1HSQA

Solution structure of the sh3 domain of phospholipase cgamma
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
71
structure length
71
Chain Sequence
b'GSPTFKCAVKALFDYKAQREDELTFIKSAIIQNVEKQEGGWWRGDYGGKKQLWFPSNYVEEMVNPEGIHRD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOSPHOLIPASE C-GAMMA (SH3 DOMAIN)
publication title Solution structure of the SH3 domain of phospholipase C-gamma.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Phosphoric diester hydrolase
total genus 4
structure length 71
sequence length 71
ec nomenclature ec 3.1.4.11: Phosphoinositide phospholipase C.
pdb deposition date 1994-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1hsqA00
2JMCA 2J7IA 3M0RA 2HSPA 3REAB 2RQRA 1WIEA 1WXBA 2F2VA 1T3SA 2K79A 2LNHB 1N5ZA 3UA6A 2DM1A 2JM8A 2AZVA 2BZYA 2RF0A 4DEXA 2KXDA 1I1JA 3VS1A 1U3OA 4J9HA 1WDXA 1GBQA 3NHNA 2LJ1A 4J9BA 2C0IA 2DYBA 2BZ8A 2EGAA 1ABOA 3U23A 4GBQA 4JPBW 1X69A 3VS3A 3LH5A 1RUWA 1UGVA 1TUCA 4RUGA 2K3BA 2K6DA 3M0QA 2LCSA 1YWPA 1WXTA 2V1RA 2GNCA 1SSHA 2FG0A 3QWXX 2P4RA 1K4US 3VS2A 2KGTA 1QCFA 1B07A 1UJ0A 2EYWA 2EPDA 2H8HA 2RN8A 4CC4B 4AFQC 4OMOA 2EYXA 1M30A 1UECA 4OMLA 2ECZA 2GQIA 1JO8A 1JU5C 2L3PA 2MOXA 1NG2A 1Y57A 3ZL7C 4R0KA 3VS0A 2DILA 1JXOA 2CUBA 2BTTA 1BU1A 3IQLA 1GRIA 3RBBB 2VKNA 1BB9A 4J9FA 2JT4A 4Y92A 4OMPA 2HEQA 4RTUA 2KT8A 4E6RA 4ORZA 2FPDA 5IXFA 3CQTA 3UF4A 2DL7A 1GBRA 1LCKA 3I5SA 1GCPA 1WYXA 1ZUKA 1YNZA 2QDLA 1PRMC 3C0CA 2LZ6B 3PE0A 4LUEA 4RTVA 1QKXA 3VS5A 1A0NB 3TSWA 4RTXA 5FW9A 5FWCA 4X1VA 1MUZA 4RTWA 4J9GA 2JTEA 1W6XA 3QWYA 4GLMA 2A36A 4LN2A 4D8KA 2KBTA 4EIKA 1OPLA 1YWOA 2ENMA 4J9IA 2VVKA 1PHTA 2J05A 1AOJA 2BZXA 2AZSA 1GCQC 1QWEA 2B86A 2CSIA 3REBB 1YP5A 2EQIA 2X3WD 2HCKA 1TUDA 2LX7A 2RMOA 1ZX6A 1WX6A 1WXUA 2J06A 1MV0B 2YUOA 2K7AA 4JZ4A 1M27C 1PKSA 2ED1A 1AWJA 1ZUYA 2A28A 1CSKA 5I11A 2M51A 1ZBJA 1ZSGA 4QT7A 1M3AA 3M0UA 1U5SA 1UDLA 1M3BA 4HVUA 1PNJA 5IXBA 4J9CA 1YCSB 1QKWA 3NPFA 1ABQA 2GTJA 2PTKA 1UG1A 2A08A 1GCQA 1UTIA 2DMOA 1W70A 2OJ2A 2YUQA 3UATA 4DEYA 1GFDA 2K9GA 2DRMA 1FYNA 2X3XD 1KSWA 2SEMA 2OAWA 1K1ZA 1SHFA 3NGPA 1X27A 2GBQA 4HVWA 2DA9A 2JMAA 2F2WA 2KE9A 1H3HA 3THKA 2KYMA 1OOTA 2KXCA 2MCNA 2CDTA 2L3QA 3I5RA 3I9QA 4HVVA 2XMFA 2DL8A 4K11A 1K0SA 4CC7A 2JS2A 1PRLC 2C0TA 2J6OA 3VS6A 4J9DA 2LP5A 5I22A 2LQNA 1OPKA 2DX1A 3VS7A 3VS4A 1IO6A 2PZ1A 2EVRA 3EG3A 2KYBA 3TVTA 1EFNA 1W1FA 1T3LA 2DVJA 3O5ZA 4IIMA 1BBZA 2EW3A 5IH2A 1J3TA 1KFZA 2O2OA 1HD3A 1JXMA 2KT1A 4JJBA 4AFSC 1HJDA 2FPFA 3I35A 2NUZA 3PVLA 2FO0A 1Z9QA 1AVZC 2CT4A 1WA7A 3PVQA 2KR3A 1NEBA 2DBMA 2JM9A 2KRSA 1I07A 2CT3A 1JEGA 4RTZA 4OMMA 1AZEA 1E7OA 3UA7A 4LUDA 2NWMA 2DBKA 4FSSA 3M0PA 4ESRA 2I0NA 2EYZA 3RNJA 2W10A 3R6NA 2A37A 2ROLA 3SEMA 1WI7A 1Z9ZA 5ECAA 1AEYA 2CH4W 4CC2A 2YT6A 4HXJA 2KRMA 3EHQA 4AFUC 4OMQA 2EGCA 2JS0A 2O31A 4F14A 3M0TA 4D8DA 3M0SA 3JV3A 1H92A 1X6BA 2AKLA 2VWFA 1UJYA 2DJQA 2FPEA 3H0FA 2CREA 1WLPB 1CKAA 1SRMA 4KRTA 2C0OA 2G6FX 3EG1A 2DLPA 1HSQA 1RI9A 2GTOA 2MIOA 2FRWA 1RLPC 1Y0MA 2J6KA 5EC7A 2SRCA 2KNBB 1FMKA 3H0IA 1UE9A 1OEBA 1MV3A 2RQTA 2D8HA 2LJ0A 3VRZA 2L0AA 5L23A 2D8JA 2DRKA 4RTYA 2JXBA 1QLYA 2YUPA 1KIKA 4HCKA 1AWOA 2RNAA 4AG1C 1SPKA 5IHKA 3H41A 4Z8AA 2JW4A 2LMJA 4LE9A 2EKHA 1H8KA 4J9EA 1UHCA 2EGEA 4A63B 5IHNA 1ARKA 1SEMA 4IIOA 1M3CA 1WFWA 2W0ZA 1SHGA 1AD5A 2KRNA 4JJCA 1V1CA 2DE0X 1JQQA 2AKKA 4LNPA 2V1QA 1PKTA 1NLOC 2YSQA 3EG2A 1E6GA 3EGUA 2PNIA 2DL4A 1TG0A 1I0CA 3VRYA 1UFFA 2CUDA 3EG0A 2O9VA 1VA7A 4CC3A 1U06A 1G83A 2YDLA 2J6FA 2KEAA 1AWXA 2HDAA 3FJ5A 1M8MA 1NM7A 3NMZC 2CH4A 2F2XA 2IIMA 3H0HA 1G2BA 2D0NA 1T0HA 2HBWA 2M0YA 4ZNXA 1UUEA 2FEIA 2OI3A 2O9SA 4RTTA 2RQVA 2RQUA 1XOVA 1GL5A 3ULRB 4JZ3A 1X43A 2O88A 1CKBA 5HCKA 1VYTA 2RPNA 1VYVA 5GJWB 4F16A 4OMNA 2EYYA 2LJ3A 1K9AA 2GGRA 2ED0A 1S1NA 2YUNA 1AWWA 1SRLA 2LQWA 3SHWA 5GJVB 1X2QA 4F17A 4JJDA 1NYGA 1PWTA 1GFCA 1T0JA 3GBQA 2D1XA 2ROTA 4M4ZA 1ZLMA 1X6GA 1ZUUA 2RQWA 4AG2C 4WCIA 1RLQC 2CSQA 2AK5A 2ABLA 1OV3A 3KFVA 4Z88A 1NYFA 1NLPC 1X2KA 2KROA 2L3SA 2K2MA 1NEGA 2EBPA 5FWBA 2DL5A 1KJWA 2FRYA 2L2PA 2DNUA 1VYUA 4AFZC 1B3QA 1UHFA 2E5KA 4Z89A 1QWFA 3TSZA 1K76A 1YN8A 2DL3A 3A98A 1BK2A 2DF6A 5IHIA 1E6HA 1AZGB 2ESWA 3EHRA 1K0XA
chains in the Genus database with same CATH superfamily
1OU9A 2JMCA 2J7IA 5HKCA 3I56Q 5AT1B 4KUDK 1WIEA 1T3SA 2E3HA 4M75E 2OTJT 1EX4A 3CCVA 2AZVA 3M5AA 1M1KU 3H9NA 2X4JA 1HK9A 1NZ9A 4KH0B 1BCOA 1GBQA 1R77A 4J9BA 1SKUB 2C0IA 2FL7A 4M7DA 1MGQA 2EGAA 1NE8A 3LH5A 1RUWA 3OA6A 1M2VA 1TUCA 5GAN2 4JLGA 4RUGA 3HSBA 2K6DA 2CS7A 1UGQB 4FYWB 3OW2S 1Q95G 2P4RA 1QCFA 5J39A 3HTRA 2XICA 2EYWA 2H8HA 2RN8A 2JTFA 2O4XA 4FSXA 2XU8A 1UECA 1JB0E 2GQIA 1AT1B 1K73R 4R0KA 3RKXA 1C6VX 3E2UA 1VQ9T 2RHUA 3RBBB 2Y90A 4BY6C 2VKNA 4J9FA 3OSVA 3UWNA 3EGXA 4Y92A 3NTKA 2HEQA 5GAOm 4RTUA 3VKIA 1VQNT 3G71Q 1ZA2B 3QO3A 1GBRA 3UF4A 1VQ8T 2D0QB 2F5KA 4C5HA 3I5SA 4DOVA 4F7UB 1YJ9T 1GCPA 3UT1A 1ZUKA 4AT1B 2QDLA 1QKXA 3CCQT 5LJ3f 3HRUA 3KUFA 5FWCA 3SWNA 3X28B 1MUZA 4J9GA 3CCVQ 2VV5A 2VB6A 4GLMA 2A36A 3MEWA 3WVEB 1PCXA 3EG9B 4EIKA 2BIVA 2ZPBB 1KC8C 4LD9K 1PHTA 2X9HA 4M78E 1C1AA 1RADB 4OB2B 1VQ7Q 1U1TA 1YP5A 2QA4A 3HRTA 2RMOA 3MP6A 4J5YA 1WXUA 5EG2A 2GQVA 3JCMb 2J06A 4X9CA 2KQWA 2P84A 3JB9G 4ME7A 3HFOA 2K7AA 2X51A 1MNDA 2ED1A 3CEYA 1ZUYA 4HCZA 1YHQT 2M51A 5IT9E 3UDCA 3LW5E 3P8BB 4QT7A 1I5LA 3JCMQ 4DBFA 1PNJA 3CCRQ 2R5MA 2JVVA 3CCUT 1YCSB 1ABQA 3MHXA 4M7DB 4DEYA 1GCQA 2KVQG 5A0GA 1TU0B 1BCMA 1KSWA 1K1ZA 2ZZDA 4J6WA 1UGRB 1OI1A 5GAMh 1U1SA 2ZPFB 1WHGA 2DA9A 1KQ2A 2KE9A 1H3HA 3FIFA 2B8AA 4NS5A 4BDZA 1M2OA 1OOTA 1PSFA 3I5RA 4HVVA 1NJIU 2DL8A 4CC7A 2JJ9A 3N5BB 2C0TA 4O5VA 3VS6A 1RABB 1FMWA 4PK4A 1R0CB 4B6MA 5I22A 3FRNA 2EIFA 3VS7A 2HQXA 3VS4A 1IO6A 1YIJA 3J80E 2PZ1A 2QA4Q 2EVRA 3GNFB 2PQWA 4C8QB 5GAN7 1W1FA 1K8AC 1BBZA 3FB9A 5GAN3 1J3TA 4PJLA 2NLUA 1HD3A 4C92B 4JS4A 3QXEB 2RI5A 1LPLA 4ATOA 4CRIA 3CC2T 2FO0A 2DKGA 2LCLA 2KR3A 2VXFA 4IUPA 2JM9A 3CCJA 3NTHA 1F1BB 3M4GA 4RTZA 4OMMA 1E7OA 1WNLA 2K5IA 2DBKA 4II1A 4C0GA 4FSSA 4ESRA 2I0NA 3RNJA 2A37A 1EZZB 1M1KR 1YJNT 1JJ2S 3FLGA 1TS9A 4CC2A 3RMQA 3EHQA 5M9OA 4FYYB 4OB1B 4XTWA 2EGCA 5GAOl 4ANJA 2O31A 1Q7YC 3M0TA 1KG1A 1IB8A 1M1FA 2L8DA 1B34A 1X6BA 2GFAA 4IKFA 1UJYA 3OMCA 4NL2A 1WJQA 2WSEE 3A1PA 3G4ST 4DQ2A 2CREA 1CKAA 1G3WA 1SRMA 4KRTA 2C0OA 3ASKA 3FC3A 1RI9A 3E9GA 2OTLT 5KYUA 4C0FA 3V7CA 1OQKA 5EC7A 4E7IA 1VQ6A 1FMKA 2E6ZA 1ZSZB 4C0DB 3VRZA 5KYWA 2DK3A 1YIJQ 2D8JA 4HA8A 4RTYA 2AT1B 3I56T 2JXBA 4MZMA 2K3YA 2P0PA 4ZGEB 1Q81U 4BUGA 4HCKA 2CZ0B 4OGEA 1SPKA 9ATCB 2JW4A 1WHMA 2MF2A 1K9MU 2EKHA 4A63B 1VQMT 3OYCA 2DXCA 3DLMA 2RJDA 1SEMA 3JAME 1D3BA 2W0ZA 1TXQA 2LQKA 1AD5A 3QG1A 2KRNA 3CCJQ 1QP3A 2LTOA 3HFNA 1BYMA 4M75D 1G3SA 1QMCA 2KY9A 3T9NA 5LJ3j 3L2ZA 3LX7A 1GXIE 2O9VA 3CD6A 1C0MA 2CP6A 2YDLA 2KEAA 5CIUA 5CQXA 2F2XA 2PU9B 3X24B 5J26A 2O9SA 4RTTA 1N8RU 4OF1A 3ZEHA 1KHIA 3BDLA 4JZ3A 1X43A 4ELZC 2O88A 3Q1JA 2RPNA 2ZAEA 1VYVA 1KD1U 3H6ZA 2FZKB 1S72Q 2DD4A 2DTHA 1Q86U 1VQ6Q 3G71T 1ZSZC 3MJXA 1QW1A 2K3XA 4F17A 5I21A 4M7AF 2DZCA 3D7SB 1JJ2A 4A54A 3GBQA 4FT2A 4F04B 2ATCB 2D1XA 3FDRA 3JCMJ 2CZ7B 3OB9A 4WCIA 2RHZA 2EJGA 2E10A 1K73C 3CCVT 1RLQC 4N0AA 3GNGA 1NPRA 1NLPC 5DY9A 2EBPA 2DL5A 3RIRA 1ZHIA 4D6WA 1VYUA 3QDFA 1UHFA 2E5KA 3CC7A 1QWFA 3OYIA 1LJOA 3S3OA 7AT1B 3J81E 1I8FA 2X35A 1E6HA 4DBRA 3OW2P 1DJ7B 5KE2A 2EWNA 3P8HA 1IGUA 3DB4A 5KYWB 1VIEA 3CD6Q 2HKQB 2YXYA 4M77B 2HSPA 4KT0E 1VQ4A 4J6XA 3REAB 1RI0A 1QQJA 1RAAB 2OX7A 2RJEA 2F2VA 1Q82U 4DBQA 1PM3A 1N5ZA 3AT1B 3GF5A 2DERA 3M57A 3L2QA 1G8XA 2ZPHB 1I1JA 1VQKA 2K4YA 5LJ5f 1YCYA 1RAHB 4OVAA 4XU2A 2EJFA 4PJMA 2BZ8A 3O8VA 4GBQA 2LVMA 3RERA 3HRSA 4N4HA 3QDRB 2QQ9A 3A8OB 1WXTA 3OYBA 4PJOB 1UJ0A 4FCYA 1R0BG 4OMOA 3CPWS 2EYXA 3CCST 2ECZA 1JO8A 1JU5C 2L3PA 3CCMA 3FEOA 3CBPA 1N9RA 3ZL7C 3VS0A 2DILA 2BTTA 5LJ3d 2CP7A 3OYKA 5CKBA 3CC7Q 2DZ9A 3VV0A 2X4YA 1OYXA 2QA4T 2XI9A 4ORZA 1M90U 2FPDA 3G1JA 2JOYA 3CQTA 4Y91A 4J6YA 4OGCA 1WHKA 3V7RA 3OBYA 5CCAA 4F7UA 2RI3A 4WF2A 1YNZA 1XNIA 1PRMC 2NUPB 3C0CA 1VQLT 4QVZA 3V7SA 2WACA 4RTXA 5FW9A 5DLQE 2LX9A 4X1VA 4JRQA 4DOWA 1G3TA 2JTEA 2DEQA 4N4GA 1VQKQ 2COYA 4LN2A 2RA2A 1ZBXA 1Q81R 3EG9A 3EH1A 2P4TA 2ENMA 1YWOA 4J9IA 4C8QG 4XTZA 2V26A 2J05A 1AOJA 2PUOB 1KHCA 1UGSB 2AZSA 4LDUA 2PVGB 3V8KA 4BY6B 4UC4A 2L89A 4C92G 2EQIA 2X3WD 2A3LA 2HCKA 4KUIA 2LX7A 4JRIA 1PSEA 1RL2A 1W4SA 5GMKh 1MV0B 3EFSA 3JB9J 2CZ1B 1VUBA 1PKSA 5LJ3e 4EMKC 4XU1A 4QVCA 3G6EA 3M54A 4EPCA 5I11A 4RG2A 1XTDA 1ZSGA 4Q5WA 3CCMQ 1M3AA 4PLLA 3META 4XTVA 3QYHB 1M1KC 2ZPEB 3E1SA 3HPWA 4L6V5 2GTJA 1W2BA 3L2WA 3G7ZA 4ZN1A 2DMOA 1UTIA 1YIJT 2OJ2A 1N8RR 2XIDA 1X01A 2K9GA 2QGFB 1VQ7A 3GOXA 4LDWA 1LOJA 3MCAB 5LL6S 1IHWA 2OAWA 4HCBA 3OMGA 2WSCE 1WQ7A 1IRXA 2LT4A 4M7AD 1AHJB 1NBEB 2HQHA 2RK1A 2E1HA 2Y4YA 4E7JA 3LGLA 3P8DA 1PD1A 2BE7D 2KYMA 3LGFA 2CDTA 3I9QA 4IUVA 1YFNA 3CPWA 3A5ZB 2XMFA 4K11A 2L5QA 3CCJT 5GAOr 2VGMA 1PRLC 3A8GB 3ZBDA 2J6OA 4J9DA 3HP9A 1JJ2P 1OPKA 1KQSP 4J8OA 3CCRA 4FIBA 1WHJA 2M1HA 4N4IA 2QASA 2E41A 3BW1A 2H3JA 2IPOB 4C8QA 2PVDB 5FLXE 4ZN3A 1RAEB 1T3LA 2QYZA 4IIMA 2DIGA 1KFZA 4R56A 2O2OA 4F7UE 1JXMA 4C92A 1HJDA 3G6EQ 5CQYA 2NUZA 2EFIA 2A0FB 3AHUA 1NEBA 2DBMA 1WPYA 2AHJB 1JEGA 2GCXA 5FU7C 1Q82R 1VQ6T 3UA7A 4ZGJB 5KCHA 1IHVA 4PNOA 2HL3A 4M75F 3R6NA 1Z9ZA 2XDDA 2CP5A 4M75C 1AEYA 3LYIA 4BI4A 2YT6A 3PFSA 4HXJA 2LT1A 2KRMA 3EFOB 1ZQ1A 3CBOA 2JS0A 5LJ5j 1D0XA 1YBYA 3QZ5B 4D8DA 3M0SA 2X4WA 3VYGA 3CXCS 1WZOA 3GIBA 2DXUA 2FPEA 1WLPB 4JRKA 2GF7A 2G6FX 3EG1A 4C0ZA 1HSQA 4NL3A 3MO8A 2FRWA 1RLPC 2HSEB 2VGNA 2KNBB 5GAMj 5L8RE 4FT4A 1UE9A 3OYHA 1ZSZA 1OEBA 1YI2T 5KH6A 1VQPQ 2L0AA 2ZCFB 2DRKA 4FYVB 3CD6T 4M7DE 2QAZA 1LNXA 2DPPB 2YUPA 1D1CA 2QQRA 5DLOA 2DIQA 1AWOA 2QEXA 3H41A 4Z8AA 3EH2A 1M5Q1 4MZPA 2EGEA 4HT9A 2E65A 4BE2A 3M58A 1TTHB 4JJCA 1V1CA 2EYQA 4F7UF 4FW2A 3FJPA 5CKDA 2CZ6B 2DE0X 4M77G 2AKKA 3OQ5A 1NLOC 4A4KA 5CO7A 2XG8D 2RJCA 2PNIA 2DL4A 2QG9B 4E7KA 4X9DA 3EG0A 3QJYA 1N9SA 3CCLA 2HDAA 5D6XA 4BB7A 4C8QE 1B7TA 3H0HA 4M78F 1G2BA 2DXTA 1N6AA 2OI3A 4AMCA 2RQUA 1GL5A 4C92E 2L3RA 3JCMd 3PTAA 4L59A 3I55A 3PMIA 1RAFB 4P5NA 3CC7T 3GLXA 5GJWB 2R58A 5FROA 3DKMA 4F16A 4OMNA 1R8OB 1PG5B 4PJOG 2EYYA 1K9AA 2GGRA 1S1NA 1SRLA 3SHWA 5FRNA 5GAN8 1X2QA 3OYAA 1VQ4T 4JJDA 1PWTA 3CMET 5HK0A 2VYTA 2JUFA 4E7SA 2ROTA 2QEXQ 3JCMX 1ZLMA 4AG2C 2RQWA 4XU0A 4KGVB 3HKSA 3QUIA 2F5TX 3F70A 2CSQA 2XHCA 2AK5A 2ABLA 1OV3A 4Z88A 4M7DF 1NYFA 1VQKT 5DM7R 1X2KA 3CXCA 2L3SA 1KJWA 3VUBA 2FRYA 3OYLA 5AYFA 5C6SA 3TSZA 1K76A 1YN8A 3A98A 3M53A 2BE9B 4ZTFA 1QVFA 1S72A 1AZGB 2FZCB 5LJ5d 1V29B 5KYXB 4TVRA 3M0RA 4LDVA 4VUBA 3JCMe 4M77A 3KBGA 3CCLQ 3CCQA 2I2LA 2RQRA 4E2FB 3CPWP 4M7AB 1YITA 2OTJQ 4JLIA 3CMAA 4QW2A 3UA6A 3DLLA 2DM1A 1Q81C 1H641 2HBPA 2BZYA 1MNEA 1VQ5A 3CCMT 3JCMP 4RMOA 3VS1A 4J9HA 1WDXA 3I55Q 3RKWA 1M9SA 3U23A 4JPBW 2P0QA 2KMTA 2EQJA 4ELYC 3WVDB 4R55A 1H3ZA 1PC0A 1YWPA 2COZA 2V1RA 1SSHA 2FG0A 3QWXX 3QBYA 3VS2A 2KGTA 4PJOA 3SWNC 2MYSA 3JSCA 3TREA 2HMAA 1N27A 2EPDA 3E9FA 4X34A 4AFQC 5C0MA 5D6YA 1I5OB 2MOXA 2DXBA 4M75G 1RAIB 5I2SA 1OX9A 5LJ5e 2M02A 1Y57A 5FRMA 1JXOA 2CUBA 1BU1A 1N8RC 2V8KA 1BB9A 4JDSA 4BACA 2KT8A 2ZPIB 2RI2A 5IXFA 2DL7A 1TOVA 2RO0A 4QQGA 1LCKA 4IUUA 3QZ9B 1Q86C 1WYXA 5LJ3h 3CCQQ 2NUPA 2RHIA 3PE0A 4RTVA 3VS5A 3JCMf 1A0NB 4M7AC 3CBMA 1YITQ 3CMAQ 3C12A 3QJ6A 4RKUE 1D1AA 3INZA 3CCEA 1VQ5Q 1W6XA 3ER0A 3QWYA 3VYHB 4D8KA 2KBTA 2K5LA 1OPLA 4A4HA 3GPLA 3M4YA 5A0DA 8ATCB 1GCQC 1QWEA 1U8RA 1G3YA 3L1AA 3OYNA 2NUTB 2CSIA 5GANj 2M0OA 1VQ7T 1TUDA 1YJWA 1ZX6A 2MPXC 1WX6A 2DTOA 3EFRA 4PJJA 3OY9A 3A8LB 1NJIR 2YRDA 1M27C 3CPFA 3QKJA 2RK2A 4M77E 3KXTA 4BE0A 4HKEA 2O01E 4J83A 1SSFA 2PVOB 4GY5A 2HQEA 4PFPA 4M78D 1Q82C 3LWIA 4PJNA 3UPUA 3NFCA 1UGPB 3M0UA 1U5SA 1UDLA 1HXDA 1M3BA 2JZ2A 4HVUA 2H3EB 4HCCA 2XDBA 4EMHA 5IXBA 2DTIA 3V8JA 1MMDA 3CCRT 1IZ6A 3QPHA 1W2BS 1GFDA 1I81A 4V2SA 2DRMA 5CR2A 1FWZA 3WXMB 3OYFA 4KULA 3SDZA 1JBMA 2SEMA 4BI8B 4DBHA 2Y4XA 1WHLA 1X27A 1BI2A 4A4GA 3JB9F 2GBQA 4HVWA 2JMAA 2QI2A 5GAMf 4PJOE 3THKA 3G4SA 2KXCA 2MCNA 4LD6A 2L3QA 4EMKB 4E7LA 3CCEQ 2E3IA 5KYYB 2OTLA 4M7DD 3MEVA 2Z0WA 2YLBA 3BDUA 2QTVA 3MEAA 2DX1A 4KH1B 3A8HB 5GAOq 1YJWQ 1EFNA 2DO3A 5KYNA 2DVJA 5LJ3g 2FYKA 5IH2A 1M90C 3CXCP 1OULA 1Y71A 2JNGA 2KT1A 1VQMA 2E70A 4JJBA 4OP0A 2XD0A 3JB9H 4MMKA 2CP2A 2FPFA 3I35A 3PVLA 4KGXB 1Z9QA 5GAOp 2F1LA 5FU6C 3PVQA 3GP8A 4NOYA 1MMGA 2KRSA 1XJWB 5GMKj 3CC4A 4LUDA 2NWMA 1QVPA 2EJ9A 4A4EA 3M0PA 5CVIA 3PIOA 2QQSA 2W10A 2ROLA 4LDYA 1WI7A 1K9MR 5ECAA 1VQOA 1QVGS 4XU3A 4FYXB 2HKNA 2RHXA 4C92D 3EAEA 1XQHA 3EFOA 4AFUC 2QEXT 4OMQA 4XQ3A 3OS1A 2KI7A 3JV3A 4OMFB 1H92A 2LNVA 2AKLA 3MP1A 3SD4A 3G4SQ 2DD5A 2DJZA 1Y96B 4GLKA 2F69A 1P92A 5GANd 1WJSA 2OTLQ 2DLPA 3M56A 3A8MB 4XK8E 2MIOA 1TUGB 5CKEA 1Y0MA 4BI3A 2SRCA 2EQUA 3H0IA 2KSSA 5FU7B 1G5VA 1MV3A 1QCNA 2RQTA 2K2VA 2D8HA 5L23A 4OB0B 4YTLA 2K5FA 4CI0C 2CKKA 3MPUB 3CCLT 2G3RA 4M75B 1UB4A 1KIKA 2COWA 2RNAA 5GAOn 5IHKA 2FB7A 1KD1R 2LMJA 4LE9A 1VQMQ 1H8KA 1UHCA 1BIBA 5IHNA 2YWWA 1ARKA 3RDVA 1Q86R 4IIOA 1WFWA 3I55T 1SHGA 5CAIA 1RACB 3CC4Q 2V1QA 1PKTA 4C5IA 2HL5C 1BI3A 1E6GA 2D9TA 3EGUA 4M7AG 2HZYA 5GAN6 1VQOQ 1UFFA 2CUDA 3HL8A 1VA7A 1VQPA 1U06A 2C06A 1G83A 1VOMA 1HYOA 2J6FA 4B9XA 5GANe 1AWXA 3FJ5A 1PD0A 1M8MA 4N0AC 2DEUA 4OB3B 1T0HA 3BE3A 1UUEA 4MMLA 4EDUA 4IURA 3ULRB 3QSUA 1CKBA 5HCKA 1VYTA 4JUVA 2LJ3A 1WHHA 2ED0A 1S72T 3M9QA 2YUNA 1AWWA 4EMGA 3EGDB 3JCMh 3X25B 5GJVB 2PUKB 2QQBA 3OYMA 1NYGA 1QVGA 5HY6A 1YITT 3C94A 4QQ6A 2QGGA 3CMAT 3CCSA 1KC8U 3OYDA 3JB9D 1VQ5T 2AIRB 2KAFA 1MMAA 1NEGA 4M78B 1OX8A 1M8VA 5IAYA 1O75A 4RCCA 4MZTA 5HK3A 2L2PA 4E47A 2DNUA 4JS5A 4AFZC 1B3QA 4LDXA 2DF6A 3S3MA 1QVFS 1WJRA 5KYXA 3L2VA 1K0XA 4QVDA 3NTIA 2XKOC 1VQLA 1WXBA 2K79A 4M7AA 2LNHB 5GANf 4C5GA 2JM8A 5LJ5h 3OYYA 4C5EA 2RF0A 4DEXA 2KXDA 1U3OA 2QK0A 2FZGB 4PFZA 1M90R 3NHNA 2LJ1A 2E6NA 5GMKm 3TQ7P 1D0YA 2DYBA 2OAUA 1ABOA 3RR6A 2CP0A 1X69A 4XTXA 3VS3A 4J7IA 4M77D 1M2VB 3JCMc 1UGVA 1NJIC 2K3BA 3OW2A 5GMKe 3M0QA 2LCSA 1Y07A 3JB9I 2GNCA 1K4US 1M1GA 1B07A 3OBWA 1BI0A 1BKBA 4CC4B 3CCSQ 2O4XB 3PMTA 2GFUA 4LXCA 2HD0A 3L2RA 1M30A 3CCET 2OTJA 4OMLA 4J7FA 3PGGA 4M78C 1NG2A 4MDXA 2XDPA 4MDWA 4PKCC 2DETA 4FL6A 3IQLA 1GRIA 1V76A 2P0KA 1WGSA 3EGXB 3S3NA 1QP2A 2JT4A 3PT9A 4OMPA 1K8AU 1OZ3A 2RJFA 1X6OA 2QXFA 4RG8A 4E6RA 3M55A 1YJWT 4PJOD 4HT8A 3JCMg 4FM4B 4PL6A 3X26B 2EQKA 3BY7A 1VQLQ 2LZ6B 4LUEA 3LLRA 1D1BA 2K57A 3TSWA 4IUQA 3SWNB 3LH0A 3OYJA 4RTWA 3TU4K 6AT1B 5D7UA 2MWPA 2RM4A 2V8IA 5A2QE 2JTMA 2VVKA 2KK4A 1W2BP 2BZXA 4M7DC 1VQ9A 2HAXA 2B86A 1KQSS 2NUTA 5KCOA 3REBB 2DAQA 4PFOA 2LDMA 2M9UA 2WSFE 1VQNA 1Q7YU 3L42A 1VQ8A 2YUOA 1YJ9A 1IREB 3RESA 4JZ4A 3OS2A 1AWJA 2M16A 2VC8A 2NYSA 1TSFA 1IGQA 1O9SA 2A28A 5LJ5g 1CSKA 4M7AE 3OYGA 5CK9A 1ZBJA 1OZ2A 4PLIA 1NPPA 3DB3A 1BIAA 5GAMd 1K9MC 4J9CA 1QKWA 3NPFA 4XTYA 2PTKA 3J7AF 4C8QF 1UG1A 2A08A 3UATA 1W70A 2YUQA 4O6JA 3TCJA 4C8QC 2EAYA 2YLCA 1FYNA 3URGA 5GAMg 2LCCA 2X3XD 4C92F 1I4K1 5KE3A 1SHFA 3NGPA 4C92C 4BE1A 2F2WA 1QCOA 3ZFJA 4EMKA 4Y28E 1YHQA 3RKYA 3X20B 5KYYA 1K0SA 2MMPA 2JS2A 2CP3A 1ACMB 2MI6A 3S6WA 3L2UA 3CC4T 1VQ9Q 1YI2A 2LP5A 3CCUA 5CKFA 1QVGP 4KGZB 2LQNA 1IXDA 1KC8R 4XAXB 1VQOT 2XK0A 3EG3A 3VJPA 1VQNQ 5GMKl 2CYZB 5I2MA 1JRIA 1X75C 2KYBA 3TVTA 2R57A 4A53A 1KD1C 2D6FA 1VQ8Q 1KK7A 8AT1B 1VIFA 2RHYA 3O5ZA 1YJ9Q 3VU3C 2EW3A 2ZPGB 1M4ZA 2LQ8A 2V8JA 4A4FA 4AFSC 5GAMe 2A7YA 3OS5A 3OYEA 3G6ET 1AVZC 2CT4A 1WA7A 2IVWA 4Z02A 4BD3A 3OSSC 1I07A 2CT3A 3VUZA 1AZEA 1RAGB 4C0DC 5CKHA 3TEEA 2RH2A 1ZA1B 2EYZA 3MEUA 3JRZA 3SEMA 4E7ZA 4KBMB 1KQSA 1TH7A 3C95A 2MAMA 4JJNK 2CH4W 5GAN5 2FHDA 2DFUA 1K73U 5IN1A 3RUXA 4WTOB 2YRVA 1SF9A 3M59A 3MKDA 1LVKA 4F14A 1B34B 3SFMA 2VWFA 2QDYB 1Y7XA 3CC2A 4F7UG 4L5GA 2DJQA 1Y96A 1YHQQ 3H0FA 2VUBA 1EIFA 1BI1A 5FU6B 2LC4A 5KYUB 2GTOA 4RCBA 3QYGB 2EKOA 3QHSA 2J6KA 1YI2Q 2BUDA 3CCUQ 1WQWA 2LJ0A 2EQMA 4B9WA 3CMEA 1YJNA 1VQPT 5GMKi 1MMNA 5GANh 1QLYA 4M75A 4M78G 4AG1C 1FX7A 4ZTJA 1FXXA 1K8AR 4J9EA 4FW1A 2RB6A 4JRPA 5GAN4 2E64A 1D3BB 1M3CA 3R6OA 2CGHA 2HNIA 4QQDA 1JQQA 2QTXA 2JN0A 2YHTA 4LNPA 3EG2A 2YSQA 3C4SA 3RMSA 2E12A 3JCMV 1TG0A 1I0CA 3VRYA 4CC3A 2YRCA 3I56A 2LRQA 1NM7A 3NMZC 2CH4A 2IIMA 4M7DG 2D0NA 2HBWA 2M0YA 4XTUA 4ZNXA 2FEIA 2FVUA 2RQVA 1XOVA 1UEBA 3MP8A 5D6WA 1Q7YR 3H8ZA 3CC2Q 5A0LA 1OU8A 3SB2A 4QKUA 4BDYA 1QVFP 3V8LA 2QQAA 3PIPA 1FMVA 2VASA 3HHTB 4M77F 2LQWA 4DA4A 3QIIA 1VQ4Q 4M77C 4C8QD 3EGDA 3CMEQ 1YJNQ 2DVEA 2X4XA 3OS0A 1KQ1A 2ZGWA 1SG5A 1T0JA 1GFCA 2R5AA 3PNWC 2BKDN 2E5QA 4FU6A 4M4ZA 1MHNA 1X6GA 1ZUUA 3LWHA 2VXEA 2KDSA 3JCMW 3KFVA 2MWOA 2KROA 2K2MA 3BFMA 4M78A 5FWBA 2IG0A 5J3BA 2DYIA 1TWBA 4Z89A 2RD1A 1D09B 2DL3A 1BK2A 2E4HA 5IHIA 4E7HA 2MK5A 4ZGDB 3ME9A 3G71A 2ESWA 4PJOF 1D0ZA 3EHRA 3E19A 4IUTA 5GANg 4PJOC
chains in the Genus database with same CATH topology
2JMCA 2J7IA 3M0RA 2HSPA 3REAB 2RQRA 1WIEA 1WXBA 2F2VA 1T3SA 2K79A 2LNHB 1N5ZA 3UA6A 2DM1A 2JM8A 2AZVA 2BZYA 2RF0A 4DEXA 2KXDA 1I1JA 3VS1A 1U3OA 4J9HA 1WDXA 1GBQA 3NHNA 2LJ1A 4J9BA 2C0IA 2DYBA 2BZ8A 2EGAA 1ABOA 3U23A 4GBQA 4JPBW 1X69A 3VS3A 3LH5A 1RUWA 1UGVA 1TUCA 4RUGA 2K3BA 2K6DA 3M0QA 2LCSA 1YWPA 1WXTA 2V1RA 2GNCA 1SSHA 2FG0A 3QWXX 2P4RA 1K4US 3VS2A 2KGTA 1QCFA 1B07A 1UJ0A 2EYWA 2EPDA 2H8HA 2RN8A 4CC4B 4AFQC 4OMOA 2EYXA 1M30A 1UECA 4OMLA 2ECZA 2GQIA 1JO8A 1JU5C 2L3PA 2MOXA 1NG2A 1Y57A 3ZL7C 4R0KA 3VS0A 2DILA 1JXOA 2CUBA 2BTTA 1BU1A 3IQLA 1GRIA 3RBBB 2VKNA 1BB9A 4J9FA 2JT4A 4Y92A 4OMPA 2HEQA 4RTUA 2KT8A 4E6RA 4ORZA 2FPDA 5IXFA 3CQTA 3UF4A 2DL7A 1GBRA 1LCKA 3I5SA 1GCPA 1WYXA 1ZUKA 1YNZA 2QDLA 1PRMC 3C0CA 2LZ6B 3PE0A 4LUEA 4RTVA 1QKXA 3VS5A 1A0NB 3TSWA 4RTXA 5FW9A 5FWCA 4X1VA 1MUZA 4RTWA 4J9GA 2JTEA 1W6XA 3QWYA 4GLMA 2A36A 4LN2A 4D8KA 2KBTA 4EIKA 1OPLA 1YWOA 2ENMA 4J9IA 2VVKA 1PHTA 2J05A 1AOJA 2BZXA 2AZSA 1GCQC 1QWEA 2B86A 2CSIA 3REBB 1YP5A 2EQIA 2X3WD 2HCKA 1TUDA 2LX7A 2RMOA 1ZX6A 1WX6A 1WXUA 2J06A 1MV0B 2YUOA 2K7AA 4JZ4A 1M27C 1PKSA 2ED1A 1AWJA 1ZUYA 2A28A 1CSKA 5I11A 2M51A 1ZBJA 1ZSGA 4QT7A 1M3AA 3M0UA 1U5SA 1UDLA 1M3BA 4HVUA 1PNJA 5IXBA 4J9CA 1YCSB 1QKWA 3NPFA 1ABQA 2GTJA 2PTKA 1UG1A 2A08A 1GCQA 1UTIA 2DMOA 1W70A 2OJ2A 2YUQA 3UATA 4DEYA 1GFDA 2K9GA 2DRMA 1FYNA 2X3XD 1KSWA 2SEMA 2OAWA 1K1ZA 1SHFA 3NGPA 1X27A 2GBQA 4HVWA 2DA9A 2JMAA 2F2WA 2KE9A 1H3HA 3THKA 2KYMA 1OOTA 2KXCA 2MCNA 2CDTA 2L3QA 3I5RA 3I9QA 4HVVA 2XMFA 2DL8A 4K11A 1K0SA 4CC7A 2JS2A 1PRLC 2C0TA 2J6OA 3VS6A 4J9DA 2LP5A 5I22A 2LQNA 1OPKA 2DX1A 3VS7A 3VS4A 1IO6A 2PZ1A 2EVRA 3EG3A 2KYBA 3TVTA 1EFNA 1W1FA 1T3LA 2DVJA 3O5ZA 4IIMA 1BBZA 2EW3A 5IH2A 1J3TA 1KFZA 2O2OA 1HD3A 1JXMA 2KT1A 4JJBA 4AFSC 1HJDA 2FPFA 3I35A 2NUZA 3PVLA 2FO0A 1Z9QA 1AVZC 2CT4A 1WA7A 3PVQA 2KR3A 1NEBA 2DBMA 2JM9A 2KRSA 1I07A 2CT3A 1JEGA 4RTZA 4OMMA 1AZEA 1E7OA 3UA7A 4LUDA 2NWMA 2DBKA 4FSSA 3M0PA 4ESRA 2I0NA 2EYZA 3RNJA 2W10A 3R6NA 2A37A 2ROLA 3SEMA 1WI7A 1Z9ZA 5ECAA 1AEYA 2CH4W 4CC2A 2YT6A 4HXJA 2KRMA 3EHQA 4AFUC 4OMQA 2EGCA 2JS0A 2O31A 4F14A 3M0TA 4D8DA 3M0SA 3JV3A 1H92A 1X6BA 2AKLA 2VWFA 1UJYA 2DJQA 2FPEA 3H0FA 2CREA 1WLPB 1CKAA 1SRMA 4KRTA 2C0OA 2G6FX 3EG1A 2DLPA 1HSQA 1RI9A 2GTOA 2MIOA 2FRWA 1RLPC 1Y0MA 2J6KA 5EC7A 2SRCA 2KNBB 1FMKA 3H0IA 1UE9A 1OEBA 1MV3A 2RQTA 2D8HA 2LJ0A 3VRZA 2L0AA 5L23A 2D8JA 2DRKA 4RTYA 2JXBA 1QLYA 2YUPA 1KIKA 4HCKA 1AWOA 2RNAA 4AG1C 1SPKA 5IHKA 3H41A 4Z8AA 2JW4A 2LMJA 4LE9A 2EKHA 1H8KA 4J9EA 1UHCA 2EGEA 4A63B 5IHNA 1ARKA 1SEMA 4IIOA 1M3CA 1WFWA 2W0ZA 1SHGA 1AD5A 2KRNA 4JJCA 1V1CA 2DE0X 1JQQA 2AKKA 4LNPA 2V1QA 1PKTA 1NLOC 2YSQA 3EG2A 1E6GA 3EGUA 2PNIA 2DL4A 1TG0A 1I0CA 3VRYA 1UFFA 2CUDA 3EG0A 2O9VA 1VA7A 4CC3A 1U06A 1G83A 2YDLA 2J6FA 2KEAA 1AWXA 2HDAA 3FJ5A 1M8MA 1NM7A 3NMZC 2CH4A 2F2XA 2IIMA 3H0HA 1G2BA 2D0NA 1T0HA 2HBWA 2M0YA 4ZNXA 1UUEA 2FEIA 2OI3A 2O9SA 4RTTA 2RQVA 2RQUA 1XOVA 1GL5A 3ULRB 4JZ3A 1X43A 2O88A 1CKBA 5HCKA 1VYTA 2RPNA 1VYVA 5GJWB 4F16A 4OMNA 2EYYA 2LJ3A 1K9AA 2GGRA 2ED0A 1S1NA 2YUNA 1AWWA 1SRLA 2LQWA 3SHWA 5GJVB 1X2QA 4F17A 4JJDA 1NYGA 1PWTA 1GFCA 1T0JA 3GBQA 2D1XA 2ROTA 4M4ZA 1ZLMA 1X6GA 1ZUUA 2RQWA 4AG2C 4WCIA 1RLQC 2CSQA 2AK5A 2ABLA 1OV3A 3KFVA 4Z88A 1NYFA 1NLPC 1X2KA 2KROA 2L3SA 2K2MA 1NEGA 2EBPA 5FWBA 2DL5A 1KJWA 2FRYA 2L2PA 2DNUA 1VYUA 4AFZC 1B3QA 1UHFA 2E5KA 4Z89A 1QWFA 3TSZA 1K76A 1YN8A 2DL3A 3A98A 1BK2A 2DF6A 5IHIA 1E6HA 1AZGB 2ESWA 3EHRA 1K0XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JMC A;  2J7I A;  3M0R A;  2HSP A;  3REA B;  2RQR A;  1WIE A;  1WXB A;  2F2V A;  1T3S A;  2K79 A;  2LNH B;  1N5Z A;  3UA6 A;  2DM1 A;  2JM8 A;  2AZV A;  2BZY A;  2RF0 A;  4DEX A;  2KXD A;  1I1J A;  3VS1 A;  1U3O A;  4J9H A;  1WDX A;  1GBQ A;  3NHN A;  2LJ1 A;  4J9B A;  2C0I A;  2DYB A;  2BZ8 A;  2EGA A;  1ABO A;  3U23 A;  4GBQ A;  4JPB W;  1X69 A;  3VS3 A;  3LH5 A;  1RUW A;  1UGV A;  1TUC A;  4RUG A;  2K3B A;  2K6D A;  3M0Q A;  2LCS A;  1YWP A;  1WXT A;  2V1R A;  2GNC A;  1SSH A;  2FG0 A;  3QWX X;  2P4R A;  1K4U S;  3VS2 A;  2KGT A;  1QCF A;  1B07 A;  1UJ0 A;  2EYW A;  2EPD A;  2H8H A;  2RN8 A;  4CC4 B;  4AFQ C;  4OMO A;  2EYX A;  1M30 A;  1UEC A;  4OML A;  2ECZ A;  2GQI A;  1JO8 A;  1JU5 C;  2L3P A;  2MOX A;  1NG2 A;  1Y57 A;  3ZL7 C;  4R0K A;  3VS0 A;  2DIL A;  1JXO A;  2CUB A;  2BTT A;  1BU1 A;  3IQL A;  1GRI A;  3RBB B;  2VKN A;  1BB9 A;  4J9F A;  2JT4 A;  4Y92 A;  4OMP A;  2HEQ A;  4RTU A;  2KT8 A;  4E6R A;  4ORZ A;  2FPD A;  5IXF A;  3CQT A;  3UF4 A;  2DL7 A;  1GBR A;  1LCK A;  3I5S A;  1GCP A;  1WYX A;  1ZUK A;  1YNZ A;  2QDL A;  1PRM C;  3C0C A;  2LZ6 B;  3PE0 A;  4LUE A;  4RTV A;  1QKX A;  3VS5 A;  1A0N B;  3TSW A;  4RTX A;  5FW9 A;  5FWC A;  4X1V A;  1MUZ A;  4RTW A;  4J9G A;  2JTE A;  1W6X A;  3QWY A;  4GLM A;  2A36 A;  4LN2 A;  4D8K A;  2KBT A;  4EIK A;  1OPL A;  1YWO A;  2ENM A;  4J9I A;  2VVK A;  1PHT A;  2J05 A;  1AOJ A;  2BZX A;  2AZS A;  1GCQ C;  1QWE A;  2B86 A;  2CSI A;  3REB B;  1YP5 A;  2EQI A;  2X3W D;  2HCK A;  1TUD A;  2LX7 A;  2RMO A;  1ZX6 A;  1WX6 A;  1WXU A;  2J06 A;  1MV0 B;  2YUO A;  2K7A A;  4JZ4 A;  1M27 C;  1PKS A;  2ED1 A;  1AWJ A;  1ZUY A;  2A28 A;  1CSK A;  5I11 A;  2M51 A;  1ZBJ A;  1ZSG A;  4QT7 A;  1M3A A;  3M0U A;  1U5S A;  1UDL A;  1M3B A;  4HVU A;  1PNJ A;  5IXB A;  4J9C A;  1YCS B;  1QKW A;  3NPF A;  1ABQ A;  2GTJ A;  2PTK A;  1UG1 A;  2A08 A;  1GCQ A;  1UTI A;  2DMO A;  1W70 A;  2OJ2 A;  2YUQ A;  3UAT A;  4DEY A;  1GFD A;  2K9G A;  2DRM A;  1FYN A;  2X3X D;  1KSW A;  2SEM A;  2OAW A;  1K1Z A;  1SHF A;  3NGP A;  1X27 A;  2GBQ A;  4HVW A;  2DA9 A;  2JMA A;  2F2W A;  2KE9 A;  1H3H A;  3THK A;  2KYM A;  1OOT A;  2KXC A;  2MCN A;  2CDT A;  2L3Q A;  3I5R A;  3I9Q A;  4HVV A;  2XMF A;  2DL8 A;  4K11 A;  1K0S A;  4CC7 A;  2JS2 A;  1PRL C;  2C0T A;  2J6O A;  3VS6 A;  4J9D A;  2LP5 A;  5I22 A;  2LQN A;  1OPK A;  2DX1 A;  3VS7 A;  3VS4 A;  1IO6 A;  2PZ1 A;  2EVR A;  3EG3 A;  2KYB A;  3TVT A;  1EFN A;  1W1F A;  1T3L A;  2DVJ A;  3O5Z A;  4IIM A;  1BBZ A;  2EW3 A;  5IH2 A;  1J3T A;  1KFZ A;  2O2O A;  1HD3 A;  1JXM A;  2KT1 A;  4JJB A;  4AFS C;  1HJD A;  2FPF A;  3I35 A;  2NUZ A;  3PVL A;  2FO0 A;  1Z9Q A;  1AVZ C;  2CT4 A;  1WA7 A;  3PVQ A;  2KR3 A;  1NEB A;  2DBM A;  2JM9 A;  2KRS A;  1I07 A;  2CT3 A;  1JEG A;  4RTZ A;  4OMM A;  1AZE A;  1E7O A;  3UA7 A;  4LUD A;  2NWM A;  2DBK A;  4FSS A;  3M0P A;  4ESR A;  2I0N A;  2EYZ A;  3RNJ A;  2W10 A;  3R6N A;  2A37 A;  2ROL A;  3SEM A;  1WI7 A;  1Z9Z A;  5ECA A;  1AEY A;  2CH4 W;  4CC2 A;  2YT6 A;  4HXJ A;  2KRM A;  3EHQ A;  4AFU C;  4OMQ A;  2EGC A;  2JS0 A;  2O31 A;  4F14 A;  3M0T A;  4D8D A;  3M0S A;  3JV3 A;  1H92 A;  1X6B A;  2AKL A;  2VWF A;  1UJY A;  2DJQ A;  2FPE A;  3H0F A;  2CRE A;  1WLP B;  1CKA A;  1SRM A;  4KRT A;  2C0O A;  2G6F X;  3EG1 A;  2DLP A;  1HSQ A;  1RI9 A;  2GTO A;  2MIO A;  2FRW A;  1RLP C;  1Y0M A;  2J6K A;  5EC7 A;  2SRC A;  2KNB B;  1FMK A;  3H0I A;  1UE9 A;  1OEB A;  1MV3 A;  2RQT A;  2D8H A;  2LJ0 A;  3VRZ A;  2L0A A;  5L23 A;  2D8J A;  2DRK A;  4RTY A;  2JXB A;  1QLY A;  2YUP A;  1KIK A;  4HCK A;  1AWO A;  2RNA A;  4AG1 C;  1SPK A;  5IHK A;  3H41 A;  4Z8A A;  2JW4 A;  2LMJ A;  4LE9 A;  2EKH A;  1H8K A;  4J9E A;  1UHC A;  2EGE A;  4A63 B;  5IHN A;  1ARK A;  1SEM A;  4IIO A;  1M3C A;  1WFW A;  2W0Z A;  1SHG A;  1AD5 A;  2KRN A;  4JJC A;  1V1C A;  2DE0 X;  1JQQ A;  2AKK A;  4LNP A;  2V1Q A;  1PKT A;  1NLO C;  2YSQ A;  3EG2 A;  1E6G A;  3EGU A;  2PNI A;  2DL4 A;  1TG0 A;  1I0C A;  3VRY A;  1UFF A;  2CUD A;  3EG0 A;  2O9V A;  1VA7 A;  4CC3 A;  1U06 A;  1G83 A;  2YDL A;  2J6F A;  2KEA A;  1AWX A;  2HDA A;  3FJ5 A;  1M8M A;  1NM7 A;  3NMZ C;  2CH4 A;  2F2X A;  2IIM A;  3H0H A;  1G2B A;  2D0N A;  1T0H A;  2HBW A;  2M0Y A;  4ZNX A;  1UUE A;  2FEI A;  2OI3 A;  2O9S A;  4RTT A;  2RQV A;  2RQU A;  1XOV A;  1GL5 A;  3ULR B;  4JZ3 A;  1X43 A;  2O88 A;  1CKB A;  5HCK A;  1VYT A;  2RPN A;  1VYV A;  5GJW B;  4F16 A;  4OMN A;  2EYY A;  2LJ3 A;  1K9A A;  2GGR A;  2ED0 A;  1S1N A;  2YUN A;  1AWW A;  1SRL A;  2LQW A;  3SHW A;  5GJV B;  1X2Q A;  4F17 A;  4JJD A;  1NYG A;  1PWT A;  1GFC A;  1T0J A;  3GBQ A;  2D1X A;  2ROT A;  4M4Z A;  1ZLM A;  1X6G A;  1ZUU A;  2RQW A;  4AG2 C;  4WCI A;  1RLQ C;  2CSQ A;  2AK5 A;  2ABL A;  1OV3 A;  3KFV A;  4Z88 A;  1NYF A;  1NLP C;  1X2K A;  2KRO A;  2L3S A;  2K2M A;  1NEG A;  2EBP A;  5FWB A;  2DL5 A;  1KJW A;  2FRY A;  2L2P A;  2DNU A;  1VYU A;  4AFZ C;  1B3Q A;  1UHF A;  2E5K A;  4Z89 A;  1QWF A;  3TSZ A;  1K76 A;  1YN8 A;  2DL3 A;  3A98 A;  1BK2 A;  2DF6 A;  5IHI A;  1E6H A;  1AZG B;  2ESW A;  3EHR A;  1K0X A; 
#chains in the Genus database with same CATH topology
 1OU9 A;  2JMC A;  2J7I A;  5HKC A;  3I56 Q;  5AT1 B;  4KUD K;  1WIE A;  1T3S A;  2E3H A;  4M75 E;  2OTJ T;  1EX4 A;  3CCV A;  2AZV A;  3M5A A;  1M1K U;  3H9N A;  2X4J A;  1HK9 A;  1NZ9 A;  4KH0 B;  1BCO A;  1GBQ A;  1R77 A;  4J9B A;  1SKU B;  2C0I A;  2FL7 A;  4M7D A;  1MGQ A;  2EGA A;  1NE8 A;  3LH5 A;  1RUW A;  3OA6 A;  1M2V A;  1TUC A;  5GAN 2;  4JLG A;  4RUG A;  3HSB A;  2K6D A;  2CS7 A;  1UGQ B;  4FYW B;  3OW2 S;  1Q95 G;  2P4R A;  1QCF A;  5J39 A;  3HTR A;  2XIC A;  2EYW A;  2H8H A;  2RN8 A;  2JTF A;  2O4X A;  4FSX A;  2XU8 A;  1UEC A;  1JB0 E;  2GQI A;  1AT1 B;  1K73 R;  4R0K A;  3RKX A;  1C6V X;  3E2U A;  1VQ9 T;  2RHU A;  3RBB B;  2Y90 A;  4BY6 C;  2VKN A;  4J9F A;  3OSV A;  3UWN A;  3EGX A;  4Y92 A;  3NTK A;  2HEQ A;  5GAO m;  4RTU A;  3VKI A;  1VQN T;  3G71 Q;  1ZA2 B;  3QO3 A;  1GBR A;  3UF4 A;  1VQ8 T;  2D0Q B;  2F5K A;  4C5H A;  3I5S A;  4DOV A;  4F7U B;  1YJ9 T;  1GCP A;  3UT1 A;  1ZUK A;  4AT1 B;  2QDL A;  1QKX A;  3CCQ T;  5LJ3 f;  3HRU A;  3KUF A;  5FWC A;  3SWN A;  3X28 B;  1MUZ A;  4J9G A;  3CCV Q;  2VV5 A;  2VB6 A;  4GLM A;  2A36 A;  3MEW A;  3WVE B;  1PCX A;  3EG9 B;  4EIK A;  2BIV A;  2ZPB B;  1KC8 C;  4LD9 K;  1PHT A;  2X9H A;  4M78 E;  1C1A A;  1RAD B;  4OB2 B;  1VQ7 Q;  1U1T A;  1YP5 A;  2QA4 A;  3HRT A;  2RMO A;  3MP6 A;  4J5Y A;  1WXU A;  5EG2 A;  2GQV A;  3JCM b;  2J06 A;  4X9C A;  2KQW A;  2P84 A;  3JB9 G;  4ME7 A;  3HFO A;  2K7A A;  2X51 A;  1MND A;  2ED1 A;  3CEY A;  1ZUY A;  4HCZ A;  1YHQ T;  2M51 A;  5IT9 E;  3UDC A;  3LW5 E;  3P8B B;  4QT7 A;  1I5L A;  3JCM Q;  4DBF A;  1PNJ A;  3CCR Q;  2R5M A;  2JVV A;  3CCU T;  1YCS B;  1ABQ A;  3MHX A;  4M7D B;  4DEY A;  1GCQ A;  2KVQ G;  5A0G A;  1TU0 B;  1BCM A;  1KSW A;  1K1Z A;  2ZZD A;  4J6W A;  1UGR B;  1OI1 A;  5GAM h;  1U1S A;  2ZPF B;  1WHG A;  2DA9 A;  1KQ2 A;  2KE9 A;  1H3H A;  3FIF A;  2B8A A;  4NS5 A;  4BDZ A;  1M2O A;  1OOT A;  1PSF A;  3I5R A;  4HVV A;  1NJI U;  2DL8 A;  4CC7 A;  2JJ9 A;  3N5B B;  2C0T A;  4O5V A;  3VS6 A;  1RAB B;  1FMW A;  4PK4 A;  1R0C B;  4B6M A;  5I22 A;  3FRN A;  2EIF A;  3VS7 A;  2HQX A;  3VS4 A;  1IO6 A;  1YIJ A;  3J80 E;  2PZ1 A;  2QA4 Q;  2EVR A;  3GNF B;  2PQW A;  4C8Q B;  5GAN 7;  1W1F A;  1K8A C;  1BBZ A;  3FB9 A;  5GAN 3;  1J3T A;  4PJL A;  2NLU A;  1HD3 A;  4C92 B;  4JS4 A;  3QXE B;  2RI5 A;  1LPL A;  4ATO A;  4CRI A;  3CC2 T;  2FO0 A;  2DKG A;  2LCL A;  2KR3 A;  2VXF A;  4IUP A;  2JM9 A;  3CCJ A;  3NTH A;  1F1B B;  3M4G A;  4RTZ A;  4OMM A;  1E7O A;  1WNL A;  2K5I A;  2DBK A;  4II1 A;  4C0G A;  4FSS A;  4ESR A;  2I0N A;  3RNJ A;  2A37 A;  1EZZ B;  1M1K R;  1YJN T;  1JJ2 S;  3FLG A;  1TS9 A;  4CC2 A;  3RMQ A;  3EHQ A;  5M9O A;  4FYY B;  4OB1 B;  4XTW A;  2EGC A;  5GAO l;  4ANJ A;  2O31 A;  1Q7Y C;  3M0T A;  1KG1 A;  1IB8 A;  1M1F A;  2L8D A;  1B34 A;  1X6B A;  2GFA A;  4IKF A;  1UJY A;  3OMC A;  4NL2 A;  1WJQ A;  2WSE E;  3A1P A;  3G4S T;  4DQ2 A;  2CRE A;  1CKA A;  1G3W A;  1SRM A;  4KRT A;  2C0O A;  3ASK A;  3FC3 A;  1RI9 A;  3E9G A;  2OTL T;  5KYU A;  4C0F A;  3V7C A;  1OQK A;  5EC7 A;  4E7I A;  1VQ6 A;  1FMK A;  2E6Z A;  1ZSZ B;  4C0D B;  3VRZ A;  5KYW A;  2DK3 A;  1YIJ Q;  2D8J A;  4HA8 A;  4RTY A;  2AT1 B;  3I56 T;  2JXB A;  4MZM A;  2K3Y A;  2P0P A;  4ZGE B;  1Q81 U;  4BUG A;  4HCK A;  2CZ0 B;  4OGE A;  1SPK A;  9ATC B;  2JW4 A;  1WHM A;  2MF2 A;  1K9M U;  2EKH A;  4A63 B;  1VQM T;  3OYC A;  2DXC A;  3DLM A;  2RJD A;  1SEM A;  3JAM E;  1D3B A;  2W0Z A;  1TXQ A;  2LQK A;  1AD5 A;  3QG1 A;  2KRN A;  3CCJ Q;  1QP3 A;  2LTO A;  3HFN A;  1BYM A;  4M75 D;  1G3S A;  1QMC A;  2KY9 A;  3T9N A;  5LJ3 j;  3L2Z A;  3LX7 A;  1GXI E;  2O9V A;  3CD6 A;  1C0M A;  2CP6 A;  2YDL A;  2KEA A;  5CIU A;  5CQX A;  2F2X A;  2PU9 B;  3X24 B;  5J26 A;  2O9S A;  4RTT A;  1N8R U;  4OF1 A;  3ZEH A;  1KHI A;  3BDL A;  4JZ3 A;  1X43 A;  4ELZ C;  2O88 A;  3Q1J A;  2RPN A;  2ZAE A;  1VYV A;  1KD1 U;  3H6Z A;  2FZK B;  1S72 Q;  2DD4 A;  2DTH A;  1Q86 U;  1VQ6 Q;  3G71 T;  1ZSZ C;  3MJX A;  1QW1 A;  2K3X A;  4F17 A;  5I21 A;  4M7A F;  2DZC A;  3D7S B;  1JJ2 A;  4A54 A;  3GBQ A;  4FT2 A;  4F04 B;  2ATC B;  2D1X A;  3FDR A;  3JCM J;  2CZ7 B;  3OB9 A;  4WCI A;  2RHZ A;  2EJG A;  2E10 A;  1K73 C;  3CCV T;  1RLQ C;  4N0A A;  3GNG A;  1NPR A;  1NLP C;  5DY9 A;  2EBP A;  2DL5 A;  3RIR A;  1ZHI A;  4D6W A;  1VYU A;  3QDF A;  1UHF A;  2E5K A;  3CC7 A;  1QWF A;  3OYI A;  1LJO A;  3S3O A;  7AT1 B;  3J81 E;  1I8F A;  2X35 A;  1E6H A;  4DBR A;  3OW2 P;  1DJ7 B;  5KE2 A;  2EWN A;  3P8H A;  1IGU A;  3DB4 A;  5KYW B;  1VIE A;  3CD6 Q;  2HKQ B;  2YXY A;  4M77 B;  2HSP A;  4KT0 E;  1VQ4 A;  4J6X A;  3REA B;  1RI0 A;  1QQJ A;  1RAA B;  2OX7 A;  2RJE A;  2F2V A;  1Q82 U;  4DBQ A;  1PM3 A;  1N5Z A;  3AT1 B;  3GF5 A;  2DER A;  3M57 A;  3L2Q A;  1G8X A;  2ZPH B;  1I1J A;  1VQK A;  2K4Y A;  5LJ5 f;  1YCY A;  1RAH B;  4OVA A;  4XU2 A;  2EJF A;  4PJM A;  2BZ8 A;  3O8V A;  4GBQ A;  2LVM A;  3RER A;  3HRS A;  4N4H A;  3QDR B;  2QQ9 A;  3A8O B;  1WXT A;  3OYB A;  4PJO B;  1UJ0 A;  4FCY A;  1R0B G;  4OMO A;  3CPW S;  2EYX A;  3CCS T;  2ECZ A;  1JO8 A;  1JU5 C;  2L3P A;  3CCM A;  3FEO A;  3CBP A;  1N9R A;  3ZL7 C;  3VS0 A;  2DIL A;  2BTT A;  5LJ3 d;  2CP7 A;  3OYK A;  5CKB A;  3CC7 Q;  2DZ9 A;  3VV0 A;  2X4Y A;  1OYX A;  2QA4 T;  2XI9 A;  4ORZ A;  1M90 U;  2FPD A;  3G1J A;  2JOY A;  3CQT A;  4Y91 A;  4J6Y A;  4OGC A;  1WHK A;  3V7R A;  3OBY A;  5CCA A;  4F7U A;  2RI3 A;  4WF2 A;  1YNZ A;  1XNI A;  1PRM C;  2NUP B;  3C0C A;  1VQL T;  4QVZ A;  3V7S A;  2WAC A;  4RTX A;  5FW9 A;  5DLQ E;  2LX9 A;  4X1V A;  4JRQ A;  4DOW A;  1G3T A;  2JTE A;  2DEQ A;  4N4G A;  1VQK Q;  2COY A;  4LN2 A;  2RA2 A;  1ZBX A;  1Q81 R;  3EG9 A;  3EH1 A;  2P4T A;  2ENM A;  1YWO A;  4J9I A;  4C8Q G;  4XTZ A;  2V26 A;  2J05 A;  1AOJ A;  2PUO B;  1KHC A;  1UGS B;  2AZS A;  4LDU A;  2PVG B;  3V8K A;  4BY6 B;  4UC4 A;  2L89 A;  4C92 G;  2EQI A;  2X3W D;  2A3L A;  2HCK A;  4KUI A;  2LX7 A;  4JRI A;  1PSE A;  1RL2 A;  1W4S A;  5GMK h;  1MV0 B;  3EFS A;  3JB9 J;  2CZ1 B;  1VUB A;  1PKS A;  5LJ3 e;  4EMK C;  4XU1 A;  4QVC A;  3G6E A;  3M54 A;  4EPC A;  5I11 A;  4RG2 A;  1XTD A;  1ZSG A;  4Q5W A;  3CCM Q;  1M3A A;  4PLL A;  3MET A;  4XTV A;  3QYH B;  1M1K C;  2ZPE B;  3E1S A;  3HPW A;  4L6V 5;  2GTJ A;  1W2B A;  3L2W A;  3G7Z A;  4ZN1 A;  2DMO A;  1UTI A;  1YIJ T;  2OJ2 A;  1N8R R;  2XID A;  1X01 A;  2K9G A;  2QGF B;  1VQ7 A;  3GOX A;  4LDW A;  1LOJ A;  3MCA B;  5LL6 S;  1IHW A;  2OAW A;  4HCB A;  3OMG A;  2WSC E;  1WQ7 A;  1IRX A;  2LT4 A;  4M7A D;  1AHJ B;  1NBE B;  2HQH A;  2RK1 A;  2E1H A;  2Y4Y A;  4E7J A;  3LGL A;  3P8D A;  1PD1 A;  2BE7 D;  2KYM A;  3LGF A;  2CDT A;  3I9Q A;  4IUV A;  1YFN A;  3CPW A;  3A5Z B;  2XMF A;  4K11 A;  2L5Q A;  3CCJ T;  5GAO r;  2VGM A;  1PRL C;  3A8G B;  3ZBD A;  2J6O A;  4J9D A;  3HP9 A;  1JJ2 P;  1OPK A;  1KQS P;  4J8O A;  3CCR A;  4FIB A;  1WHJ A;  2M1H A;  4N4I A;  2QAS A;  2E41 A;  3BW1 A;  2H3J A;  2IPO B;  4C8Q A;  2PVD B;  5FLX E;  4ZN3 A;  1RAE B;  1T3L A;  2QYZ A;  4IIM A;  2DIG A;  1KFZ A;  4R56 A;  2O2O A;  4F7U E;  1JXM A;  4C92 A;  1HJD A;  3G6E Q;  5CQY A;  2NUZ A;  2EFI A;  2A0F B;  3AHU A;  1NEB A;  2DBM A;  1WPY A;  2AHJ B;  1JEG A;  2GCX A;  5FU7 C;  1Q82 R;  1VQ6 T;  3UA7 A;  4ZGJ B;  5KCH A;  1IHV A;  4PNO A;  2HL3 A;  4M75 F;  3R6N A;  1Z9Z A;  2XDD A;  2CP5 A;  4M75 C;  1AEY A;  3LYI A;  4BI4 A;  2YT6 A;  3PFS A;  4HXJ A;  2LT1 A;  2KRM A;  3EFO B;  1ZQ1 A;  3CBO A;  2JS0 A;  5LJ5 j;  1D0X A;  1YBY A;  3QZ5 B;  4D8D A;  3M0S A;  2X4W A;  3VYG A;  3CXC S;  1WZO A;  3GIB A;  2DXU A;  2FPE A;  1WLP B;  4JRK A;  2GF7 A;  2G6F X;  3EG1 A;  4C0Z A;  1HSQ A;  4NL3 A;  3MO8 A;  2FRW A;  1RLP C;  2HSE B;  2VGN A;  2KNB B;  5GAM j;  5L8R E;  4FT4 A;  1UE9 A;  3OYH A;  1ZSZ A;  1OEB A;  1YI2 T;  5KH6 A;  1VQP Q;  2L0A A;  2ZCF B;  2DRK A;  4FYV B;  3CD6 T;  4M7D E;  2QAZ A;  1LNX A;  2DPP B;  2YUP A;  1D1C A;  2QQR A;  5DLO A;  2DIQ A;  1AWO A;  2QEX A;  3H41 A;  4Z8A A;  3EH2 A;  1M5Q 1;  4MZP A;  2EGE A;  4HT9 A;  2E65 A;  4BE2 A;  3M58 A;  1TTH B;  4JJC A;  1V1C A;  2EYQ A;  4F7U F;  4FW2 A;  3FJP A;  5CKD A;  2CZ6 B;  2DE0 X;  4M77 G;  2AKK A;  3OQ5 A;  1NLO C;  4A4K A;  5CO7 A;  2XG8 D;  2RJC A;  2PNI A;  2DL4 A;  2QG9 B;  4E7K A;  4X9D A;  3EG0 A;  3QJY A;  1N9S A;  3CCL A;  2HDA A;  5D6X A;  4BB7 A;  4C8Q E;  1B7T A;  3H0H A;  4M78 F;  1G2B A;  2DXT A;  1N6A A;  2OI3 A;  4AMC A;  2RQU A;  1GL5 A;  4C92 E;  2L3R A;  3JCM d;  3PTA A;  4L59 A;  3I55 A;  3PMI A;  1RAF B;  4P5N A;  3CC7 T;  3GLX A;  5GJW B;  2R58 A;  5FRO A;  3DKM A;  4F16 A;  4OMN A;  1R8O B;  1PG5 B;  4PJO G;  2EYY A;  1K9A A;  2GGR A;  1S1N A;  1SRL A;  3SHW A;  5FRN A;  5GAN 8;  1X2Q A;  3OYA A;  1VQ4 T;  4JJD A;  1PWT A;  3CME T;  5HK0 A;  2VYT A;  2JUF A;  4E7S A;  2ROT A;  2QEX Q;  3JCM X;  1ZLM A;  4AG2 C;  2RQW A;  4XU0 A;  4KGV B;  3HKS A;  3QUI A;  2F5T X;  3F70 A;  2CSQ A;  2XHC A;  2AK5 A;  2ABL A;  1OV3 A;  4Z88 A;  4M7D F;  1NYF A;  1VQK T;  5DM7 R;  1X2K A;  3CXC A;  2L3S A;  1KJW A;  3VUB A;  2FRY A;  3OYL A;  5AYF A;  5C6S A;  3TSZ A;  1K76 A;  1YN8 A;  3A98 A;  3M53 A;  2BE9 B;  4ZTF A;  1QVF A;  1S72 A;  1AZG B;  2FZC B;  5LJ5 d;  1V29 B;  5KYX B;  4TVR A;  3M0R A;  4LDV A;  4VUB A;  3JCM e;  4M77 A;  3KBG A;  3CCL Q;  3CCQ A;  2I2L A;  2RQR A;  4E2F B;  3CPW P;  4M7A B;  1YIT A;  2OTJ Q;  4JLI A;  3CMA A;  4QW2 A;  3UA6 A;  3DLL A;  2DM1 A;  1Q81 C;  1H64 1;  2HBP A;  2BZY A;  1MNE A;  1VQ5 A;  3CCM T;  3JCM P;  4RMO A;  3VS1 A;  4J9H A;  1WDX A;  3I55 Q;  3RKW A;  1M9S A;  3U23 A;  4JPB W;  2P0Q A;  2KMT A;  2EQJ A;  4ELY C;  3WVD B;  4R55 A;  1H3Z A;  1PC0 A;  1YWP A;  2COZ A;  2V1R A;  1SSH A;  2FG0 A;  3QWX X;  3QBY A;  3VS2 A;  2KGT A;  4PJO A;  3SWN C;  2MYS A;  3JSC A;  3TRE A;  2HMA A;  1N27 A;  2EPD A;  3E9F A;  4X34 A;  4AFQ C;  5C0M A;  5D6Y A;  1I5O B;  2MOX A;  2DXB A;  4M75 G;  1RAI B;  5I2S A;  1OX9 A;  5LJ5 e;  2M02 A;  1Y57 A;  5FRM A;  1JXO A;  2CUB A;  1BU1 A;  1N8R C;  2V8K A;  1BB9 A;  4JDS A;  4BAC A;  2KT8 A;  2ZPI B;  2RI2 A;  5IXF A;  2DL7 A;  1TOV A;  2RO0 A;  4QQG A;  1LCK A;  4IUU A;  3QZ9 B;  1Q86 C;  1WYX A;  5LJ3 h;  3CCQ Q;  2NUP A;  2RHI A;  3PE0 A;  4RTV A;  3VS5 A;  3JCM f;  1A0N B;  4M7A C;  3CBM A;  1YIT Q;  3CMA Q;  3C12 A;  3QJ6 A;  4RKU E;  1D1A A;  3INZ A;  3CCE A;  1VQ5 Q;  1W6X A;  3ER0 A;  3QWY A;  3VYH B;  4D8K A;  2KBT A;  2K5L A;  1OPL A;  4A4H A;  3GPL A;  3M4Y A;  5A0D A;  8ATC B;  1GCQ C;  1QWE A;  1U8R A;  1G3Y A;  3L1A A;  3OYN A;  2NUT B;  2CSI A;  5GAN j;  2M0O A;  1VQ7 T;  1TUD A;  1YJW A;  1ZX6 A;  2MPX C;  1WX6 A;  2DTO A;  3EFR A;  4PJJ A;  3OY9 A;  3A8L B;  1NJI R;  2YRD A;  1M27 C;  3CPF A;  3QKJ A;  2RK2 A;  4M77 E;  3KXT A;  4BE0 A;  4HKE A;  2O01 E;  4J83 A;  1SSF A;  2PVO B;  4GY5 A;  2HQE A;  4PFP A;  4M78 D;  1Q82 C;  3LWI A;  4PJN A;  3UPU A;  3NFC A;  1UGP B;  3M0U A;  1U5S A;  1UDL A;  1HXD A;  1M3B A;  2JZ2 A;  4HVU A;  2H3E B;  4HCC A;  2XDB A;  4EMH A;  5IXB A;  2DTI A;  3V8J A;  1MMD A;  3CCR T;  1IZ6 A;  3QPH A;  1W2B S;  1GFD A;  1I81 A;  4V2S A;  2DRM A;  5CR2 A;  1FWZ A;  3WXM B;  3OYF A;  4KUL A;  3SDZ A;  1JBM A;  2SEM A;  4BI8 B;  4DBH A;  2Y4X A;  1WHL A;  1X27 A;  1BI2 A;  4A4G A;  3JB9 F;  2GBQ A;  4HVW A;  2JMA A;  2QI2 A;  5GAM f;  4PJO E;  3THK A;  3G4S A;  2KXC A;  2MCN A;  4LD6 A;  2L3Q A;  4EMK B;  4E7L A;  3CCE Q;  2E3I A;  5KYY B;  2OTL A;  4M7D D;  3MEV A;  2Z0W A;  2YLB A;  3BDU A;  2QTV A;  3MEA A;  2DX1 A;  4KH1 B;  3A8H B;  5GAO q;  1YJW Q;  1EFN A;  2DO3 A;  5KYN A;  2DVJ A;  5LJ3 g;  2FYK A;  5IH2 A;  1M90 C;  3CXC P;  1OUL A;  1Y71 A;  2JNG A;  2KT1 A;  1VQM A;  2E70 A;  4JJB A;  4OP0 A;  2XD0 A;  3JB9 H;  4MMK A;  2CP2 A;  2FPF A;  3I35 A;  3PVL A;  4KGX B;  1Z9Q A;  5GAO p;  2F1L A;  5FU6 C;  3PVQ A;  3GP8 A;  4NOY A;  1MMG A;  2KRS A;  1XJW B;  5GMK j;  3CC4 A;  4LUD A;  2NWM A;  1QVP A;  2EJ9 A;  4A4E A;  3M0P A;  5CVI A;  3PIO A;  2QQS A;  2W10 A;  2ROL A;  4LDY A;  1WI7 A;  1K9M R;  5ECA A;  1VQO A;  1QVG S;  4XU3 A;  4FYX B;  2HKN A;  2RHX A;  4C92 D;  3EAE A;  1XQH A;  3EFO A;  4AFU C;  2QEX T;  4OMQ A;  4XQ3 A;  3OS1 A;  2KI7 A;  3JV3 A;  4OMF B;  1H92 A;  2LNV A;  2AKL A;  3MP1 A;  3SD4 A;  3G4S Q;  2DD5 A;  2DJZ A;  1Y96 B;  4GLK A;  2F69 A;  1P92 A;  5GAN d;  1WJS A;  2OTL Q;  2DLP A;  3M56 A;  3A8M B;  4XK8 E;  2MIO A;  1TUG B;  5CKE A;  1Y0M A;  4BI3 A;  2SRC A;  2EQU A;  3H0I A;  2KSS A;  5FU7 B;  1G5V A;  1MV3 A;  1QCN A;  2RQT A;  2K2V A;  2D8H A;  5L23 A;  4OB0 B;  4YTL A;  2K5F A;  4CI0 C;  2CKK A;  3MPU B;  3CCL T;  2G3R A;  4M75 B;  1UB4 A;  1KIK A;  2COW A;  2RNA A;  5GAO n;  5IHK A;  2FB7 A;  1KD1 R;  2LMJ A;  4LE9 A;  1VQM Q;  1H8K A;  1UHC A;  1BIB A;  5IHN A;  2YWW A;  1ARK A;  3RDV A;  1Q86 R;  4IIO A;  1WFW A;  3I55 T;  1SHG A;  5CAI A;  1RAC B;  3CC4 Q;  2V1Q A;  1PKT A;  4C5I A;  2HL5 C;  1BI3 A;  1E6G A;  2D9T A;  3EGU A;  4M7A G;  2HZY A;  5GAN 6;  1VQO Q;  1UFF A;  2CUD A;  3HL8 A;  1VA7 A;  1VQP A;  1U06 A;  2C06 A;  1G83 A;  1VOM A;  1HYO A;  2J6F A;  4B9X A;  5GAN e;  1AWX A;  3FJ5 A;  1PD0 A;  1M8M A;  4N0A C;  2DEU A;  4OB3 B;  1T0H A;  3BE3 A;  1UUE A;  4MML A;  4EDU A;  4IUR A;  3ULR B;  3QSU A;  1CKB A;  5HCK A;  1VYT A;  4JUV A;  2LJ3 A;  1WHH A;  2ED0 A;  1S72 T;  3M9Q A;  2YUN A;  1AWW A;  4EMG A;  3EGD B;  3JCM h;  3X25 B;  5GJV B;  2PUK B;  2QQB A;  3OYM A;  1NYG A;  1QVG A;  5HY6 A;  1YIT T;  3C94 A;  4QQ6 A;  2QGG A;  3CMA T;  3CCS A;  1KC8 U;  3OYD A;  3JB9 D;  1VQ5 T;  2AIR B;  2KAF A;  1MMA A;  1NEG A;  4M78 B;  1OX8 A;  1M8V A;  5IAY A;  1O75 A;  4RCC A;  4MZT A;  5HK3 A;  2L2P A;  4E47 A;  2DNU A;  4JS5 A;  4AFZ C;  1B3Q A;  4LDX A;  2DF6 A;  3S3M A;  1QVF S;  1WJR A;  5KYX A;  3L2V A;  1K0X A;  4QVD A;  3NTI A;  2XKO C;  1VQL A;  1WXB A;  2K79 A;  4M7A A;  2LNH B;  5GAN f;  4C5G A;  2JM8 A;  5LJ5 h;  3OYY A;  4C5E A;  2RF0 A;  4DEX A;  2KXD A;  1U3O A;  2QK0 A;  2FZG B;  4PFZ A;  1M90 R;  3NHN A;  2LJ1 A;  2E6N A;  5GMK m;  3TQ7 P;  1D0Y A;  2DYB A;  2OAU A;  1ABO A;  3RR6 A;  2CP0 A;  1X69 A;  4XTX A;  3VS3 A;  4J7I A;  4M77 D;  1M2V B;  3JCM c;  1UGV A;  1NJI C;  2K3B A;  3OW2 A;  5GMK e;  3M0Q A;  2LCS A;  1Y07 A;  3JB9 I;  2GNC A;  1K4U S;  1M1G A;  1B07 A;  3OBW A;  1BI0 A;  1BKB A;  4CC4 B;  3CCS Q;  2O4X B;  3PMT A;  2GFU A;  4LXC A;  2HD0 A;  3L2R A;  1M30 A;  3CCE T;  2OTJ A;  4OML A;  4J7F A;  3PGG A;  4M78 C;  1NG2 A;  4MDX A;  2XDP A;  4MDW A;  4PKC C;  2DET A;  4FL6 A;  3IQL A;  1GRI A;  1V76 A;  2P0K A;  1WGS A;  3EGX B;  3S3N A;  1QP2 A;  2JT4 A;  3PT9 A;  4OMP A;  1K8A U;  1OZ3 A;  2RJF A;  1X6O A;  2QXF A;  4RG8 A;  4E6R A;  3M55 A;  1YJW T;  4PJO D;  4HT8 A;  3JCM g;  4FM4 B;  4PL6 A;  3X26 B;  2EQK A;  3BY7 A;  1VQL Q;  2LZ6 B;  4LUE A;  3LLR A;  1D1B A;  2K57 A;  3TSW A;  4IUQ A;  3SWN B;  3LH0 A;  3OYJ A;  4RTW A;  3TU4 K;  6AT1 B;  5D7U A;  2MWP A;  2RM4 A;  2V8I A;  5A2Q E;  2JTM A;  2VVK A;  2KK4 A;  1W2B P;  2BZX A;  4M7D C;  1VQ9 A;  2HAX A;  2B86 A;  1KQS S;  2NUT A;  5KCO A;  3REB B;  2DAQ A;  4PFO A;  2LDM A;  2M9U A;  2WSF E;  1VQN A;  1Q7Y U;  3L42 A;  1VQ8 A;  2YUO A;  1YJ9 A;  1IRE B;  3RES A;  4JZ4 A;  3OS2 A;  1AWJ A;  2M16 A;  2VC8 A;  2NYS A;  1TSF A;  1IGQ A;  1O9S A;  2A28 A;  5LJ5 g;  1CSK A;  4M7A E;  3OYG A;  5CK9 A;  1ZBJ A;  1OZ2 A;  4PLI A;  1NPP A;  3DB3 A;  1BIA A;  5GAM d;  1K9M C;  4J9C A;  1QKW A;  3NPF A;  4XTY A;  2PTK A;  3J7A F;  4C8Q F;  1UG1 A;  2A08 A;  3UAT A;  1W70 A;  2YUQ A;  4O6J A;  3TCJ A;  4C8Q C;  2EAY A;  2YLC A;  1FYN A;  3URG A;  5GAM g;  2LCC A;  2X3X D;  4C92 F;  1I4K 1;  5KE3 A;  1SHF A;  3NGP A;  4C92 C;  4BE1 A;  2F2W A;  1QCO A;  3ZFJ A;  4EMK A;  4Y28 E;  1YHQ A;  3RKY A;  3X20 B;  5KYY A;  1K0S A;  2MMP A;  2JS2 A;  2CP3 A;  1ACM B;  2MI6 A;  3S6W A;  3L2U A;  3CC4 T;  1VQ9 Q;  1YI2 A;  2LP5 A;  3CCU A;  5CKF A;  1QVG P;  4KGZ B;  2LQN A;  1IXD A;  1KC8 R;  4XAX B;  1VQO T;  2XK0 A;  3EG3 A;  3VJP A;  1VQN Q;  5GMK l;  2CYZ B;  5I2M A;  1JRI A;  1X75 C;  2KYB A;  3TVT A;  2R57 A;  4A53 A;  1KD1 C;  2D6F A;  1VQ8 Q;  1KK7 A;  8AT1 B;  1VIF A;  2RHY A;  3O5Z A;  1YJ9 Q;  3VU3 C;  2EW3 A;  2ZPG B;  1M4Z A;  2LQ8 A;  2V8J A;  4A4F A;  4AFS C;  5GAM e;  2A7Y A;  3OS5 A;  3OYE A;  3G6E T;  1AVZ C;  2CT4 A;  1WA7 A;  2IVW A;  4Z02 A;  4BD3 A;  3OSS C;  1I07 A;  2CT3 A;  3VUZ A;  1AZE A;  1RAG B;  4C0D C;  5CKH A;  3TEE A;  2RH2 A;  1ZA1 B;  2EYZ A;  3MEU A;  3JRZ A;  3SEM A;  4E7Z A;  4KBM B;  1KQS A;  1TH7 A;  3C95 A;  2MAM A;  4JJN K;  2CH4 W;  5GAN 5;  2FHD A;  2DFU A;  1K73 U;  5IN1 A;  3RUX A;  4WTO B;  2YRV A;  1SF9 A;  3M59 A;  3MKD A;  1LVK A;  4F14 A;  1B34 B;  3SFM A;  2VWF A;  2QDY B;  1Y7X A;  3CC2 A;  4F7U G;  4L5G A;  2DJQ A;  1Y96 A;  1YHQ Q;  3H0F A;  2VUB A;  1EIF A;  1BI1 A;  5FU6 B;  2LC4 A;  5KYU B;  2GTO A;  4RCB A;  3QYG B;  2EKO A;  3QHS A;  2J6K A;  1YI2 Q;  2BUD A;  3CCU Q;  1WQW A;  2LJ0 A;  2EQM A;  4B9W A;  3CME A;  1YJN A;  1VQP T;  5GMK i;  1MMN A;  5GAN h;  1QLY A;  4M75 A;  4M78 G;  4AG1 C;  1FX7 A;  4ZTJ A;  1FXX A;  1K8A R;  4J9E A;  4FW1 A;  2RB6 A;  4JRP A;  5GAN 4;  2E64 A;  1D3B B;  1M3C A;  3R6O A;  2CGH A;  2HNI A;  4QQD A;  1JQQ A;  2QTX A;  2JN0 A;  2YHT A;  4LNP A;  3EG2 A;  2YSQ A;  3C4S A;  3RMS A;  2E12 A;  3JCM V;  1TG0 A;  1I0C A;  3VRY A;  4CC3 A;  2YRC A;  3I56 A;  2LRQ A;  1NM7 A;  3NMZ C;  2CH4 A;  2IIM A;  4M7D G;  2D0N A;  2HBW A;  2M0Y A;  4XTU A;  4ZNX A;  2FEI A;  2FVU A;  2RQV A;  1XOV A;  1UEB A;  3MP8 A;  5D6W A;  1Q7Y R;  3H8Z A;  3CC2 Q;  5A0L A;  1OU8 A;  3SB2 A;  4QKU A;  4BDY A;  1QVF P;  3V8L A;  2QQA A;  3PIP A;  1FMV A;  2VAS A;  3HHT B;  4M77 F;  2LQW A;  4DA4 A;  3QII A;  1VQ4 Q;  4M77 C;  4C8Q D;  3EGD A;  3CME Q;  1YJN Q;  2DVE A;  2X4X A;  3OS0 A;  1KQ1 A;  2ZGW A;  1SG5 A;  1T0J A;  1GFC A;  2R5A A;  3PNW C;  2BKD N;  2E5Q A;  4FU6 A;  4M4Z A;  1MHN A;  1X6G A;  1ZUU A;  3LWH A;  2VXE A;  2KDS A;  3JCM W;  3KFV A;  2MWO A;  2KRO A;  2K2M A;  3BFM A;  4M78 A;  5FWB A;  2IG0 A;  5J3B A;  2DYI A;  1TWB A;  4Z89 A;  2RD1 A;  1D09 B;  2DL3 A;  1BK2 A;  2E4H A;  5IHI A;  4E7H A;  2MK5 A;  4ZGD B;  3ME9 A;  3G71 A;  2ESW A;  4PJO F;  1D0Z A;  3EHR A;  3E19 A;  4IUT A;  5GAN g;  4PJO C; 
#chains in the Genus database with same CATH homology
 2JMC A;  2J7I A;  3M0R A;  2HSP A;  3REA B;  2RQR A;  1WIE A;  1WXB A;  2F2V A;  1T3S A;  2K79 A;  2LNH B;  1N5Z A;  3UA6 A;  2DM1 A;  2JM8 A;  2AZV A;  2BZY A;  2RF0 A;  4DEX A;  2KXD A;  1I1J A;  3VS1 A;  1U3O A;  4J9H A;  1WDX A;  1GBQ A;  3NHN A;  2LJ1 A;  4J9B A;  2C0I A;  2DYB A;  2BZ8 A;  2EGA A;  1ABO A;  3U23 A;  4GBQ A;  4JPB W;  1X69 A;  3VS3 A;  3LH5 A;  1RUW A;  1UGV A;  1TUC A;  4RUG A;  2K3B A;  2K6D A;  3M0Q A;  2LCS A;  1YWP A;  1WXT A;  2V1R A;  2GNC A;  1SSH A;  2FG0 A;  3QWX X;  2P4R A;  1K4U S;  3VS2 A;  2KGT A;  1QCF A;  1B07 A;  1UJ0 A;  2EYW A;  2EPD A;  2H8H A;  2RN8 A;  4CC4 B;  4AFQ C;  4OMO A;  2EYX A;  1M30 A;  1UEC A;  4OML A;  2ECZ A;  2GQI A;  1JO8 A;  1JU5 C;  2L3P A;  2MOX A;  1NG2 A;  1Y57 A;  3ZL7 C;  4R0K A;  3VS0 A;  2DIL A;  1JXO A;  2CUB A;  2BTT A;  1BU1 A;  3IQL A;  1GRI A;  3RBB B;  2VKN A;  1BB9 A;  4J9F A;  2JT4 A;  4Y92 A;  4OMP A;  2HEQ A;  4RTU A;  2KT8 A;  4E6R A;  4ORZ A;  2FPD A;  5IXF A;  3CQT A;  3UF4 A;  2DL7 A;  1GBR A;  1LCK A;  3I5S A;  1GCP A;  1WYX A;  1ZUK A;  1YNZ A;  2QDL A;  1PRM C;  3C0C A;  2LZ6 B;  3PE0 A;  4LUE A;  4RTV A;  1QKX A;  3VS5 A;  1A0N B;  3TSW A;  4RTX A;  5FW9 A;  5FWC A;  4X1V A;  1MUZ A;  4RTW A;  4J9G A;  2JTE A;  1W6X A;  3QWY A;  4GLM A;  2A36 A;  4LN2 A;  4D8K A;  2KBT A;  4EIK A;  1OPL A;  1YWO A;  2ENM A;  4J9I A;  2VVK A;  1PHT A;  2J05 A;  1AOJ A;  2BZX A;  2AZS A;  1GCQ C;  1QWE A;  2B86 A;  2CSI A;  3REB B;  1YP5 A;  2EQI A;  2X3W D;  2HCK A;  1TUD A;  2LX7 A;  2RMO A;  1ZX6 A;  1WX6 A;  1WXU A;  2J06 A;  1MV0 B;  2YUO A;  2K7A A;  4JZ4 A;  1M27 C;  1PKS A;  2ED1 A;  1AWJ A;  1ZUY A;  2A28 A;  1CSK A;  5I11 A;  2M51 A;  1ZBJ A;  1ZSG A;  4QT7 A;  1M3A A;  3M0U A;  1U5S A;  1UDL A;  1M3B A;  4HVU A;  1PNJ A;  5IXB A;  4J9C A;  1YCS B;  1QKW A;  3NPF A;  1ABQ A;  2GTJ A;  2PTK A;  1UG1 A;  2A08 A;  1GCQ A;  1UTI A;  2DMO A;  1W70 A;  2OJ2 A;  2YUQ A;  3UAT A;  4DEY A;  1GFD A;  2K9G A;  2DRM A;  1FYN A;  2X3X D;  1KSW A;  2SEM A;  2OAW A;  1K1Z A;  1SHF A;  3NGP A;  1X27 A;  2GBQ A;  4HVW A;  2DA9 A;  2JMA A;  2F2W A;  2KE9 A;  1H3H A;  3THK A;  2KYM A;  1OOT A;  2KXC A;  2MCN A;  2CDT A;  2L3Q A;  3I5R A;  3I9Q A;  4HVV A;  2XMF A;  2DL8 A;  4K11 A;  1K0S A;  4CC7 A;  2JS2 A;  1PRL C;  2C0T A;  2J6O A;  3VS6 A;  4J9D A;  2LP5 A;  5I22 A;  2LQN A;  1OPK A;  2DX1 A;  3VS7 A;  3VS4 A;  1IO6 A;  2PZ1 A;  2EVR A;  3EG3 A;  2KYB A;  3TVT A;  1EFN A;  1W1F A;  1T3L A;  2DVJ A;  3O5Z A;  4IIM A;  1BBZ A;  2EW3 A;  5IH2 A;  1J3T A;  1KFZ A;  2O2O A;  1HD3 A;  1JXM A;  2KT1 A;  4JJB A;  4AFS C;  1HJD A;  2FPF A;  3I35 A;  2NUZ A;  3PVL A;  2FO0 A;  1Z9Q A;  1AVZ C;  2CT4 A;  1WA7 A;  3PVQ A;  2KR3 A;  1NEB A;  2DBM A;  2JM9 A;  2KRS A;  1I07 A;  2CT3 A;  1JEG A;  4RTZ A;  4OMM A;  1AZE A;  1E7O A;  3UA7 A;  4LUD A;  2NWM A;  2DBK A;  4FSS A;  3M0P A;  4ESR A;  2I0N A;  2EYZ A;  3RNJ A;  2W10 A;  3R6N A;  2A37 A;  2ROL A;  3SEM A;  1WI7 A;  1Z9Z A;  5ECA A;  1AEY A;  2CH4 W;  4CC2 A;  2YT6 A;  4HXJ A;  2KRM A;  3EHQ A;  4AFU C;  4OMQ A;  2EGC A;  2JS0 A;  2O31 A;  4F14 A;  3M0T A;  4D8D A;  3M0S A;  3JV3 A;  1H92 A;  1X6B A;  2AKL A;  2VWF A;  1UJY A;  2DJQ A;  2FPE A;  3H0F A;  2CRE A;  1WLP B;  1CKA A;  1SRM A;  4KRT A;  2C0O A;  2G6F X;  3EG1 A;  2DLP A;  1HSQ A;  1RI9 A;  2GTO A;  2MIO A;  2FRW A;  1RLP C;  1Y0M A;  2J6K A;  5EC7 A;  2SRC A;  2KNB B;  1FMK A;  3H0I A;  1UE9 A;  1OEB A;  1MV3 A;  2RQT A;  2D8H A;  2LJ0 A;  3VRZ A;  2L0A A;  5L23 A;  2D8J A;  2DRK A;  4RTY A;  2JXB A;  1QLY A;  2YUP A;  1KIK A;  4HCK A;  1AWO A;  2RNA A;  4AG1 C;  1SPK A;  5IHK A;  3H41 A;  4Z8A A;  2JW4 A;  2LMJ A;  4LE9 A;  2EKH A;  1H8K A;  4J9E A;  1UHC A;  2EGE A;  4A63 B;  5IHN A;  1ARK A;  1SEM A;  4IIO A;  1M3C A;  1WFW A;  2W0Z A;  1SHG A;  1AD5 A;  2KRN A;  4JJC A;  1V1C A;  2DE0 X;  1JQQ A;  2AKK A;  4LNP A;  2V1Q A;  1PKT A;  1NLO C;  2YSQ A;  3EG2 A;  1E6G A;  3EGU A;  2PNI A;  2DL4 A;  1TG0 A;  1I0C A;  3VRY A;  1UFF A;  2CUD A;  3EG0 A;  2O9V A;  1VA7 A;  4CC3 A;  1U06 A;  1G83 A;  2YDL A;  2J6F A;  2KEA A;  1AWX A;  2HDA A;  3FJ5 A;  1M8M A;  1NM7 A;  3NMZ C;  2CH4 A;  2F2X A;  2IIM A;  3H0H A;  1G2B A;  2D0N A;  1T0H A;  2HBW A;  2M0Y A;  4ZNX A;  1UUE A;  2FEI A;  2OI3 A;  2O9S A;  4RTT A;  2RQV A;  2RQU A;  1XOV A;  1GL5 A;  3ULR B;  4JZ3 A;  1X43 A;  2O88 A;  1CKB A;  5HCK A;  1VYT A;  2RPN A;  1VYV A;  5GJW B;  4F16 A;  4OMN A;  2EYY A;  2LJ3 A;  1K9A A;  2GGR A;  2ED0 A;  1S1N A;  2YUN A;  1AWW A;  1SRL A;  2LQW A;  3SHW A;  5GJV B;  1X2Q A;  4F17 A;  4JJD A;  1NYG A;  1PWT A;  1GFC A;  1T0J A;  3GBQ A;  2D1X A;  2ROT A;  4M4Z A;  1ZLM A;  1X6G A;  1ZUU A;  2RQW A;  4AG2 C;  4WCI A;  1RLQ C;  2CSQ A;  2AK5 A;  2ABL A;  1OV3 A;  3KFV A;  4Z88 A;  1NYF A;  1NLP C;  1X2K A;  2KRO A;  2L3S A;  2K2M A;  1NEG A;  2EBP A;  5FWB A;  2DL5 A;  1KJW A;  2FRY A;  2L2P A;  2DNU A;  1VYU A;  4AFZ C;  1B3Q A;  1UHF A;  2E5K A;  4Z89 A;  1QWF A;  3TSZ A;  1K76 A;  1YN8 A;  2DL3 A;  3A98 A;  1BK2 A;  2DF6 A;  5IHI A;  1E6H A;  1AZG B;  2ESW A;  3EHR A;  1K0X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...