 1H30A 1G86A 1XB9A 3ZVXA 4MXWA 5DDJ2 5FZHA 1NQDA 4NHXA 1XSQA 2NYYA 4WM8C 4AHWA 3D0SA 1BLZA 4DZGA 2X09A 1FPN1 1UWWA 1AL0G 4FFHA 3EHKA 3RRDA 4YVSC 5A3MA 2WWUA 4YZ2A 4J1XA 3RDIA 4UW4A 1KDKA 1BEV3 3FFQA 5G05L 3LPGA 2VUCA 1ZZ7A 3UETA 2R043 2ZAHA 3KGZA 1SFPA 1WCSA 4Y5Z0 2ZZQA 1T6GC 4PI2A 4Z8BA 4LORA 4XJ9A 2BU9A 5F3GA 1JUIA 2A3YA 2VPVA 2WNVA 3UKTA 2CY6A 4D8MA 4C91A 4LEJA 4UWDA 4Q27A 4P9XA 3WXPA 1K45A 1POV0 1YQ8A 1FPN3 4GD4A 3VBSA 5IVVA 1EAH2 5FY4A 2VOKA 4IEOA 1H6XA 4UF0A 1ZZ8A 3IDBB 3POYA 1MPXA 4Q2FA 2Q5TA 4KWJA 3GYDA 4Q1RA 5HBAA 2QQMA 3FWEA 4CCLA 1PZ9A 2R0FA 2EALA 4KWKA 5BNNB 5JOXA 2XUMA 1REFA 5K0UB 3J26N 3VL8A 5L9VA 4Y26A 1QWRA 1IPJA 3DCQA 1WW7A 3MV01 3POEA 5FTTC 1X82A 1I6XA 2EAAA 4Z2WA 1UY0A 3MIFA 2VNRA 4LO5B 3EXUA 1STMA 2W94A 1V6MA 5L19A 2ERFA 2P37A 3LA2A 2W92A 2R063 5CKNA 3POFA 1NCQB 4ES9A 1ZZ9A 4IEZA 5ABJC 1LOFA 2LM3A 5IVBA 1RL3A 2VR4A 2JEMA 3WT3A 2CNAA 2ENRA 3LF7A 4B4PA 3U0ZA 3J7HA 5A32A 1B35B 3O1PA 2WZ8A 3ETQA 1DYOA 3R4DB 4DNYA 1JZ5A 4KBBA 2VCMA 1JZ3A 2CYFA 1UKRA 4LLOA 4Q4V3 1V9U1 3ZFEC 4MSVA 4XDQA 4XHBA 2ZABA 2DVDA 4IV3A 4I0BA 3E1F1 2Q8CA 2UWAA 4XUOA 1WWYA 3KMHA 4MVTA 1YQCA 1O8PA 3C8XA 1ZREA 2AYHA 3KSCA 1OPOA 5E89A 1O3SA 4LBQD 4AHXA 5D8AB 2E6VA 2DCYA 5FPBA 1S0JA 4HK9A 3VZJA 1JZ4A 2ZXQA 4ZZ8A 5DXDA 5AC91 1AYN1 1EPZA 1Q5OA 3KT4A 1KFXL 5ANQA 1V9U3 3BVCA 1AJOA 3WSOA 2GN7A 4LNVA 2H0VA 1S0DA 4Z82A 3LQCA 5IT6A 1JOPA 1AVBA 4D3WA 1XXNA 4OYUA 3WQ1A 1KJLA 2ZX4A 2JG9A 2WFF1 2DFCA 4URAA 3HD8B 2P34A 3H1WA 3OUJA 1PZ8A 2GMPA 1PZ7A 5F8PA 4SLIA 1COV2 5H9PA 1AYN3 2TBVA 1QMJA 5LBCA 5AC93 5F9TA 2D97A 3VZLA 3ZXFA 2J42A 4M3CA 1BCXA 3EJKA 1PO21 4XFAA 4EN0A 1CAVB 1IHMA 2P4EA 4GB31 2JX9A 3KV6A 4MGKE 4XJZA 4C1XA 3BODA 1A78A 2YROA 1RHI1 4RA0A 3VBRB 2XKOA 3OJBA 1LHWA 4AGVA 2WFF3 2I07B 1NT0A 4W50A 3SEPA 1K5MC 5JXGA 1XBFA 3ZYJB 1Y9QA 3CMGA 5ANNA 2WZR2 4AI1A 2CGOA 5GLWA 3URFA 1R1A2 4FPKA 1PO23 1N1SA 4GB33 4UW3A 3TYJA 4JGYA 5HCFA 5A3NA 3NSTA 1JTZX 2QFEA 2WQ4A 3LA3A 4M3CF 4LT5A 1RHI3 1W0OA 3ZSJA 1ND2C 3KF5A 3VHOA 4A3XA 1WCQA 4BA6A 4FTSA 3VBUB 4D0QA 2DFBA 5FPXA 5J37A 5EQUA 1GP4A 3GBWA 1L7LA 4XEZA 4P9IA 4CUCA 2EIBA 2OA2A 3K3OA 4CVUA 4FP3A 4CZSA 4NMIA 4QAWA 5JZGC 1WLCA 2Y0IA 3CIHA 1J3QA 3C7OA 1S0BA 1GUIA 3D0JA 5CBLA 2VZ1A 4FT8A 2TEPA 2R32A 4M0NA 1PGSA 1EUTA 3AMNA 1SLBA 3BTYA 2JIJA 1TMF2 4M01A 4OUEA 3S7IA 3SLIA 4YZ1A 3ZN6A 3VBFB 5IK8A 1X50A 2XVKA 2HWE2 3ZFFC 1CJDA 3M70A 1ZBA2 1UZYA 5IW0A 4IEPA 1XC6A 2X10A 4FPOB 4HPKB 5JVVA 1GOHA 2D6MA 5FYUA 3BYWA 1H8TA 2ZEYA 4MYEA 1BMV1 1DZQA 3WDUA 4FO9A 4AVBA 3ZXAC 1C4RA 2RJLA 2EVXA 3P1IA 3H7JA 2ZGKA 1GNHA 4YGDA 3Q8BA 5IJRA 4COVA 2J22A 4NIGA 4YW7A 1FNZA 2JIGA 1F35A 5B4NA 3OGVA 3QLQA 5FO9B 4HSLA 5FRAA 1F2NA 1VRBA 1WBFA 3UV9A 3W9AA 3ACLA 3ZXJA 4AG4A 4B4QA 4CDWB 2O1QA 4BMEA 4LOSA 4EN6B 3T3YA 1RUE1 1V6KA 1YEWA 3P3NA 4DIQA 2HWC2 5T50A 4QT6A 4NWWA 4JVAA 3LGRA 3WDYA 2IVJA 4FPJA 1XE0A 4JTOA 3R4SA 3OBTA 4B7KA 2W39A 5C6CA 2A6WA 5JWPA 4AYUA 1ODNA 2F17A 2TUNA 4FOYA 1IS3A 3CKHA 2HWF1 2Q8OA 4A42A 4BM8A 2ZX3A 3DEMA 5BNOC 1ASJ2 1FV2A 1QQP2 5IATA 3PIGA 1H1AA 2VXRA 2Q1ZB 2VW2A 2QQIA 2TNFA 4HKLA 3WUCA 4B7EA 2YG0A 1TNRA 4JV4A 1RUE3 1NUKA 4O65A 1WMDA 1ND2A 4PDWC 5J98B 1OC1A 4CDXB 2WSUA 4NUBA 2B5HA 4CCKA 3UL2A 2JB8A 3NNLA 5I8YA 2VBBA 1U5XA 5F6LB 5FZAA 3WF4A 3KZ4C 4AI8A 3CEWA 2HWF3 4QGNA 4XF4A 5GLZA 1U12A 3ILNA 3K4DA 5JZGA 3JCIA 4GQ7A 4MGQA 3S7EA 1H9PA 5IVYA 3PLQA 1AX1A 3THCA 1PVC1 1H1MA 2WO3A 4MGYE 4B4RA 4COWA 3RZLA 4KWUA 4ATEA 2C26A 3VZNA 1DCSA 2DWRA 3NVCA 4UFHA 4FCAA 4LQRA 4P00B 2FBEA 2PQQA 3OF1A 3P6BA 1BK0A 5TSWA 3AP6A 4CEYC 3VKOA 2V4VA 1ND3A 3DYMA 5EP9A 1OOPB 2WUHA 1FYUA 3AP5A 3VHPA 1GP5A 1OI6A 3H8OA 3DF0A 2XLGA 2PN5A 1OSGA 1PVC3 2JD9A 1HRV2 2OPWA 2BNMA 4Q5OA 5JLVA 3ZN5A 1RVF2 4XQ4A 3TNPB 2A6VA 1OFSA 3U14A 1V70A 1AL21 4JHTA 5A3LA 3HMYA 1H6YA 1IS5A 1QF3A 2UWCA 4Z07A 4LA3A 4F83A 1H4GA 3GGLA 3NAPB 5E88A 4J1WA 4ORFA 1WCKA 5A33A 4KQ7A 1XOYA 1VB4A 1R081 2OZ6A 5A7QA 3WP5A 5T5OA 1C8M2 5IAVA 2CGPA 4I2OA 3IKWA 5B2GB 5D21A 1IS4A 4XAEA 2RDSA 5A7NA 3OEAA 1KS5A 3WNNA 5BNOA 5APAA 4W4ZA 1LOBA 4IQPA 2RS52 2ARXA 5JSRA 1VBC2 4NRQA 2L9LA 3OPZA 1WD4A 2W87A 3MZHA 2VQTA 1ZA4A 5E1RA 4AEDB 5LBBA 2OT7A 1CX4A 4UW5A 1NX9A 4YM1A 1R083 2XWBB 3POWA 3GHNA 4MGIE 2Y6GA 1H2LA 2NMNA 4NHLA 2HEVF 3WG2A 2PHLA 3AZXA 5DABA 1O4TA 2Q8EA 3VZMA 5LBFA 3LFIA 2DCKA 3KGLA 1D4M3 1RUD1 3IAQA 3VDDC 5C71A 5T5LA 1LR5A 1PO12 4QX1A 4MXVA 2WN2A 4PIXA 4R8HA 4XILA 5A7OA 1I5PA 2ES3A 4BIFA 3NNMA 4QPIB 1JODA 4INDA 2E63A 3RNSA 1H0BA 4OUSA 2PAKA 4IW3A 4L11A 3N9LA 3WX5A 2QZ3A 1RITA 2YC0A 4AQTA 4NHKA 5SV8A 1S2EA 4IEYA 4CCJA 1W8FA 3JQWA 5F3CA 2NM1A 1RUD3 1VAVA 3I3MA 4Y22B 3TRSB 4HLTA 2ZA9A 1W0NA 1VB2A 1X33A 1CJPA 4TWTA 4CCOA 4COZA 2DV9A 1D2QA 2Y33A 3U4XA 1MS4A 4K6BA 2OZJA 1C28A 3RYPA 4CXWA 1NG0A 3FBMA 4DUVA 3N3HA 5C70A 4OUMA 4LPLA 1BJQA 4GWMA 4PBPA 4XOGA 2R7EB 3AL6A 1HQNA 2OQ6A 2JB4A 2ZMLA 5I0DA 1RUI1 5SV5A 2FDKA 1W6OB 4E4DX 4PQ9A 2X8KA 4K8FA 5FZ3A 4AGRA 5K0UC 1CAUB 4LBJA 1SCSA 1AXKA 1MS8A 4S2DA 5DPNA 5FCCA 2UYAA 4G4FA 4GZ9A 4UI9L 2V73A 2Y34A 3RS6A 3ZR6A 4ZU5A 1PK6A 3HBZA 3HPNA 2PTMA 4JZRA 1F9KA 2VW1A 4GIQA 4QKFA 2BTVC 2KD7A 5FQ0A 2BFUS 4CU9A 4NPMA 1OUXA 1RUI3 1JU4A 2G4IA 1U5ZA 2HWB2 4LA2A 4CUGA 1NZCA 2DCJA 1VRH2 5J48A 1B35C 2A5ZA 4XXPA 5HCHA 2CTVA 4IE6A 1RUG3 1VBD2 3NWKA 3V0AA 4FTEA 1HB2A 4C1WA 4KGGA 2AEYA 4ZXKA 2VUAA 3N9NA 3I59B 4N53B 4NPRA 4QXHA 2VU9A 4CRQA 4PI0A 1LGCA 1JYTA 2RDRA 4NJ4A 4NR1A 3U37A 1XU1A 1V6OA 3O7OA 4HXCA 2CWSA 1RUOA 4UAPA 4XJ8A 4OZOA 1KGYA 2FDHA 5FBZA 3MYXA 4UFLA 3TNQA 1OA2A 3B01A 4XUPA 4IESA 2P6CA 3ZSMA 4JGZC 1EP0A 3PVEA 4QQLA 1AR91 5FPAA 2ZMKA 3DPRB 2ZTNA 3IN9A 1GFF2 4HN0A 1VMHA 3FN9A 2R30A 4UFKA 4CEWB 2W46A 4D7TA 1W9SA 1JXNA 2YZ4A 2AUYA 2ZACA 3PDQA 3WQ7A 5HV0A 4R4ZA 1UU5A 3RVHA 4OHZA 3LPFA 5IWFA 5FY0A 3FUOA 1ZNPA 3TN92 4PIYA 2FZ1A 4FOVA 3BGAA 3ME2A 3D4KA 2JJ6A 4Q4Y2 1XYNA 1AR93 3ORJA 3WP4A 1RUC2 4E9KA 2MPFA 2QJVA 5BNNA 2X5IB 3RZZA 5J1XA 4BXSV 4LHNA 1CR7A 2VQ0A 4BPZA 4TLFA 5K0UA 2RS12 5C3RA 1S0CA 1OBNA 4XACA 2VZTA 2RS31 1ZBE1 3NL1A 3OGRA 1WMXA 3PIJA 5FXVA 1Q8PA 2GNTA 3DYOA 3AM2A 5LRSA 2VMCA 3JD71 4DINB 1XNTA 3BI3A 3QACA 5FPZA 4META 3DKWA 5IFPA 3M7AA 3A0KA 4AHZA 3LEMA 3QCWA 1B35A 1S0FA 4YLZA 4P9WA 4BHPA 3AB0A 4K9SA 4NROA 2BP6A 2RS33 1ZBE3 1MQTC 1W6PB 4UBHA 2QNKA 4XTPA 4BLIA 4A6SA 1J3RA 4V2WA 4L8QA 5LA1A 4BU2A 3MPBA 4PHZA 2JXAA 3BU0A 4RSUA 3JD73 5A7SA 3VD4A 2QKDA 3B94A 5HPOA 2ZAAA 4ONUA 2EICA 4UT5A 2XL7A 3FLRA 3NRUA 3L2HA 4RFRB 1J83A 1VBB1 1RUJ1 1UXXX 3OD4A 4JRLA 5EYYA 4IEQA 3MICA 5LA0A 2QTWB 3VBFC 2UWBA 5FYSA 1SBDA 1QJU2 4GWNA 2A75A 1JN2P 4OQ8A 1VE0A 1S55A 4LLFA 2IXJA 2QDNA 1PNFA 4ET7A 3MBWA 4YGEA 1RMU2 1NXD1 3MIHA 3VBOC 5KC6A 2C6SA 1VBB3 4UW6A 2ETEA 1RUJ3 4TLGA 5T55A 4IDZA 1W6NB 5A3UA 4PT6A 2KM2A 4IETA 5J7MA 5JR7B 4CXYA 3OG2A 1REEA 1SLTA 1CAVA 2QE3A 3FL7A 3W21A 4BQ5A 3OPWA 4EZHA 4ISRA 3RG0A 3MGUA 1F15A 5BNPC 1JOBA 1AUYA 2DU1A 3R0RA 3AJZA 4N90A 1EV11 1QDCA 4CDUC 5CKQA 2WNEA 1SCRA 2WS91 2W3JA 2HEYF 3F95A 2RR12 4M4RA 5F39A 4OI1A 3QH7A 5FP3A 1NA1C 3M3OA 2O14A 1JYXA 2GC1A 1OLMA 3CBNA 1HXS1 5IYYA 2HYXA 3ETPA 5KXBA 4HANA 3WW3A 3MIEA 4YG6A 1SDDB 1TEIA 4P08A 4RHV2 3ZYBA 3W5MA 3V0BB 4KL1A 4H7LA 5FLJA 1I5ZA 4JKMA 3T4VA 3VZOA 3KM5A 4KNCA 4JRAA 2MEV2 1EV13 2ZKLA 2XXZA 3AZZA 4LBQA 4Y20B 5IUQA 3SKVA 1MEC1 1CN1A 2WS93 2QQLA 3UESA 3N4MA 3M8LA 4MOAA 3ASIA 3AX4A 3J9SA 4V1PA 3HJRA 1HXS3 2AEZA 5CADA 1C3HA 2AH2A 3R6SA 1YRZA 2BQPA 5EWSA 4HBNA 3ZO0B 4AVAA 4ZU7A 2W68A 4MHRA 2EXIA 1PMIA 4BH9A 3T2QA 4M4PA 2D3RA 2D40A 5FKCA 1OLRA 1W3XA 2GZWA 2P2KA 4AFCA 1HRI1 1MEC3 3VBFA 3O0XA 3T2TA 4AR2A 2HLEA 3BKZA 2PHTA 5GKAC 3AMHA 1PGL1 1Q8OA 4HPKA 4Q4W1 1IKQA 2E33A 4J25A 3I49A 1KJRA 5C4WC 2W1WA 1G8WA 3HWJA 4NAOA 4BXFA 3HAGA 1AX0A 1N3PA 1X9PA 3JBG2 3ZXGA 2JD4A 4H55A 2BRTA 2XJSA 4TXWA 3THDA 3VKMA 4GJYA 1A6CA 3OSDA 4ES8A 2GDFA 2K46A 4M0HA 1HRI3 4EN9B 3I3QA 1UMZA 3MFAA 4PIZA 5FZGA 1W2NA 4CDWA 1UU4A 2R0HA 2VXJA 3CZUA 3N7JA 4Q4W3 3KVAA 1GP6A 2VNVA 3MW2A 4YVWB 3PNAA 5DAPA 4FVVA 1BVVA 3B9IA 1WUVA 3C7FA 3HVDA 1GICA 3D3AA 2H6CA 4BQYA 5ACA2 1PGW2 5EZWA 5CG9A 1DQ0A 2QQWA 4E8CA 2WO2A 3A7QA 3EQEA 3RZJA 5HXVA 2Z69A 1ULGA 2XWJB 1F4AA 4XF3A 2WL1A 3PMSA 1V9U2 4GXLA 1GR3A 5FUNA 1VLNA 1GLHA 4K8RB 4QXKA 4XABA 3BPZA 4CDXA 3UK9A 4AEDC 1UYXA 1V0AA 3WY6A 1XE7A 1H2NA 2HWD3 2GSYA 2V09A 2ZOEB 3POJA 5H9RA 3WW1A 4C0BA 1JHJA 3B69A 4F7ZA 2YGMA 4LKEA 2JDHA 1TME1 4K21A 4AFBA 3VBSC 5C8CB 1AJKA 4Y4YA 2GNMA 5BY5A 3A22A 2WABA 1WW4A 2VM9A 1UMHA 4RQPC 3KQ4B 1LHVA 2QQVA 2WT2A 3AYDA 1VAKA 1WLWA 1LGNA 2RHPA 2DUPA 2BDRA 4FPEA 1MS3A 2D6NA 1MZEA 2DBNA 4HK8A 1HN0A 2UY9A 2C0ZA 4M00A 1RUH2 2I45A 3VKLA 2W08A 1YQ2A 2WA4A 2XPJA 1RUF1 3E97A 2D3SA 2WFF2 1TME3 4IE5A 3N9QA 1JYIA 3ABZA 2D6KA 1OQDA 1QJFA 4CYDA 2HH9A 2WWSA 1LOFC 1HJGA 2YPDA 4XQWA 5A3TA 2VOTA 3FMGA 2RJKA 2IXKA 4Q4X3 2D43A 1OMIA 3A4UA 1RUF3 2X29A 5F2WA 1XE8A 5JPMB 3WCRA 1ZZBA 2XOMA 1N47A 4XCBA 1IS6A 4GMP1 3M3EA 4LIVA 3RPQA 3SCHA 3AFKA 4XFCA 4NRPA 4Z1VA 3RQ0A 2VCCA 3BALA 1QJY1 4IV3C 2WN3A 4YM0A 4DUWA 3IIIA 1RJ7A 4LO4B 1ZVFA 4OHXA 4AF9A 1C57A 3MF6A 2XVGA 1UAIA 1UO9A 4RR3B 1SLIA 1Y4WA 2WT0A 3H3ZA 2FDFA 4DRVA 3MUZ1 3PURA 1LOAA 4D6RA 1AR62 1OQEA 2PLV2 2PHFA 1YLLA 4PBOA 4QQ2A 2ZEWA 4B29A 3FLTA 3AMQA 4AEDA 4LBMA 1K12A 4GMP3 1BZWA 1W6QB 1QHDA 2VBPA 2BZDA 5BYNA 1QJY3 2N7GA 1JI6A 4PLNA 1UCXA 4LBOA 1DU3D 4BK4A 4RQPA 5LBEA 1MR5A 2JG9C 2R061 1JW6A 5FZOB 1V6LA 4GWJA 3NV4A 4GAZA 2WYFA 4V2VA 2VW0A 1AR72 1YI9A 4O7XA 2XBO1 2ILMA 3MDPA 4RGKA 1UNBA 4FOWA 4QPIA 4AVVA 2VZVA 3M1HA 4CXXA 1TZOA 4AAPA 1PM4A 3WLUA 4NIDA 1GV9A 1V6NA 4QPGB 3TAYA 3FFZA 1OH3A 4XIKA 1CAXB 2AREA 1W99A 3VD9A 3ZFGB 3GZUC 1NLRA 2A73B 2YFZA 3GBGA 4XJWA 4Q4V1 1CAWB 1T6BX 1S0GA 3N9OA 4Y22A 1G6NA 2PELA 1VBE1 1MS0A 3VGIA 2FDJA 2XBO3 2GMMA 1DDLA 4JTNA 3FE5A 3C3VA 2OW4A 3J7NA 4S2HA 5FZEA 4DS0A 1C5HA 1EYBA 4JGYC 4GMP0 2VUDA 4RL7A 2WNUB 5A7WB 1KITA 1F5JA 4KGQA 5LA9A 3J8F3 3VHRA 5FP4A 4O9EA 3T4HB 5T5PA 2A7AA 2Y60A 1CAUA 2Q8DA 5GALA 1VBE3 2UY8A 4CSWA 1KD7A 4N43B 3AP7A 4I3GA 3WR0A 4LBLA 3C7HA 5CIRA 4NIIA 4IGPA 4IV1B 4MV2A 5C33A 3VHNA 2GN3A 4FTBA 5EV7A 3RWNA 4Z2AA 1BBT2 1CONA 2JICA 4FFGA 2JDPA 4Y3OA 4XIOA 4CP2A 1GQHA 5FR3A 1ULDA 3BB6A 1LESA 1IQAA 5A6QA 1OUSA 3I2IA 1GZWA 2B4KA 3KD4A 2EXHA 4N8MA 1HW5A 1C1FA 4WVZA 3AZVA 3RMYA 5CFCC 2WYSA 1NQJA 4R9AA 2VL4A 5GZEA 2JDAA 1OD3A 2KR2A 3KS7A 1H8TC 1W2TA 3U1XA 3ZKUA 4N53A 2FD8A 2A6YA 2ZGQA 5FZIA 5HXMA 3IB3A 3H3UA 3WCSA 1W05A 3AL5A 4F3JA 3S0MA 1ZRCA 3JB4C 1YC61 1ZRIA 4WM7B 1VJ2A 4FPCA 4D6QA 3I2FA 2ZGNA 4D6SA 5DAQA 3WHUA 1KEXA 1NXMA 2FCTA 4QHBA 4WVWA 1HKDA 3HNMA 5FLIA 3O1UA 2PXJA 4UFMA 4CUBA 1IG3A 4QB2A 2YBPA 2WO1A 4RFT0 4XMIA 3I3DA 3T0AA 1I1EA 1URXA 5FIXA 1W9FA 4QD2A 1AL22 1W9WA 3WZ1A 4YM2A 4CEWA 4IE7A 1PIV2 4YW2A 3K48A 3BOPA 2G9GA 1FT9A 3NJZA 5L9RA 2NQYA 3KLSA 1APNA 1N1YA 2IUWA 5EFUA 4DRRA 2UYBA 1ENSA 2X5IA 4XZUG 4CUAA 3I97A 4N9HA 4XMAA 4Y1ZA 1F8VA 1OQ1A 2J7MA 4YGBA 2NMOA 2LRPA 2WBKA 3IMMA 3N7KA 5EHDA 3WQ0A 3PL0A 1Q56A 3LAGA 4PF5A 4P9GA 3R4UA 5EPAA 4COUA 3OUIA 1DGRN 2VTXA 2W5FA 4TN7A 1MS5A 3KB5A 5K9YA 2Y6KA 5L7OC 1GU3A 3TOJA 1QJX2 1Q3EA 3O0WA 5HI0A 2VBDA 4UBGA 1IGOA 3AKPA 1VALA 5FZKA 3ZYIB 2YHJA 3CQOA 1Q8QA 1DZTA 1LU1A 4OI2A 4DUXA 3OY8A 3I2JA 3AYAA 5D2AA 1ND3C 1W6PA 2Z5WA 4RGGA 5FXZA 3SQOA 3U78A 3LZZA 5FZ8A 3VB9A 1ACCA 2PMWB 2JE9A 2Z4FA 3J7MA 1EPWA 4LUKA 3VBHC 1Q43A 4OULA 1QXJA 4YG3A 5DDJ3 3S5AA 1GOFA 2QZ2A 4LKDA 4F8AA 2BERA 2O8QA 5FV3A 3W5NA 4LJHA 4KWLA 1X8MA 2PFWA 3GCWA 3FHQA 4XDOA 4E2QA 5GZDA 4AEJA 4GWIA 4XW3A 1M4WA 5FZ6A 1FMD2 4A6OA 3BUCA 3PU8A 4XXAA 4D69A 1YQ6A 4XZPA 3PJQA 1L7QA 4HETA 4A2UA 4YRDA 4NN0A 4OHWA 5LZ6A 1GOGA 1YWKA 1SG3A 4QMAA 1S0EA 1Z0HA 3LD8A 4IGOA 2D6LX 5C9AB 1UF2C 1D0HA 1R092 3CLPA 4OZXA 3AYCA 3SNMA 3INAA 1W6NA 3V56A 3U07A 4LO7A 1J59A 1N1TA 4AGGA 4AFAA 3OCPA 1XNAA 3CJXA 2P3IA 1YJLA 4FPGA 2EIEA 1KS4A 2WAOA 5B4XA 1W2OA 4E4SA 3K46A 3WNMA 4EQVA 1FAYA 2VAUA 4KU7A 3I2HA 1SFNA 5H9QA 1VBA2 1L3JA 4YVWC 4B1MA 4CP9B 5L7OA 4IEVA 4W6YA 1T2XA 3TWIA 4X8PA 5C4WB 2EXJA 1F5FA 1BVP1 4Q0SA 4DMIA 3OGJA 3HT1A 3USUB 4AXOA 3RZMA 3FC0A 4ARYA 1CQ9A 5E6HA 2IC1A 2QUOA 1W8TA 2WC2A 5KC5A 1W9YA 3IPVB 4QXBA 2P5BA 2ZKNA 3AP9A 4CDQB 3ZYGA 4Q8LA 5A6YA 4GH4B 4KH9A 2VMHA 3LEIA 4HVQA 1W3VA 1RC6A 1ALYA 3H9AA 1HDKA 3V0BA 3JZVA 3CNAA 2PA7A 4OHVA 5IHRA 1PNGA 3QD6A 3RI9A 4LKSA 3VBHA 3F2ZA 1GANA 5FYTA 4K1YA 5FY9A 1P8JA 4LIUA 4Y20A 4UOJA 2D5HA 5IFTA 2WLQA 2D7FA 2JDYA 1E5HA 4GULA 4ZKTB 1TQ5A 3OBAA 3LEGA 3VN4A 5C8CC 2XONA 3WDTA 2OUHA 3ZXLA 1AR92 1JUHA 2JECA 3MO4A 5LB6A 2Q1FA 1W8HA 3KHCA 4MG2A 2ZGTA 1JH5A 3POGA 1G9BA 2J1UA 3WV6A 1LOGA 4QX0A 1COV1 1D2SA 2VD7A 4EYUA 3HBKA 3SHRA 1NY71 3PVOA 3O1MA 2OS2A 2QDRA 2YBSA 3C7EA 3U11A 1XNCA 1OF3A 5FZBA 2EXKA 3MLKA 4FQ4A 2YBKA 1LOCA 5FXWA 4XFHA 3VD5A 1PK6C 4BYYA 2JWPA 4HVRA 4O61A 3PUQA 4FFFA 1D4M1 3EYPA 3S5QA 4D7SA 5I8TA 5KHHA 3QBQA 1ZZCA 1A8DA 1VPHA 4I09A 5EJ3A 1CIYA 2QCSB 2WZR1 4CU6A 1COV3 2XLAA 3B00A 2ORXA 3OOXA 4GJZA 4XPVA 2WFPA 1TE1B 1R1A1 2MHFA 4W65A 3MV11 2VMIA 3ACGA 4LXLA 5FY5A 4EWEA 4IEUA 5FZMA 1J1TA 2A70A 2ARBA 1XNBA 2LW8A 4MXWB 5EJZB 3CJIC 3ZYHA 4ITCA 5FDBA 3QH6A 2RE9A 3LDKA 5JDBA 3VKFC 2ZBJA 5A3WA 4YVWA 3SKJE 2C9KA 1OD5A 3M3CA 1GWMA 3AKTA 3OTFA 2DTYA 4TYSA 2WZR3 2WNOA 4BDVB 1SACA 1UY2A 3WG4A 1R1A3 2JE7A 4OMDA 5DN2A 3TEZA 4ZZ5A 3WW2A 3MW3A 1K3IA 2YXSA 2WNVB 4XDPA 5J96B 5CVRA 4QXCA 1UX6A 1E5RA 1TMF1 4YW6A 5JAXA 2VMDA 3WP6A 3CF6E 2HWE1 2R6QA 4IEXA 4M3CE 3BIWE 1B09A 2NZ9A 1LEMA 1ZBA1 2JDZA 4HONA 3H0OA 1HX6A 1W0PA 1OURA 5C8CA 4LHKA 2BPA2 2LROA 2RV9A 4OI0A 5CYYA 2VOWA 1WLTA 1WKYA 4KMQA 2QQNA 3RJ2X 1ULOA 1WD3A 4HT1T 2DVGA 4RS5B 1TMF3 2XJVA 1LHUA 2WAAA 1W8ZA 4MZUA 3WNOA 5BNNC 4Y33A 3FJSA 2HWE3 4Q0VA 5FZDA 4QB1A 1RUG1 1ZBA3 1Z7S2 2CDPA 4QPGC 1S1AA 1NCRB 4E27A 1KXGA 2HWC1 1W9TA 4P9YA 5JUVA 4HN1A 1J84A 1NCQC 5DZEA 4WVMB 2CAVA 3W20A 3AFGA 3L9JT 4LO8A 2Y8KA 4ZY9A 2EIDA 1US3A 2WIIB 1IPSA 4H14A 1XSRA 4AVTA 1ASJ1 5CG8A 1QQP1 4WV8A 1LB2A 1O8SA 5JXHA 3WF3A 2JG8B 5F6KA 5IVEA 1EV12 3P5BA 3CJIA 3OD0A 2DVBA 2VH9A 4WM8B 5FJKA 2HWC3 5T5JA 3WNKA 4S2FA 4XETA 3W58A 4LUMA 2G19A 2XQXA 4YVSB 3UKVA 5FP8A 2ARCA 4B1LA 4OVEA 2WA3A 3RZHA 2NLRA 2XDVA 1OT5A 3HT2A 2DVAA 1DGLA 4RR3A 1ASJ3 5FYYA 1QQP3 5FFOC 1NKGA 1XNDA 4JKLA 1WCUA 4RN5A 1PX4A 1TVGA 2ORZA 1YQ5A 3JXSA 5FYCA 2GNBA 5GM0A 4URTA 1DG6A 2VQAA 5D8AC 3GBFA 2VTXJ 1RB8G 1QEXA 2W9XA 1GZCA 1UYPA 1XU2A 1W6QA 2EAKA 4LBNA 2IXCA 5FYZA 2PAEA 3W59A 3AXEA 4LE4A 3I7DA 4L9BA 5GZGA 4DPNA 1DQ1A 5FK7A 3TBDA 1MVEA 4QKBA 1LULA 4XCAA 5FZOA 3WG3A 1O91A 4Y24A 2FDIA 5M0TA 4I0WB 3AVRA 1RJ8A 1HRV1 2WO7A 4N7UA 4B3NA 2JE8A 1RVF1 1SBEA 4H2AA 1WZXA 3BCWA 3PMEA 4D7YA 2R072 4Y1UA 3PHMA 4L0PA 5E16A 2P17A 2VG9A 5C3OA 5DG1A 4BQ3A 5ABJB 3O5SA 4QPGA 4AEKA 4AFMA 1CAXA 3VBRC 1CVNA 3ZFGA 3KT7A 3R05A 3FBYA 1UOBA 1C8M1 1W04A 1NCQA 1UPIA 1ULFA 3CHXA 3DECA 3HN1A 1W8OA 3ON7A 1DP0A 1HRV3 4KBZA 5EXOA 1ULEA 1RVF3 2VUJA 4FXGB 4QX7A 4Y5TA 3RYRA 3WNPA 3ST7A 2IXLA 4BCUA 2W1QA 3AJYA 4E2SA 1VBC1 2BUKA 2J1RA 2V5YA 3ACHA 1CIWA 5CKMA 3WDVA 2HEWF 3ZFEB 3O14A 4HMZA 1U5IA 1E5IA 1AYM2 5FZ0A 3PUHA 5A7WA 1W2UA 1LAJA 1BYHA 4XJAA 3AKRA 2R1BA 3VBUC 5DAWA 1N1VA 4EN7B 1C8M3 1VAMA 4Q8KA 1UKGA 1WMFA 2D93A 3KV9A 2WLPA 3MUY1 4N43A 3SMHA 2RM22 3A23A 1LJ7A 1CESA 2DVFA 5FREA 1H9WA 4LK7A 1A8MA 2RS53 3T09A 1PO11 1VBC3 1UXZA 4WBBA 5CFDB 5D8AA 3OUHA 3N9MA 4UXAA 4O9GA 2B46X 2ZHMA 4CA9A 5HV4A 5LWBA 1YFWA 3ITQA 3FHIB 3ZDSA 3WW4A 1HN1A 1FOD2 4NHMA 4AWDA 1CPNA 4IERA 4LMFA 5GZCA 1YIPA 4L97A 1CD3G 4I30A 4GA9A 2DUQA 2DYCA 4AVCA 3HOBA 3JB8A 1AXYA 1MS9A 3M2MA 1HV0A 1NYWA 1PO13 3T30A 1AR81 3E5XA 4GALA 1YUDA 2Q30A 1RUF2 4BMBA 4PLOA 4R9BA 4K20A 1KFUL 3OGSA 1BQPA 1MACA 4H3WA 2YUEA 1ENQA 1POQA 1UYYA 2YC2A 4WM7A 4ZS2A 1K5MB 4CDWC 5JPNB 5IK7A 3KHBA 1YHFA 5CEHA 2ZPXA 4U36A 3DUIA 1W6MB 3E6BA 1DLCA 1SFYA 3E6DA 3UGHA 3VBRA 4EN8B 2BGCA 3D82A 5JMCA 2FHRA 3PUAA 4AFDA 1YYNA 3OPTA 3WP3A 5C5TA 5JIUA 1AR83 3A21A 4FXKB 3ZR5A 3IM0A 1PHMA 3Q8CA 1D0GA 3OB8A 5JMOA 2ZEZA 1BEV2 2P3KA 3USSA 1ND2B 4GKXA 4LKFA 1Y9MA 2A3WA 2R042 1WMEA 2V4AA 4AOCA 3IDEA 3KV5A 3NW4A 4XF0A 1JZ8A 1JYVA 1JU3A 4CDXC 3MF9A 4NRMA 4E8DA 2HWB1 5JZGB 1FPN2 3FUQA 3VBUA 4WVVA 1LENA 4YFZA 1VRH1 3LEKA 4LTAA 5LASA 3O1OA 3SEEA 4A7YA 5FYIA 1RXFA 3T08A 5LW9A 3S57A 2LTNA 3ZYFA 2ZGPA 1FATA 1MZFA 2D3PA 1L7RA 5T52A 2QQUA 1O4YA 4QX3A 3ZFFB 3MLJA 5DAXA 2GC0A 2GAUA 4CCDA 2ZGUA 1S2BA 2K9ZA 1RUNA 2HWB3 2RDNA 1VRH3 1H2MA 4QX8A 4QKDA 4X6QB 2DUOA 5FMCA 2R062 1VBD3 4JAAA 5IVJA 4XHXA 1VR3A 3N7LA 2B42B 1JS9A 1OOPC 4BE3A 3I54A 1V6IA 5LRRA 2QVSB 1SDWA 1EUUA 2VNOA 2XJTA 4ZXEA 2B39A 2XMLA 4FPFA 3TN91 3ES4A 2JDUA 4LR4A 1QOSA 3H42B 4RGAA 4YARA 2Z79A 4I02A 4Q4V2 5F3IA 1LHOA 1GWLA 3DV8A 4WZCA 1RUC1 1LEDA 2MNGA 3NAPC 4K3UA 2ZCWA 4XYXA 5KXDA 1NOVA 1DGRA 3ZX7A 4QGMA 2HWD1 1ZYBA 3WHTA 5BNOB 1MZ5A 2RS11 3ZPOA 2DTWA 3IAPA 3IDCB 4QQOA 4MX3A 4CU8A 4PDWB 1KRIA 4HKWA 3Q8EA 3UJQA 1O7FA 2YV8A 4DEVA 4YW1A 4HL0A 4YPJA 3TN93 2LS6A 4HSJA 1HIXA 1YCIA 3BPSA 4Q4Y3 4KU8A 3FLPA 1RUC3 1DYPA 2B8MA 2DCZA 2ZX1A 3KVBA 2BV4A 4DOUA 5F2SA 2RS13 4BQXA 3OYWB 1JOJA 1J1LA 2C4XA 3I8TA 4UYBA 4XUNA 4A44A 1RIRA 3AKQA 2Z2SB 5DG2A 1QU0A 2GU9A 2ZJCA 5F37A 3Q8FA 5AC92 1YIFA 1AYN2 1RXGA 4XUTA 5CNAA 4CP9A 3PUSA 2YGLA 3FHAA 5C4WA 4UFJA 4QPIC 2RJ2A 4CEYB 3USUA 1WW5A 3AYEA 4Q4X1 1TG7A 1DF0A 3IPVA 5FYHA 3WINE 4CDQA 5KWRA 4GH4A 5FMOL 2E31A 1JHNA 3SITA 2OXBA 1OOPA 4NAMA 2ZGOA 1XPWA 3GJAA 1SBFA 1J3PA 4L92A 3L2YA 3H7YA 5ERLA 2FCVA 4BOWA 1PO22 5CZKA 1I9RA 4GB32 4DO0A 1QJU1 3NJVA 1VMFA 2RMU1 2PAMA 4PQQA 5FZFA 1RHI2 1PX3A 3H8UA 3MIDA 4S2GA 5BUVA 3O1SA 3H3LA 2DF7A 1GQPA 1OKOA 1RMU1 4MO3M 4K1ZA 1JYCA 3ZXDA 1S4CA 3WD5A 3NAPA 1ONAA 5A6XA 1N3OA 1RGSA 2D6PA 1GYKA 4NWVA 3RGBA 3LSEA 1YNAA 2AGSA 4L2NA 3UT0A 5LK7B 3BTZA 2VZRA 1QJU3 2DU0A 5I0SA 3GNEA 5F5QA 2RMU3 1NZIA 3SXWA 2FZ2A 1UY4A 3M4FA 4C8DA 1UZVA 2CSGA 2XJPA 1RMU3 3MIGA 5BXXA 5L73A 2RR11 2BJSA 5DUXA 3O1RA 2E7QA 3MEPA 3THPA 1AF9A 2E53A 4FI9A 3ACFA 4QHOA 4XBLA 2J1EA 4FBFA 3VUOA 3UGGA 4D94A 5GZFA 3VDDB 4AVSA 4N7IA 2E26A 4OQ9A 1H8VA 2G1MA 4RHV1 4CE8A 1QOOA 1HB1A 1QJZA 4A7ZA 4QX5A 5JCTA 3B3QE 1DYKA 3MPPG 3RFRA 2MEV1 4N53C 5A70A 1ZRFA 2WWJA 2XL9A 3HN3A 2Q4SA 2RR13 4RYDA 3THTA 4A41A 3H1YA 4UFIA 1UY3A 4EJRA 3NV1A 4QDRA 2Y6LA 2YDEA 5DZGA 1O59A 4QKNA 3JUUA 3VD3A 2O8OA 1BMV2 1OVPA 2DDUA 1G9FA 4RHV3 1UW8A 1DZRA 3NKTA 1QIQA 2XVLA 3PUIA 2XG3A 4E4HA 2XQRA 3H8XA 3J8F1 1O3TA 4YYOA 1HQWA 2MEV3 2VCBA 1D4VB 2Y38A 1LU2A 2XHKA 3DPRC 2ZHKA 1LCLA 3FZ3A 3ILFA 1O4ZA 3UGFA 4Q1PA 4CEWC 3AZYA 5DAVA 1C1LA 1RUE2 1GBGA 4YW5A 1YFXA 3JBG1 3KCXA 3NO8A 4NVPA 4Q26A 5A1FA 4JDNA 4RS5A 1LECA 2FMDA 1W6OA 2IFWA 1VP6A 2X5IC 4MH0E 4RD7A 1OLME 4X6RB 2HWF2 4BJ0A 5JOZA 2Y6HA 3AXDA 3GZTB 1DQ5A 2V5DA 3GXUA 3ZMNA 1NCRA 2F4PA 4QPYA 2VY0A 3SH3A 1WA6X 3JBG3 2BVBA 2W2IA 5FY7A 2W52A 1VMJA 2IFRA 3AZWA 4WVMA 5ACA1 1PGW1 4BQ2A 1HB4A 1DHKB 1OFNA 1QY4A 2SBAA 3B93A 2VO5A 1U5YA 3EO6A 2X53S 2ZGRA 5FPLA 1SMVA 4CCCA 4XFIA 1H1IA 2JG8A 3DL3A 3GALA 4CCMA 3O0VA 2AACA 3APBA 4QM9A 1PVC2 2OX0A 4MLOA 4WM8A 4MHUA 4IE0A 3I59A 5DMYA 1UY1A 1K42A 1N3QA 1CPMA 1YI7A 2VGDA 4YVSA 3GZEA 3DGTA 4BZ4A 1OH4A 1PMHX 4R52A 2CV6A 3ZN4A 1R1ZA 4JGZB 5ACA3 2ADDA 5T54A 1SPPB 3LCPA 5A7PA 2VMFA 2ET1A 3AC0A 5KHGA 2WKKA 2XUEA 2FMYA 5K4LA 4LOTA 5CFDC 1RUH1 1CZSA 2P6HA 3BTAA 1GNZA 4P5HA 3GF6A 2ZHNA 3DPRA 3HEIA 1DQ6A 4ASLA 3VDBA 2PHRA 1ST8A 3ILRA 3MW4A 3WDWA 2YU2A 4TSVA 3SCFA 2XR4A 5C3PA 4FQZA 4YM3A 1W8NA 1JZ7A 1FXZA 4HFSA 4XE9A 3POIA 2BWAA 2C9AA 4QU2A 4AAXA 1W2AX 4FAGA 1NY72 2W47A 1ENRA 1R082 3LB9A 1DQ2A 4NPLA 2GALA 1RUH3 2WSVA 1W39A 2BOIA 1S0IA 1UOJA 2CU5A 3ZMOA 1LODA 2QQKA 3ELNA 1D4M2 3RYKA 3ZKYA 2DURA 4AE2A 1UIJA 2BWCA 4BK5A 5ABJA 4OHYA 5E8AA 2XB6C 2R49A 2ATFA 1LOEA 5JIAA 3RZKA 2H0BA 5LCWL 1IZ3A 1VIWB 4G9SB 3VDCA 3T0BA 5DDJ1 5JR2A 2WRAA 3LKJA 2WZEA 5CA6A 5IVCA 2FCUA 4LE3A 3NV2A 2JENA 1MQTB 1KDMA 4Y1VA 3WNXA 3ZSEA 5L9BA 1I3HA 3NNJA 1DIWA 4BIOA 5DUWA 1RUD2 4LBQB 4C0HA 1AR61 5LK5A 3ZFEA 2PLV1 2A1XA 3WNLA 1JBCA 4NIHA 1PMJX 1W8WA 3IT8A 3P3PA 3VLBB 4ATFA 3MI8A 1JYWA 1UL9A 5K8SA 3GM8A 2PQSA 2YU1A 3ZIWA 4YNIA 1EAH1 4K7JA 2OYZA 2W1SA 5JXIA 4ZPIA 1O3RA 2KXLA 3ATGA 2WJSA 2P3JA 1AR63 1AR71 4YZ5A 2PLV3 2F4LA 5FJHA 3KCCA 5CFDA 3LFMA 3AMMA 2LUWA 3O1VA 2B45X 3WEZA 3CDZB 2OUJA 1AHSA 2F6BA 3HQRA 4FOQA 1MVQA 1RYYA 1Q8SA 1SLAA 4QWNA 2W95A 1IQDC 4PLMA 3VD7A 3ZYRA 4AI3A 5FYBA 5AFBA 1S2KA 4OI4A 3VBOB 3EB7A 3WF0A 5LEJA 5FOJB 1A3KA 4YZ3A 1EAH3 2C24A 3HR9A 1RUI2 2Q1MA 3ZOIA 3ES1A 3AMPA 1W8UA 4A3ZA 2OKXA 1AR73 1REDA 2YPJA 4N9IA 1W03A 4BQ1A 5J3UA 2YY1A 3E5UA 3MHZA 1RUG2 5BNPB 3WOGA 2WINB 3ZXEA 5KHIA 2BYVE 5BNQA 3KV4A 1ZM1A 4CDUB 4CCEA 3LIGA 3TB0A 2GP5A 2ID4A 1K5MA 5ISLA 1X36A 1NA1B 1UZ0A 3U10A 1W6MA 2VVDA 3M3QA 1K5JA 4TZDA 1W90A 1NLSA 2ZEXA 1DBNA 5C7GA 2YYOA 3DXUA 4GKYA 1HJFA 2ZS6B 2BOJA 3LSDA 1QJEA 1BKZA 1XNKA 3K4ZA 1CWPA 5C3QA 4I01A 1H4HA 1C8NA 3LA7A 1BBT1 1C5IA 4YZ4A 2CAUA 5JXJA 4R9DA 3D8CA 1LGBA 1YXWA 1LTEA 2XLFA 5AVPA 5DUVA 4FPHA 5FBJA 2IVIB 5T3NA 1QKQA 5F3EA 5FPVA 2D5FA 4BISA 3B02A 3NNGA 5CISA 4IGQA 4XQDA 4ZHNA 1SLLA 3IZOA 5CAZA 5IK4A 1G9DA 3B9CA 1IOAA 4YFWA 4CCNA 3LIHA 3DKQA 4QGLA 1AX2A 4LO6B 1BBT3 1FV3A 1QNYA 1Z78A 1BXHA 1XYOA 2ARAA 3AKSA 4XJUA 1QOTA 3SH4A 3WDXA 2XHNA 3ZFFA 4AZZA 3BOWA 1PVXA 3ALQA 2VVEA 3NNFA 4JHZA 2O0OA 3IIAA 4DB5A 2AZ5A 5GLVA 5FOBB 3C2UA 4J6GA 3NJXA 2VMGA 4MGSA 2A3XA 4QM8A 4YW3A 3H8RA 4QDSA 5KHJA 2GH8A 5LY2A 3QOPA 1CZTA 4AL9A 5CB7A 3SISA 5GJ6A 2KA3A 1PIV1 2PHUA 2RS32 1ZBE2 1UYZA 3KQRA 4HVOA 4XBQA 2VNGA 2WQ8A 3ROUA 1X7NA 1ULCA 4YGCA 3ZPYA 4G3YC 2W91A 5F5IA 2QQPA 3NV3A 3O1TA 2ZX0A 1E57A 2Y0OA 3JD72 4BQWA 1UOGA 5FK8A 5A3OA 2GNDA 4HKOA 5CFCA 1ZX5A 1V6JA 3CU7A 3IWZA 4JCKA 3E6CC 1AL23 1UMIA 2I2SA 5FMDA 3I2KA 3LDBA 4JDMA 1PIV3 4PDWA 2EA7A 2VZ3A 1LKNA 4AW7A 2P3YA 3AVSA 4NOTA 4RR3C 4DXRA 2G9ZA 5FO8B 2A6XA 4QQPA 4QPWA 1AXZA 1IKPA 1QJX1 2E51A 3HIFA 4KG8A 4XF9A 4DY5A 4NHYA 4OCTA 4ZU4A 1SEFA 3VBSB 5FZ4A 4BLJA 1DQ4A 2VECA 4UF0B 4Z92B 2Y6FA 4JKKA 1X9TA 4RQPB 5FYVA 3PVBB 4LHLA 3OYWA 2DCTA 3ZM8A 4YSFA 1VBB2 4E4ZA 1RUJ2 1NLQA 4QX2A 3VKNA 2B9VA 2IZWA 5C3SA 3LE0A 2Y6JA 4MADA 1JYNA 2DBIA 4OFGA 1QJX3 4ZONA 3H1MA 3RI8A 2CL2A 1KQRA 5FZLA 1NE4A 4EROA 2I74A 5LEKA 2VZUA 2WR9A 4A7KA 5BPXA 4CEYA 2NPIA 3RSJA 2WQZC 1DGWX 3T2PA 1HV1A 4I0AA 1AR82 3GZAA 3K3NA 3OGGA 1GQGA 5FXXA 3KF3A 1FMD1 5GLUA 4ISQA 3ZFGC 2ET7A 2XH6A 5A32B 3HNBM 5IAXA 1G9CA 4P9LA 4FSJA 4EWAA 2XGXA 5FO7B 2BBVA 3ECQA 5LA2A 1CX1A 1RTVA 3BN6A 2GH2A 3JU9A 1UU6A 1R091 3NMBA 4IV3B 1LRHA 3WF1A 1QH6A 2WS92 4XC9A 3K2OA 4R4XA 4XFGA 3U75A 1D7PM 4COYA 2WNUC 1FMD3 3VZKA 3D5OA 1US2A 2D6OX 3OBRA 1HXS2 4Y1XA 3I3BA 3SCGA 3T2OA 2IXIA 2ZGLA 3K4AA 5DQ0A 2JDMA 4N43C 5KBFA 4IEWA 1ZA7A 3CZJA 3GJBA 2PHWA 1VBA1 1IPKA 2CDOA 4BWOA 3BU7A 1HB3A 2ZGMA 2HBUA 4IV1C 4ASMB 5BV6A 1Y3TA 1J58A 4XBNA 3RZGA 1R093 1GZWB 5JSPA 1MEC2 4XTMA 3LDRA 2K0GA 4P5YA 5C5UA 2C1FA 1FI2A 3PTRB 4FP2A 4QB6A 5I8SA 5KR7A 2VZQA 2JG9B 3VDDA 2VVFA 2GC3A 2JKBA 5LATA 3VDAA 1OKQA 2Z42A 5FZCA 4P14A 3UYJA 1HLCA 1VBA3 3UJOA 4M3CB 2WT1A 1O3QA 4EE2A 2PYTA 3E5QA 1HRI2 2B7YA 3O12A 3PVNA 2X05A 3VV1A 2XJUA 2EF6A 4L99A 2FQPA 1GSLA 1TNFA 3C7GA 5FP7A 5FY1A 4DY3A 1PGL2 2JKXA 4Q4W2 2C5DA 4WM7C 4ZS3A 1G9AA 1UQXA 4TTGA 2YB7A 2V72A 2YMZA 5FLHA 2A6ZA 2HBTA 5FAXA 1YJKA 4QU1A 1DLLA 1LNSA 4U2AA 3SC7X 2ZMNA 2BFUL 1CAWA 4OMCA 3M3IA 2BBAA 1V00A 4JGYB 5FKBA 2IWGB 4NE9A 4CPBA 5FMBA 4QHZA 3PJYA 2YFUA 3ZXKA 2RS51 4AQSA 2QQJA 1WGPA 5GLTA 1OPMA 4LBKA 4BB3A 2HWD2 2QQOA 3MFCA 4DFSA 5AVAA 1Y9GA 2A71A 2WNUA 1SLCA 3I2DA 2BNNA 2J1AA 4FAHA 3LOIA 5I93A 2VC9A 4AQ6A 1GNYA 3GDBA 2VOVA 2E7TA 4EV0A 4Q29A 1UX7A 1QH7A 3HQXA 4IV1A 4XVHA 1F4HA 3AK0A 3CO2A 3ZN6B 3LOBA 3UKNA 2E7AA 1GKBA 3ZIXA 2OVUA 1UIKA 4AHYA 2VJXA 4LK6A 3GHMA 1UPSA 3S30A 5CFCB 4XURA 4PJYA 3OY8B 1TME2 4DXTA 3KWVA 4XFBA 2NN8A 1H8TB 5J36A 4DXSA 4MUVA 3K51A 2HYKA 1G7YA 4LULA 4MGZE 3TEXA 1GMMA 1F31A 1OA3A 1SZBA 3WG1A 4CP0A 2FDGA 1FNYA 1W06A 1NE6A 1LHNA 2UURA 4IUGA 4Q4X2 2E32A 4WZFA 3ZLIA 5D1IA 5HCBA 4P02B 2OQ7A 1ENXA 4JGZA 2AC1A 5EIYB 2JDNA 1SPPA 1YO8A 1HQLA 4NIAA 3PTYA 2UU8A 4AI0A 4FPLA 1W28A 1DFQA 4IXLA 1ZZ6A 3IDAA 4LITA 4YW4A 4Q0QA 3V65A 5FWJA 4IL7A 2RMU2 3OBZA 3BTXA 3WQBA 1BK1A 3G7DA 3J7LA 1Z7S1 5DUUA 3TEYA 2ADEA 2RG4A 3RWKX 3N9PA 2YC4A 5AFEA 1WBLA 1R64A 4E2GA 2VTFA 4KI5M 3ZSLA 5C9AC 4Y4RA 4CU7A 5FUPA 1QJY2 2OIIA 5A1AA 3N7MA 4R9CA 5JOWA 5FZ1A 5G04L 4EZ4A 4FPYA 3MLLA 4Q0UA 5FYMA 2BNOA 3POSA 5F5CA 3DYPA 1GZTA 1VBD1 5L7OB 1DGWA 1Z7S3 1ZRRA 3GCXA 3I3EA 4JQTA 3H50A 1ZRDA 1CGPA 3HQUA 4CTEA 1RINA 3D6EA 4AK3A 1WW6A 3JQXA 1PM7A 3VL9A 2VMEA 1OA4A 1ODMA 3PU3A 1UZWA 2D44A 2GP3A 2LALA 2W0XA 3NKGA 5JI7A 4AQ2A 5FPUA 1MQTA 1ND3B 4XUQA 4EWDA 5JSOA 3WUDA 2HKXA 5FP9A 2RDQA 3VBHB 3I2OA 4CDQC 4NO4A 4GH4C 2H6BA 3G6JB 2WZPP 2ZGSA 4K40A 1FX5A 5IVFA 4MGTA 2XBO2 1GWKA 1Q8VA 4PCRA 3U4SA 1NAEA 1O5UA 2G9FA 4KG0A 1UD1A 1SQ4A 3AP4A 2ZHLA 3K75B 3HNYM 1UOFA 4ASKA 5A33B 3DN7A 3EMRA 2VCAA 3J8F2 3WVJA 4LHSA 1CZVA 1QNWA 4JQRA 3T1MA 5F5AA 1U0AA 3RMXA 1SHWB 3N35A 4Q4Y1 2BEOA 4A45A 4DQAA 4B8EA 5A3PA 2R1DA 3Q9OA 1VBE2 5FMOS 3TEWA 5A1LA 4DEQA 4YWAA 4YG0A 1EY2A 2R071 5H9SA 3S6PA 3X29B 4AI9A 5DZFA 5F1RA 3VBOA 3LWCA 4BQ4A 5KXEA 2CHHA 3CL1A 2VZOA 3B7MA 1QXPA 1XYPA 4JDOA 2AENA 2JDKA 4AEMA 2VE1A 1QDOA 2XJRA 3EBRA 4Q0PA 5C9AA 1WCDJ 4XAAA 2BVVA 4A4AA 2XJQA 3V64A 4HZFA 5BNPA 3ACIA 2R073 2OPKA 2VOXA 4HOOA 1MZ6A 1WA4A 2E9QA 3OEBA 3ZSKA 4H7MA 1OXCA 4CDUA 2BGOA 1WLDA 1YFUA 4Y5SA 1AYM1 2WDBA 3IMNA 4XFFA 1AZDA 1NA1A 5EJ1B 2BGPA 1XRUA 5HCAA 1H2KA 2GMEA 3MIBA 4W8JA 2VULA 3SH5A 5J09A 1XJAA 1MS1A 2CGNA 1OVSA 2ZZJA 4ARXA 5I0RA 2R16A 1OF4A 3K77A 5F32A 2RM21 2W1UA 2NP0A 2J1SA 5IK5A 2IXHA 5C8WA 5I91A 2XKPA 2RVAA 4IE4A 5L36A 2WNVC 1OLQA 1QXRA 2Y26A 1AYM3 2D98A 1YFYA 2VZPA 4PF1A 5FY8A 4C90A 2J1VA 5I0UA 1JZ2A 3I4IA 4CP1A 5F7UA 1FOD1 3T0DA 4JC1A 2CWMA 4XF1A 5FWEA 1POV1 4W6WA 4FFIA 5A80A 3N36A 5FZ9A 2RM23 1BHGA 3FX3A 3I2GA 2VQUA 5A6ZA 1ULPA 1QGLA 4QQHA 3NQHA 3ZDVA 5KHKA 5KXCA 3ZYPA 1A34A 5FZ7A 4W6XA 1XQNA 3T1LA 3WF2A 2QBXA 4X8NA 4DXZA 2B9UA 4JX0A 1GZ9A 1UZZA 4RS5C 4CPBD 1PK6B 3POBA 5I0TA 2SLIA 4I3PA 3KCYA 2PHXA 3Q8AA 1FOD3 2K2SA 3UNPA 5LY1A 5JOYA 5EYXA 5FQ0B 4QDQA 3A0NA 1POV3 3RJRA 3ENRA 5JI9A 4SBVA 4AI2A 1Y43B 1UN1A 1Y7BA 2AR6A 2J1TA 1NCRC 3NJYA 5FUIA 2VZSA 2Q0AA
chains in the Genus database with same CATH topology
2EIGA 3B5LB 4P9JA 2ZX2A 4Y1YA 1O5LA 1X8EA 1M06G 2PHDA 3KT1A 3V0AB 1BEV1 3CJIB 3J4UH 2BW8A 2HJIA 5K7PA 1OHFA 2R041 3IBMA 5CU1A 2GC2A 4OLLA 2JG8C 1H30A 1G86A 3ZVXA 4MXWA 5DDJ2 1NQDA 2NYYA 4WM8C 4DZGA 4AHWA 3D0SA 1FPN1 1AL0G 3RRDA 3EHKA 4YVSC 5A3MA 4YZ2A 4J1XA 3RDIA 4UW4A 1KDKA 1BEV3 3FFQA 1ZZ7A 2R043 2ZAHA 3KGZA 1WCSA 4Y5Z0 2ZZQA 1T6GC 4Z8BA 4XJ9A 1JUIA 2A3YA 2VPVA 2WNVA 3UKTA 2CY6A 4C91A 4LEJA 4Q27A 4P9XA 3WXPA 1POV0 1FPN3 3VBSA 1EAH2 2VOKA 4IEOA 1ZZ8A 3IDBB 3POYA 4Q2FA 2Q5TA 4KWJA 3GYDA 4Q1RA 5HBAA 3FWEA 1PZ9A 2R0FA 2EALA 4KWKA 5BNNB 5JOXA 2XUMA 1REFA 5K0UB 3J26N 3VL8A 4Y26A 1QWRA 1IPJA 1WW7A 5FTTC 1X82A 1I6XA 2EAAA 4Z2WA 3MIFA 2VNRA 4LO5B 3EXUA 1V6MA 5L19A 2ERFA 2P37A 3LA2A 2R063 1NCQB 4ES9A 1ZZ9A 4IEZA 5ABJC 1LOFA 2LM3A 1RL3A 3WT3A 2JEMA 2CNAA 2ENRA 4B4PA 3U0ZA 5A32A 1B35B 3ETQA 3R4DB 4DNYA 4KBBA 2CYFA 1UKRA 4LLOA 4Q4V3 1V9U1 3ZFEC 4MSVA 4XDQA 4XHBA 2ZABA 2DVDA 4IV3A 4I0BA 2UWAA 3KMHA 4MVTA 1ZREA 2AYHA 3KSCA 1OPOA 5E89A 1O3SA 4LBQD 4AHXA 5D8AB 2E6VA 2DCYA 3VZJA 1S0JA 4HK9A 5DXDA 5AC91 1AYN1 1EPZA 1Q5OA 3KT4A 1KFXL 1V9U3 1AJOA 2GN7A 4LNVA 2H0VA 1S0DA 4Z82A 5IT6A 4D3WA 1AVBA 1XXNA 3WQ1A 1KJLA 2ZX4A 2JG9A 2WFF1 2DFCA 3HD8B 2P34A 3H1WA 1PZ8A 2GMPA 1PZ7A 5H9PA 4SLIA 1COV2 5AC93 1AYN3 2TBVA 1QMJA 5F9TA 2D97A 3VZLA 3ZXFA 4M3CA 4XFAA 1BCXA 3EJKA 1PO21 4EN0A 1CAVB 1IHMA 4GB31 2JX9A 4XJZA 4MGKE 4C1XA 3BODA 1A78A 2YROA 1RHI1 4RA0A 3VBRB 2XKOA 3OJBA 1LHWA 4AGVA 2WFF3 2I07B 1K5MC 3ZYJB 1Y9QA 2WZR2 4AI1A 2CGOA 5GLWA 3URFA 1R1A2 4FPKA 1PO23 1N1SA 4GB33 4UW3A 3TYJA 4JGYA 5HCFA 3NSTA 1JTZX 2QFEA 2WQ4A 3LA3A 4M3CF 4LT5A 1RHI3 1W0OA 3ZSJA 1ND2C 3VHOA 4A3XA 4BA6A 4FTSA 3VBUB 2DFBA 5FPXA 5J37A 3GBWA 4XEZA 4P9IA 2OA2A 4FP3A 4CZSA 5JZGC 1WLCA 2Y0IA 1J3QA 3D0JA 1S0BA 5CBLA 4FT8A 2TEPA 2R32A 4M0NA 1PGSA 3AMNA 1SLBA 1TMF2 4M01A 3S7IA 3SLIA 4YZ1A 3ZN6A 3VBFB 5IK8A 1X50A 2XVKA 2HWE2 3ZFFC 1CJDA 3M70A 1ZBA2 1UZYA 5JVVA 4IEPA 4HPKB 4FPOB 5CFCA 2D6MA 1H8TA 4MYEA 1BMV1 1DZQA 3WDUA 4FO9A 4AVBA 3ZXAC 1C4RA 2RJLA 2EVXA 3H7JA 2ZGKA 1GNHA 4YGDA 4COVA 1FNZA 5FO9B 3QLQA 4HSLA 5FRAA 1F2NA 1WBFA 3UV9A 3ZXJA 3W9AA 3ACLA 4B4QA 4AG4A 4CDWB 4EN6B 2O1QA 4BMEA 1RUE1 1V6KA 3P3NA 2HWC2 5T50A 4QT6A 4NWWA 4JVAA 3LGRA 3WDYA 4FPJA 4JTOA 3R4SA 3OBTA 4B7KA 2W39A 5C6CA 2A6WA 5JWPA 4AYUA 2TUNA 4FOYA 1IS3A 2HWF1 2Q8OA 4BM8A 2ZX3A 5BNOC 1ASJ2 1FV2A 1QQP2 1H1AA 2VXRA 2Q1ZB 2VW2A 4HKLA 2TNFA 4B7EA 3WUCA 4JV4A 1TNRA 4PDWC 1RUE3 5J98B 1WMDA 1ND2A 4CDXB 2WSUA 2B5HA 3UL2A 5I8YA 1U5XA 5F6LB 3KZ4C 4AI8A 3CEWA 2HWF3 4QGNA 4XF4A 5GLZA 1U12A 3ILNA 5JZGA 3JCIA 4GQ7A 3S7EA 1H9PA 3PLQA 1AX1A 1PVC1 1H1MA 4MGYE 4B4RA 4COWA 4ATEA 3VZNA 2DWRA 3NVCA 4FCAA 2FBEA 2PQQA 3OF1A 5TSWA 3AP6A 4CEYC 3VKOA 1ND3A 1OOPB 3AP5A 1FYUA 3VHPA 1OI6A 3DF0A 2XLGA 2PN5A 1OSGA 1PVC3 1HRV2 2BNMA 5JLVA 3ZN5A 1RVF2 4XQ4A 3TNPB 2A6VA 1OFSA 1V70A 1AL21 5A3LA 3HMYA 1IS5A 1QF3A 2UWCA 4Z07A 4LA3A 4F83A 1H4GA 3NAPB 5E88A 4J1WA 4ORFA 1WCKA 5A33A 4KQ7A 1VB4A 1R081 2OZ6A 3WP5A 5T5OA 1C8M2 2CGPA 4I2OA 3IKWA 5B2GB 1IS4A 1KS5A 5BNOA 1LOBA 4IQPA 2RS52 2ARXA 5JSRA 1VBC2 3OPZA 1WD4A 3MZHA 1ZA4A 5E1RA 4AEDB 1CX4A 4UW5A 4YM1A 1R083 2XWBB 3POWA 3GHNA 4MGIE 4NHLA 1H2LA 2NMNA 2HEVF 3WG2A 2PHLA 3AZXA 1O4TA 3VZMA 2DCKA 3KGLA 1D4M3 1RUD1 3VDDC 5T5LA 1LR5A 1PO12 4R8HA 4MXVA 4XILA 4PIXA 2ES3A 4BIFA 4QPIB 4INDA 2E63A 3RNSA 1H0BA 4OUSA 2PAKA 3WX5A 4L11A 4AQTA 2QZ3A 1RITA 2YC0A 4NHKA 5SV8A 4IEYA 3JQWA 2NM1A 1RUD3 1VAVA 4Y22B 3TRSB 4HLTA 2ZA9A 1VB2A 1X33A 1CJPA 4TWTA 4COZA 2DV9A 1D2QA 3U4XA 1MS4A 4K6BA 2OZJA 1C28A 3RYPA 1NG0A 3FBMA 3N3HA 4OUMA 1BJQA 4GWMA 4PBPA 4XOGA 1HQNA 2ZMLA 1RUI1 5SV5A 1W6OB 4E4DX 4PQ9A 2X8KA 4K8FA 4AGRA 5K0UC 1CAUB 4LBJA 1SCSA 1AXKA 1MS8A 4S2DA 5FCCA 2UYAA 4G4FA 2V73A 3RS6A 4ZU5A 1PK6A 3HBZA 2PTMA 1F9KA 2VW1A 4GIQA 2BTVC 5FQ0A 2BFUS 1RUI3 2G4IA 1U5ZA 2HWB2 4LA2A 1NZCA 2DCJA 1VRH2 5J48A 1B35C 2A5ZA 4XXPA 2CTVA 1RUG3 1VBD2 3NWKA 3V0AA 4FTEA 4C1WA 4KGGA 4ZXKA 2VUAA 4N53B 3I59B 4NPRA 2VU9A 4CRQA 1LGCA 4NR1A 1XU1A 1V6OA 3O7OA 1RUOA 2CWSA 4XJ8A 5FBZA 3MYXA 3TNQA 1OA2A 3B01A 4IESA 3ZSMA 4JGZC 1EP0A 3PVEA 4QQLA 1AR91 2ZMKA 3DPRB 2ZTNA 3IN9A 1GFF2 4HN0A 2R30A 4CEWB 4D7TA 2ZACA 1JXNA 2YZ4A 2AUYA 3WQ7A 4R4ZA 1UU5A 4OHZA 3FUOA 1ZNPA 3TN92 4PIYA 2FZ1A 4FOVA 3ME2A 3D4KA 2JJ6A 4Q4Y2 1XYNA 1AR93 3WP4A 1RUC2 4E9KA 2MPFA 2QJVA 5BNNA 2X5IB 3RZZA 4LHNA 1CR7A 2VQ0A 4BPZA 4TLFA 5K0UA 2RS12 1S0CA 2RS31 1ZBE1 3NL1A 1Q8PA 2GNTA 3AM2A 5LRSA 3JD71 4DINB 3QACA 5FPZA 4META 3DKWA 3M7AA 3A0KA 4AHZA 3QCWA 1B35A 1S0FA 4YLZA 4P9WA 4BHPA 3AB0A 4K9SA 2RS33 1ZBE3 1MQTC 1W6PB 4UBHA 2QNKA 4XTPA 4BLIA 1J3RA 4L8QA 3MPBA 2JXAA 4RSUA 3JD73 2QKDA 3B94A 2ZAAA 4ONUA 2XL7A 3FLRA 3L2HA 1VBB1 1RUJ1 3OD4A 4JRLA 5EYYA 4IEQA 3MICA 3VBFC 2UWBA 1SBDA 1QJU2 4GWNA 2A75A 1JN2P 1S55A 4LLFA 2IXJA 2QDNA 1PNFA 4YGEA 3VBOC 1RMU2 1NXD1 3MIHA 5KC6A 1VBB3 4UW6A 2ETEA 1RUJ3 5T55A 1W6NB 2KM2A 4IETA 5J7MA 5JR7B 1REEA 1SLTA 1CAVA 2QE3A 4ISRA 3RG0A 3MGUA 5BNPC 1AUYA 2DU1A 3R0RA 3AJZA 4N90A 1EV11 1QDCA 4CDUC 2WNEA 1SCRA 2WS91 2HEYF 2RR12 4OI1A 3QH7A 1NA1C 3M3OA 2GC1A 1HXS1 5KXBA 4HANA 3WW3A 3MIEA 4YG6A 1TEIA 4RHV2 3V0BB 4KL1A 4H7LA 5FLJA 1I5ZA 3VZOA 3KM5A 4KNCA 4JRAA 2MEV2 1EV13 2ZKLA 3AZZA 4LBQA 4Y20B 5IUQA 1MEC1 1CN1A 2WS93 3N4MA 3M8LA 3ASIA 3AX4A 3J9SA 4V1PA 1HXS3 5CADA 1C3HA 2AH2A 3R6SA 1YRZA 2BQPA 5EWSA 4HBNA 3ZO0B 4AVAA 4ZU7A 2W68A 2EXIA 1PMIA 4BH9A 2D3RA 2D40A 1OLRA 2GZWA 2P2KA 4AFCA 1HRI1 1MEC3 3VBFA 3O0XA 3T2TA 2PHTA 5GKAC 3AMHA 1PGL1 1Q8OA 4HPKA 4Q4W1 1IKQA 1KJRA 1G8WA 3HWJA 3HAGA 1AX0A 1N3PA 3ZXGA 3JBG2 2JD4A 4H55A 2XJSA 3VKMA 1A6CA 4ES8A 2GDFA 4M0HA 1HRI3 4EN9B 1UMZA 3MFAA 4PIZA 4CDWA 1UU4A 2R0HA 3N7JA 4Q4W3 4YVWB 3MW2A 3PNAA 4FVVA 1BVVA 3B9IA 1WUVA 1GICA 2H6CA 5ACA2 1PGW2 5EZWA 5CG9A 1DQ0A 3EQEA 5HXVA 2Z69A 1ULGA 2XWJB 4XF3A 2WL1A 3PMSA 1V9U2 4GXLA 1GR3A 1VLNA 1GLHA 4QXKA 3BPZA 4CDXA 3UK9A 4AEDC 3WY6A 1XE7A 1H2NA 2HWD3 2GSYA 2V09A 2ZOEB 3WW1A 5H9RA 4C0BA 3B69A 4F7ZA 2YGMA 1TME1 4K21A 4AFBA 3VBSC 5C8CB 1AJKA 4Y4YA 2GNMA 5BY5A 1WW4A 4RQPC 1LHVA 2WT2A 3AYDA 1VAKA 1WLWA 2RHPA 1LGNA 2DUPA 4FPEA 1MS3A 2D6NA 1MZEA 4HK8A 2UY9A 2C0ZA 4M00A 1RUH2 2I45A 3VKLA 2W08A 2WA4A 2XPJA 1RUF1 3E97A 2D3SA 2WFF2 1TME3 1JYIA 2D6KA 1OQDA 2WWSA 1LOFC 4XQWA 3FMGA 2RJKA 2IXKA 4Q4X3 2D43A 1OMIA 3A4UA 1RUF3 2X29A 1XE8A 5JPMB 3WCRA 1ZZBA 1N47A 1IS6A 4GMP1 3M3EA 3RPQA 3SCHA 3AFKA 4XFCA 4Z1VA 3RQ0A 3BALA 1QJY1 4IV3C 4YM0A 1RJ7A 4LO4B 1ZVFA 4OHXA 4AF9A 1C57A 3MF6A 2XVGA 1UAIA 4RR3B 1SLIA 2WT0A 3H3ZA 4DRVA 1LOAA 1AR62 1OQEA 2PLV2 2PHFA 1YLLA 4PBOA 4QQ2A 4B29A 3FLTA 3AMQA 4AEDA 4LBMA 4GMP3 1BZWA 1W6QB 1QHDA 5BYNA 1QJY3 2N7GA 4PLNA 1UCXA 4LBOA 1DU3D 4RQPA 1MR5A 2JG9C 2R061 1JW6A 1V6LA 3NV4A 2VW0A 1AR72 1YI9A 2XBO1 2ILMA 3MDPA 4QPIA 4FOWA 4AVVA 3M1HA 3WLUA 1GV9A 1V6NA 4QPGB 3TAYA 3FFZA 4XIKA 1CAXB 2AREA 3ZFGB 3GZUC 1NLRA 2A73B 4XJWA 3GBGA 4Q4V1 1CAWB 4Y22A 1S0GA 1G6NA 2PELA 1VBE1 1MS0A 3VGIA 2XBO3 2GMMA 1DDLA 4JTNA 3FE5A 3C3VA 2OW4A 4DS0A 4S2HA 1C5HA 1EYBA 4JGYC 4GMP0 4RL7A 2WNUB 1KITA 1F5JA 4KGQA 3J8F3 3VHRA 4O9EA 5T5PA 2A7AA 1CAUA 5GALA 1VBE3 2UY8A 1KD7A 4N43B 3AP7A 4I3GA 3WR0A 4LBLA 5CIRA 4IV1B 4MV2A 5C33A 3VHNA 2GN3A 4FTBA 5EV7A 3RWNA 1BBT2 1CONA 2JICA 4XIOA 4CP2A 1GQHA 1ULDA 3BB6A 1LESA 1IQAA 1GZWA 3KD4A 4WVZA 2EXHA 1HW5A 1C1FA 3AZVA 3RMYA 5CFCC 1NQJA 4R9AA 5GZEA 3KS7A 1H8TC 4N53A 2A6YA 2ZGQA 3H3UA 3WCSA 4F3JA 3S0MA 1ZRCA 3JB4C 4WM7B 1VJ2A 4FPCA 2ZGNA 3WHUA 1NXMA 4QHBA 4WVWA 1HKDA 5FLIA 4RFT0 4XMIA 1I1EA 1URXA 4QD2A 1AL22 3WZ1A 4CEWA 4YM2A 1PIV2 4YW2A 3K48A 3BOPA 2G9GA 1FT9A 3NJZA 2NQYA 3KLSA 1APNA 1N1YA 5EFUA 4DRRA 2UYBA 1ENSA 2X5IA 4N9HA 4XMAA 4Y1ZA 1F8VA 1OQ1A 4YGBA 2NMOA 3N7KA 3WQ0A 1Q56A 3LAGA 4PF5A 4P9GA 3R4UA 4COUA 1DGRN 1MS5A 3KB5A 5K9YA 5L7OC 3TOJA 1QJX2 1Q3EA 3O0WA 5HI0A 4UBGA 1IGOA 3AKPA 1VALA 3ZYIB 2YHJA 1Q8QA 1DZTA 1LU1A 4OI2A 3OY8A 3AYAA 1ND3C 1W6PA 2Z5WA 4RGGA 3LZZA 2JE9A 4LUKA 3VBHC 1EPWA 1Q43A 4OULA 1QXJA 4YG3A 5DDJ3 2QZ2A 4F8AA 2O8QA 4KWLA 1X8MA 2PFWA 4E2QA 5GZDA 4AEJA 4XW3A 1M4WA 1FMD2 4XXAA 4D69A 4XZPA 3PJQA 4HETA 4A2UA 4YRDA 4NN0A 4OHWA 1YWKA 4QMAA 1S0EA 1Z0HA 2D6LX 5C9AB 1UF2C 1D0HA 1R092 3CLPA 4OZXA 3AYCA 3SNMA 3INAA 1W6NA 3V56A 3U07A 4LO7A 1J59A 1N1TA 4AGGA 4AFAA 3OCPA 3CJXA 2P3IA 1YJLA 4FPGA 1KS4A 4E4SA 1FAYA 4KU7A 1SFNA 5H9QA 1VBA2 1L3JA 4YVWC 5L7OA 4IEVA 4W6YA 3TWIA 4X8PA 5C4WB 2EXJA 1F5FA 1BVP1 4Q0SA 4DMIA 3OGJA 3HT1A 3USUB 4AXOA 3FC0A 1CQ9A 2IC1A 2QUOA 2WC2A 5KC5A 3IPVB 4CDQB 2ZKNA 3AP9A 3ZYGA 4Q8LA 4GH4B 4KH9A 2VMHA 4HVQA 1RC6A 1ALYA 3H9AA 1HDKA 3V0BA 3JZVA 3CNAA 2PA7A 4OHVA 1PNGA 3QD6A 3RI9A 3VBHA 1GANA 4K1YA 4Y20A 2D5HA 2WLQA 2D7FA 4GULA 4ZKTB 1TQ5A 3VN4A 5C8CC 3WDTA 3ZXLA 2OUHA 1AR92 1JUHA 2JECA 2ZGTA 1JH5A 1G9BA 3WV6A 1LOGA 1COV1 1D2SA 3SHRA 1NY71 3PVOA 2QDRA 3U11A 1XNCA 2EXKA 3MLKA 4FQ4A 1LOCA 4XFHA 1PK6C 4BYYA 4HVRA 1D4M1 4D7SA 5I8TA 5KHHA 3QBQA 1ZZCA 1A8DA 4I09A 5EJ3A 2QCSB 2WZR1 1COV3 2XLAA 3B00A 4XPVA 2WFPA 1TE1B 1R1A1 2MHFA 4W65A 2VMIA 4EWEA 4IEUA 1J1TA 2A70A 2ARBA 1XNBA 4MXWB 3CJIC 4ITCA 5FDBA 3QH6A 2RE9A 5JDBA 3VKFC 2ZBJA 4YVWA 1OD5A 3M3CA 3AKTA 3OTFA 2DTYA 4TYSA 2WZR3 1SACA 3WG4A 1R1A3 2JE7A 3WW2A 3MW3A 2YXSA 2WNVB 5J96B 5CVRA 1UX6A 1TMF1 5JAXA 3WP6A 3CF6E 2HWE1 2R6QA 4IEXA 4M3CE 3BIWE 1B09A 2NZ9A 1LEMA 1ZBA1 2JDZA 3H0OA 1HX6A 1W0PA 5C8CA 4LHKA 2BPA2 4OI0A 2VOWA 1WLTA 3RJ2X 1WD3A 4HT1T 2DVGA 4RS5B 1TMF3 2XJVA 1LHUA 4MZUA 5BNNC 3FJSA 2HWE3 4Q0VA 1RUG1 1ZBA3 1Z7S2 4QPGC 1S1AA 1NCRB 4E27A 1KXGA 2HWC1 4P9YA 4HN1A 1NCQC 5DZEA 4WVMB 2CAVA 3AFGA 3L9JT 4LO8A 2WIIB 4H14A 4AVTA 1ASJ1 5CG8A 1QQP1 4WV8A 1LB2A 2JG8B 5F6KA 1EV12 3CJIA 3OD0A 2DVBA 2VH9A 4WM8B 2HWC3 5T5JA 4S2FA 4XETA 3W58A 4LUMA 4YVSB 3UKVA 4OVEA 2WA3A 2NLRA 3HT2A 2DVAA 1DGLA 4RR3A 1ASJ3 1QQP3 5FFOC 1XNDA 4YYOA 2GNBA 5GM0A 4URTA 1DG6A 2VQAA 5D8AC 3GBFA 1RB8G 1GZCA 1XU2A 1W6QA 2EAKA 4LBNA 2IXCA 2PAEA 3W59A 3AXEA 4LE4A 3I7DA 4L9BA 5GZGA 4DPNA 1DQ1A 3TBDA 1MVEA 1LULA 3WG3A 1O91A 4Y24A 4I0WB 1RJ8A 1HRV1 4N7UA 4B3NA 1RVF1 1SBEA 3BCWA 3PMEA 4D7YA 2R072 4Y1UA 3PHMA 5E16A 2P17A 2VG9A 5DG1A 5ABJB 3O5SA 4QPGA 4AEKA 4AFMA 1CAXA 3VBRC 1CVNA 3ZFGA 3KT7A 3R05A 3FBYA 1C8M1 3HN1A 1NCQA 1UPIA 1ULFA 3SCGA 1HRV3 5EXOA 1ULEA 1RVF3 2VUJA 4FXGB 3RYRA 3ST7A 2IXLA 4BCUA 3AJYA 4E2SA 1VBC1 2BUKA 2V5YA 3ZFEB 3WDVA 1CIWA 2HEWF 3O14A 4HMZA 1U5IA 1AYM2 1W2UA 1BYHA 4XJAA 3AKRA 2R1BA 3VBUC 1N1VA 4EN7B 1C8M3 1VAMA 4Q8KA 1UKGA 1WMFA 2D93A 2WLPA 4N43A 3SMHA 2RM22 1LJ7A 1CESA 2DVFA 5FREA 1H9WA