1HSQA

Solution structure of the sh3 domain of phospholipase cgamma
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
71
structure length
71
Chain Sequence
b'GSPTFKCAVKALFDYKAQREDELTFIKSAIIQNVEKQEGGWWRGDYGGKKQLWFPSNYVEEMVNPEGIHRD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOSPHOLIPASE C-GAMMA (SH3 DOMAIN)
molecule tags Phosphoric diester hydrolase
source organism Homo sapiens
publication title Solution structure of the SH3 domain of phospholipase C-gamma.
pubmed doi rcsb
total genus 4
structure length 71
sequence length 71
ec nomenclature ec 3.1.4.11: Phosphoinositide phospholipase C.
pdb deposition date 1994-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1hsqA00
2AZVA 1SHFA 2JTEA 5GJVB 1PKTA 1AWOA 4F14A 2DE0X 1U06A 1ZUUA 2EYWA 3PE0A 2EQIA 3GBQA 3SHWA 2SRCA 4RTYA 1ZUYA 1ABQA 4OMPA 2CT3A 4CC7A 1MV3A 4AG1C 4JJBA 2RQVA 4LUDA 1KFZA 2J6OA 1YWPA 2ED0A 1GFCA 1WFWA 3A98A 2EGAA 1NLOC 4E6RA 2HDAA 3TSZA 2BZ8A 1W1FA 2C0IA 1YNZA 2F2XA 2NUZA 2YT6A 1VYVA 1M3BA 2RMOA 3VRYA 1BK2A 1TUDA 1K0SA 2BZXA 2DVJA 2BZYA 3UF4A 1TG0A 2DX1A 2VKNA 2RQUA 1BBZA 1RI9A 4RTWA 1GCQA 3EG1A 2B86A 2EVRA 1OPKA 2HSPA 1UFFA 3H0IA 4LE9A 4ZNXA 3VS2A 3VS1A 2KRMA 2X3WD 5FW9A 2EGEA 3QWXX 1W70A 3I5RA 1NEBA 4OMOA 5I11A 2L0AA 3H0HA 1JO8A 1AZEA 1FMKA 1ZLMA 2KXDA 4RTTA 3IQLA 2F2VA 1T3SA 1Y0MA 2F2WA 2KXCA 1NM7A 1PNJA 2J6FA 1RLPC 1V1CA 2K79A 3M0QA 3VS5A 4CC3A 3I35A 2M51A 1NEGA 1HSQA 4A63B 1T3LA 4HCKA 1SEMA 2KYMA 2NWMA 1PWTA 1X43A 3EG2A 4X1VA 3U23A 4JJCA 1WXTA 2D8HA 1PRMC 2LJ3A 1CSKA 2C0OA 3EG0A 2K3BA 2O2OA 1HD3A 3THKA 1ABOA 2L3QA 1Z9QA 3CQTA 1PKSA 2EBPA 2KT1A 3M0RA 1WIEA 3REBB 4WCIA 1GFDA 1LCKA 3VRZA 1K0XA 1WXUA 2HCKA 3NHNA 1VYTA 1OOTA 2JS0A 2KNBB 1U5SA 2YDLA 2LJ1A 2PNIA 1KIKA 5FWBA 2J6KA 1QKXA 1QKWA 2EW3A 2KEAA 2JM8A 2LJ0A 1NYGA 1QWEA 1YCSB 2W10A 4EIKA 3SEMA 1AWWA 2LZ6B 2ESWA 1EFNA 1MUZA 2QDLA 2LQNA 1CKBA 3VS3A 2DL7A 2LX7A 1AWXA 2A37A 4Z8AA 2GTJA 1X2KA 2GGRA 2VWFA 4J9EA 5IHNA 2DJQA 3VS4A 1GRIA 3O5ZA 2KGTA 1FYNA 2DMOA 2RQWA 1M30A 2FG0A 4JZ3A 1X6BA 1UJYA 2J06A 2FPEA 5EC7A 4HVUA 1VYUA 3M0UA 2RF0A 4Y92A 5ECAA 3TSWA 1H92A 1JXOA 2JS2A 2ECZA 2RQRA 1SHGA 3REAB 2FPFA 5HCKA 1YWOA 2OJ2A 1SPKA 1W6XA 2O9SA 2EYYA 2D0NA 2YUOA 3PVQA 4RTXA 2A28A 1K1ZA 1SRMA 1X27A 2EYZA 4LNPA 4RTUA 1ZX6A 1NYFA 2A36A 2GBQA 4D8KA 4LN2A 2OI3A 1PRLC 2I0NA 2P4RA 1AVZC 4OMNA 1M3CA 3EG3A 4HVWA 2FEIA 4KRTA 4IIOA 3EHRA 2DLPA 4LUEA 2L2PA 2FRYA 1OPLA 2H8HA 5IXFA 2KROA 1WX6A 2KT8A 2MIOA 2HEQA 2GNCA 3LH5A 4AG2C 3UA6A 2CUBA 1UJ0A 1A0NB 1IO6A 2DL8A 2FRWA 2M0YA 2BTTA 4RTZA 1AZGB 1WI7A 2DF6A 3RNJA 1AEYA 2V1QA 1X69A 4M4ZA 4J9HA 4JPBW 3M0SA 1JQQA 1UUEA 3QWYA 2DYBA 1QWFA 1I0CA 2CT4A 2FPDA 4DEXA 2AZSA 1B3QA 1MV0B 2G6FX 2JW4A 2L3SA 3JV3A 4J9FA 2KBTA 4K11A 1UHCA 2O9VA 1ZUKA 2CDTA 2DBKA 4CC2A 1BU1A 2EPDA 2HBWA 1B07A 1T0HA 2K6DA 1T0JA 1H3HA 3NGPA 3I9QA 2AKKA 1HJDA 2CUDA 4AFSC 2LQWA 2OAWA 1K9AA 3H41A 2GQIA 4J9GA 2CSQA 4ORZA 1KSWA 3NPFA 5IXBA 2RN8A 2JT4A 2ABLA 4AFZC 1OEBA 4JZ4A 1GBQA 1X2QA 2MOXA 1NG2A 3I5SA 4ESRA 1WXBA 2EYXA 2CH4A 2J05A 1G2BA 4Z89A 3FJ5A 2D1XA 2CREA 2O88A 1H8KA 2L3PA 1UGVA 3KFVA 1WDXA 1XOVA 2DNUA 1SSHA 2KYBA 3C0CA 2MCNA 5IHKA 2LMJA 2EGCA 4RTVA 1YP5A 1AOJA 4GLMA 1I1JA 2YUQA 4OMQA 2JMCA 2CH4W 2C0TA 2K9GA 1I07A 1QLYA 3RBBB 2SEMA 1VA7A 4R0KA 5L23A 3UATA 1G83A 1J3TA 1WYXA 5IH2A 4AFUC 2E5KA 2GTOA 2KRSA 4OMMA 4F16A 1QCFA 1GCQC 5I22A 2RPNA 1WLPB 3M0TA 2D8JA 5GJWB 1UG1A 1UE9A 3TVTA 3R6NA 2DBMA 2K7AA 2KE9A 2YUPA 2ROTA 1PHTA 1Y57A 4OMLA 2LP5A 4JJDA 1AD5A 1RLQC 1M3AA 1GCPA 1CKAA 4IIMA 1UDLA 2DRKA 2YSQA 1OV3A 3ZL7C 3VS0A 1E6GA 2DL4A 4D8DA 1U3OA 2LCSA 1S1NA 4J9DA 1JEGA 2DM1A 2RQTA 1GL5A 2JM9A 3VS7A 4HXJA 1AWJA 3EHQA 4J9BA 4Z88A 1SRLA 2ENMA 2O31A 1BB9A 1TUCA 2KR3A 1M27C 2ED1A 2YUNA 4AFQC 4GBQA 5IHIA 5FWCA 2KRNA 2XMFA 1ARKA 1Z9ZA 2FO0A 2V1RA 2AKLA 2DILA 3NMZC 1E6HA 1X6GA 2DRMA 1ZSGA 3EGUA 3VS6A 1GBRA 1UECA 2A08A 2JXBA 2PZ1A 2ROLA 4HVVA 1NLPC 1N5ZA 4F17A 2EKHA 1E7OA 4RUGA 2DL5A 1KJWA 2J7IA 3ULRB 1UHFA 2DA9A 4J9CA 1JXMA 1K4US 2JMAA 1WA7A 4CC4B 2LNHB 4FSSA 1M8MA 3M0PA 3UA7A 2AK5A 2CSIA 2IIMA 3H0FA 1JU5C 1YN8A 1K76A 2W0ZA 4DEYA 4QT7A 2DL3A 2VVKA 1ZBJA 3PVLA 1UTIA 2PTKA 2K2MA 1RUWA 4J9IA 2RNAA 2X3XD
chains in the Genus database with same CATH superfamily
2YXYA 2HQEA 2BUDA 2MPXC 1QVFA 1D0ZA 3CC7Q 4F14A 1SSFA 4BD3A 2DE0X 1OI1A 3CCJQ 1D1CA 3J81E 1YJNT 5FU7C 5D6XA 2QYZA 4XAXB 1ZUYA 4J5YA 2XHCA 3EH1A 1MV3A 1WGSA 4OVAA 5CVIA 4AG1C 4JLIA 2RHIA 2FL7A 2J6OA 1YWPA 3OYBA 4ZN3A 1D0YA 3A98A 4O6JA 3H6ZA 2HDAA 2BZ8A 5GAOq 4OF1A 3MCAB 4J83A 2C0IA 4KH1B 2YT6A 3KBGA 4E7SA 3CC2A 3J7AF 2RMOA 5GAMh 3VRYA 1BK2A 2BZYA 2H3JA 2EJ9A 4C0DB 4PJNA 1OULA 3NTHA 4JUVA 2DX1A 1C1AA 3EG1A 3C4SA 1U1SA 4M7AA 4LE9A 2QQRA 3G1JA 4M7AF 2KRMA 3TU4K 3QIIA 3QKJA 1W70A 1NEBA 1YBYA 2L0AA 3OYNA 3HP9A 3S6WA 2OTJA 2OTLT 2KXDA 4RG2A 4PFPA 5LL6S 2F2WA 1OYXA 1H3ZA 1V1CA 4C92C 3ME9A 4DBHA 1YIJT 4A63B 1Q82C 8AT1B 2EQUA 1K9MU 2H3EB 1WJQA 1VOMA 5LJ3g 1TH7A 4J6XA 4JJCA 2FZKB 1WXTA 1M1KC 1PRMC 3QSUA 1EIFA 1G3TA 2O2OA 2DEUA 3QZ9B 1Z9QA 3CQTA 5J39A 2ZCFB 4E7JA 3X24B 1NZ9A 3VRZA 3EFOB 3TQ7P 1U5SA 2BE7D 2QEXT 4F7UG 1QKXA 4CI0C 2EW3A 4RG8A 2KEAA 3S3MA 4C5IA 3JCMh 4E7ZA 3JB9G 1YCSB 4EIKA 2ZAEA 3SEMA 5D6YA 2ESWA 1LPLA 1MUZA 2HAXA 4FYWB 5GAOm 2LX7A 4ZGDB 2GTJA 3RKYA 2O4XA 3AT1B 2BIVA 2GGRA 5HY6A 4J9EA 5IHNA 5IAYA 2RI5A 3VS4A 3T9NA 3O5ZA 4YTLA 1IGUA 1M30A 1NJIC 4JZ3A 5GMKl 3OQ5A 4II1A 5KCHA 4HVUA 1VQMA 5GANf 3DB3A 2RF0A 3TSWA 2RQRA 2FPFA 1W6XA 2VC8A 3CPFA 3PVQA 2A28A 4DBQA 1K1ZA 2ATCB 3AHUA 4A4FA 4PKCC 2EYZA 5GAN3 2GBQA 4X9CA 1XNIA 1PRLC 1N8RU 2P4RA 2PQWA 3QDRB 2FEIA 3KUFA 3EHRA 4XU0A 4JRKA 1VQ4T 1O9SA 2L2PA 4LUEA 3JCMd 1QVGP 2FRYA 3M53A 5GMKh 2MIOA 2GNCA 4AG2C 3UA6A 4BE0A 3OYFA 2KDSA 2M1HA 4M7DD 1R0CB 1Q86C 4C5EA 4RTZA 3DB4A 5A0DA 4JPBW 2X4WA 2DYBA 1KQ2A 2CT4A 2FPDA 2DERA 2AZSA 3OSVA 1MV0B 1RABB 4M75C 1ZSZA 2DEQA 3VV0A 2L3SA 2XD0A 4Z02A 2DPPB 2KBTA 1UHCA 3E1SA 1WPYA 2CP3A 2LDMA 1JJ2A 1YI2T 2LVMA 2HBWA 3OYKA 2K6DA 4LD6A 1T0JA 3NGPA 4C8QC 3S3NA 3CC2T 1HJDA 1Q82R 2LQWA 2G3RA 3MHXA 1M1KR 3CCEQ 2E5QA 4PJOE 3RERA 3NPFA 4BACA 5IXBA 3M4YA 2ABLA 4AFZC 1X2QA 1GBQA 2YLBA 3CCMA 1NG2A 3VKIA 3DKMA 1WXBA 4J7IA 2EYXA 4E2FB 3EG9B 1JB0E 1K9MR 2O4XB 1VQ9T 2PU9B 3OYAA 4F7UF 3I56Q 1VQNA 2O88A 2DTHA 3BFMA 1UGVA 1WDXA 2QA4A 9ATCB 1M1FA 5L8RE 3C0CA 1KD1C 4ZN1A 3VUBA 2R57A 4M7DB 3CMAT 1FWZA 3FRNA 3G71A 1YP5A 3JSCA 1KC8R 4GLMA 2K2VA 3V7RA 1QCOA 2DIQA 1V29B 1I07A 2SEMA 2DXCA 1G83A 3CCLQ 2HMAA 1OZ2A 2KRSA 3I56A 2XKOC 5I22A 5GANe 2RPNA 3ER0A 3M0TA 5GJWB 1UG1A 2XDDA 1YHQQ 3R6NA 3OYEA 2DBMA 4OP0A 3A5ZB 1KK7A 3CEYA 3UT1A 4OMLA 5CK9A 2FHDA 3JCMW 2KY9A 1BCMA 2DO3A 5GANd 4PFOA 2QGGA 4PJOF 5GAMf 1QVFP 2CS7A 1VQ7A 1UDLA 2DRKA 4V2SA 3C12A 2Z0WA 3SDZA 2EJGA 2LCSA 1WJSA 2ZPEB 1JEGA 1VQLT 2OX7A 1WHKA 3CXCP 2JM9A 2RH2A 4F7UA 3G4SQ 3FB9A 1SRLA 2ENMA 2O31A 1TUCA 2KR3A 1M27C 2E65A 5IHIA 5FWCA 5CR2A 3C95A 2NUTB 3JCMb 4EMKB 1X01A 2DILA 3NMZC 1TTHB 3PMIA 1ZSGA 3EGUA 4OB3B 3JB9H 3OYIA 4F17A 3PMTA 3I55T 4RKUE 4MZPA 4RUGA 2DL5A 3V7CA 1KJWA 1UHFA 2GFUA 1K4US 4QQ6A 4CC4B 2CP6A 2KAFA 4ZTJA 4RCCA 3RKXA 3LH0A 1U1TA 3CBOA 2E1HA 1VQNQ 1UGRB 1G8XA 4NS5A 4J6YA 1N9RA 1VIFA 3P8DA 3OY9A 2DL3A 3CBPA 4HCCA 3PVLA 1UTIA 3EFSA 1IHVA 2JZ2A 2LCLA 3J80E 5C6SA 4M7DA 3EGDA 3JCMX 2AZVA 2LT4A 1M1GA 2QK0A 5GJVB 4BDYA 3MP6A 1WHHA 2EYWA 3SHWA 4OMPA 3QZ5B 1M1KU 2V8KA 3CXCS 3NFCA 4CC7A 4JJBA 2RQVA 4M78D 1ZBXA 2ED0A 3EH2A 4M75D 2E3HA 2EGAA 3UPUA 1U8RA 3HTRA 3QG1A 3G6EA 1YNZA 1KQSS 4KUIA 1R0BG 4M77G 2NLUA 2ZPFB 1M3BA 5FLXE 2FVUA 1TUDA 1Q81C 4FW1A 3UF4A 1TG0A 5GMKi 2LT1A 5A2QE 5LJ3f 3P8HA 4PJOG 1RI9A 3GPLA 1GCQA 3OW2P 2D6FA 1OPKA 4DBFA 1FMWA 2DVEA 3H0IA 4ZNXA 2PVGB 2DKGA 2LQ8A 4LDWA 4A4GA 3FC3A 2EGEA 3QWXX 3I5RA 4BE2A 3A8MB 1FMKA 2LRQA 2ZGWA 4WF2A 3OSSC 1NBEB 3L2VA 1UGSB 1KHCA 2EQMA 2MI6A 5GMKm 4RTTA 3ZEHA 3M54A 1Y0MA 1NM7A 4CRIA 2J6FA 1RLPC 2AHJB 2YRDA 3DLLA 2JNGA 3I35A 2M51A 1NEGA 4HCKA 1SEMA 4WTOB 1ACMB 2MWOA 2C06A 1WZOA 1KG1A 4X1VA 4KT0E 4JS5A 1M2VA 1G3SA 3LWHA 1BI0A 3CMEA 4FYYB 1F1BB 3CCSQ 2DK3A 5LJ3e 1TSFA 2PVOB 1I81A 5CKFA 1VQKT 1Q81R 3C94A 4C0DC 1CSKA 2C0OA 2MF2A 3PIPA 3I55A 5GANh 2CKKA 3EGXB 4XQ3A 2L5QA 3H9NA 3HL8A 1QCNA 1KC8C 4B9XA 3KXTA 2VB6A 4E47A 3EGDB 3REBB 2K5LA 4Q5WA 3LX7A 4PK4A 1LCKA 2P0PA 1K8AR 2KQWA 3NHNA 3OMCA 2FYKA 3DLMA 5KCOA 1YI2Q 4ELYC 1TUGB 2LJ0A 4XU1A 3BE3A 4UC4A 3SFMA 1NPPA 1YJ9A 2DXUA 1AWWA 4MMLA 2LZ6B 4VUBA 1Y07A 2QDLA 1CKBA 1M9SA 2A37A 4Z8AA 1X2KA 4DBRA 4BI4A 4KGVB 2DJQA 1QVFS 1GRIA 3MPUB 1G3YA 2KGTA 3E9GA 2FG0A 3INZA 3N5BB 1UJYA 1S72Q 2FPEA 5EC7A 3M55A 2E70A 3M0UA 1H92A 1JXOA 4PLLA 5GAN5 5FU7B 3CBMA 1Q95G 2OJ2A 1SPKA 2O9SA 4JRPA 2E41A 5GAN2 3SD4A 4RTUA 1NYFA 2R5AA 2A3LA 2OI3A 2I0NA 1G3WA 4PJOB 1AVZC 1M3CA 3OYLA 3MP1A 4HVWA 1QP2A 3MEVA 3P8BB 2DLPA 5GANj 4IUUA 4GY5A 2QEXA 4N0AC 4A4KA 3GP8A 3A1PA 3HPWA 4N4HA 2H8HA 3HHTB 2KROA 5IXFA 4FYVB 5IT9E 3EAEA 1WX6A 1UGPB 5KYYB 3OYMA 3LH5A 2XU8A 3OYGA 1BI3A 1UJ0A 1I5LA 2M0YA 1BI1A 2BTTA 4F7UB 2DIGA 4E7KA 4IKFA 1VQ9Q 4M4ZA 3M0SA 1JQQA 1UUEA 3CCMT 4C92B 2RJEA 1FXXA 2F1LA 3CPWA 5CKDA 2KI7A 2NUTA 1MMNA 4C92D 1YI2A 3G4SA 2K5IA 1FX7A 2RM4A 5GAMj 1D3BB 1BU1A 3PGGA 1TWBA 2QQ9A 2AKKA 3X20B 4AFSC 1VQ4Q 1K8AU 1K9AA 2ZPGB 2KMTA 5CKEA 2GQIA 2V26A 4L6V5 1KSWA 3OS2A 3M58A 3OB9A 4QW2A 2JT4A 2EIFA 1OEBA 5GAMd 2HQXA 3CC4T 2MOXA 4OGEA 1LVKA 3GLXA 1I5OB 2VYTA 3I5SA 1NPRA 4XTUA 4TVRA 1YITT 3QBYA 1QW1A 2J05A 3CXCA 4Z89A 3FJ5A 1H8KA 3HRUA 2AIRB 1LOJA 1Q7YR 5KYUB 2KYBA 2JN0A 2P0KA 3VU3C 3MKDA 2E6ZA 3META 1KQSA 4NOYA 4RTVA 1I1JA 2YUQA 3CCLT 4OMQA 3CCRT 3MP8A 2D9TA 4M77A 1Y7XA 1S72A 2CH4W 2C0TA 3RBBB 2YWWA 1C0MA 3OBYA 2VGNA 4M78C 4F7UE 1VQ8A 5L23A 5DY9A 4J6WA 4Y28E 4AMCA 4PJOA 1IHWA 2GTOA 4OMMA 1YFNA 1P92A 3LGLA 3TVTA 1UE9A 3OYHA 1Y96A 2OAUA 2V8JA 4LDXA 2K7AA 2YUPA 2RB6A 2ROTA 2LP5A 4M75G 2COZA 1RLQC 1M3AA 4PLIA 3OS5A 4D6WA 4IUVA 1WJRA 2EQKA 4XTYA 4C92A 2DL4A 3WVDB 1U3OA 1OZ3A 2FZCB 3QYHB 2DM1A 2RQTA 1Q86R 3VS7A 1GL5A 4HXJA 2CZ7B 4J9BA 4Z88A 3VYGA 1W2BS 1RAFB 4AFQC 3E19A 4GBQA 4M7DE 3NTIA 4FIBA 2KK4A 2FO0A 3TREA 2DRMA 4M7DC 1N27A 1DJ7B 2A08A 2JXBA 2ROLA 2F69A 2LNVA 2X9HA 2EKHA 1S72T 2DXTA 1W4SA 2KSSA 2RD1A 3QJYA 4J9CA 1NJIR 1WA7A 1HK9A 3MEWA 2WSFE 2CSIA 2JTMA 4FM4B 5GANg 3L2WA 1JU5C 1EX4A 2VV5A 3JCMf 3LGFA 3CCMQ 4OMFB 2OTJT 1XJWB 4DEYA 2VVKA 3RIRA 2O01E 2K2MA 3PIOA 1BYMA 4J9IA 2X3XD 1MNDA 4C0ZA 2DYIA 1YJWA 3CCUA 3QXEB 3JCMV 1VQPQ 4M7DG 1M90U 2JTEA 4FU6A 5AYFA 1AWOA 2PVDB 3D7SB 1U06A 2CP7A 3ZBDA 2EQIA 4RTYA 3HRSA 4M7AB 4M75B 4P5NA 2D0QB 1KQSP 3V7SA 4LUDA 1KFZA 4XTVA 3SWNB 3BDLA 4ZGEB 1W2BP 1GFCA 1D1BA 4HKEA 3M59A 1YJNQ 1OQKA 4E6RA 2R58A 3TSZA 3RR6A 1W1FA 1ZSZB 1EZZB 1X75C 1BKBA 1VQ5A 1OU8A 1VQNT 1WHLA 2MAMA 3FLGA 2B8AA 3S3OA 3E9FA 3OW2S 2RHZA 1K0SA 2RK2A 5J26A 2DVJA 2NYSA 1MNEA 4GLKA 5I2SA 2JTFA 2M16A 3OA6A 2ZPBB 4C8QE 2DZCA 2VKNA 2HNIA 1BBZA 4RTWA 5GAOl 2PUKB 1KHIA 2EVRA 2RJFA 5CIUA 3CCJT 2HSPA 4M75F 1D1AA 5DLQE 5HKCA 1RAEB 4M77E 5FW9A 1YJNA 2K57A 1TU0B 3V8LA 5I11A 4R55A 3H0HA 1G5VA 5KYYA 1JO8A 1AZEA 3CC2Q 1ZLMA 1QQJA 1T3SA 1BI2A 3EFOA 4C92G 1BIAA 2KXCA 3CCQT 1I8FA 1PNJA 2K79A 1JJ2S 3M0QA 3X25B 1HSQA 1T3LA 1AT1B 1X6OA 3TCJA 2KVQG 2KYMA 2NWMA 1X43A 3BW1A 2DXBA 3U23A 2IPOB 4EMHA 4EPCA 3BY7A 2L89A 2RHUA 2P0QA 3JCMJ 2D8HA 2LJ3A 2DETA 2XDPA 1M4ZA 3EG0A 3JCMc 1VQMQ 2K3BA 3PT9A 1HD3A 3THKA 2L3QA 1PKSA 2EBPA 2CP5A 3HFNA 4WCIA 3O8VA 4C0FA 1K0XA 4BI8B 2DTOA 2YDLA 2QGFB 3OMGA 1VQ4A 1QKWA 2JM8A 4BI3A 4OB0B 1NYGA 2NUPB 5HK3A 2EKOA 4M75A 1VQ5Q 4PL6A 5M9OA 5LJ3j 1VQ7Q 3RKWA 1VQOQ 4HCZA 2F5TX 3CCVA 1AWXA 4M78F 4MZMA 4M78A 1VQKA 5FROA 4C0GA 1VQ8T 1QMCA 2RQWA 4C92E 2RHXA 2EQJA 2JOYA 4FSXA 2IVWA 2J06A 2HKNA 5CO7A 5LJ5g 1B7TA 1KD1U 4EMKA 1VYUA 5KE3A 4Y92A 5ECAA 3CCRA 2E4HA 3PTAA 4J7FA 1SHGA 5HCKA 1YWOA 4JRQA 3HFOA 2YUOA 2D0NA 2RI2A 5LJ5j 3CD6A 4O5VA 1JBMA 1X27A 2BE9B 4D8KA 4B9WA 2QXFA 1VQ9A 3MO8A 3CCQA 5LJ5e 1QVPA 3JB9I 3OW2A 2HBPA 8ATCB 1D0XA 5GAOp 1OPLA 1RAIB 3CC4A 3CCJA 2LTOA 3RMQA 3QPHA 2HEQA 1A0NB 1M8VA 3E2UA 2DL8A 2FRWA 2HD0A 5LJ5h 2GQVA 3JCMg 4C5HA 3UDCA 1AZGB 1Q82U 4MDXA 1AEYA 4J9HA 1I4K1 3QWYA 1BCOA 4FCYA 4ELZC 5CCAA 1B3QA 2G6FX 3R6OA 2JW4A 4M7AD 2K3YA 3JV3A 4J9FA 4K11A 1RADB 2O9VA 3JCMP 4LD9K 2L3RA 1SG5A 4C92F 2LQKA 2QQAA 3I9QA 1YITA 4M77D 2CUDA 5LJ3h 2OAWA 3H41A 4PJJA 5KH6A 4C8QG 5KYXB 4J9GA 2CSQA 1HYOA 3LW5E 5I2MA 2RN8A 2COWA 5IN1A 4JZ4A 1PC0A 1ZA2B 4PJOD 2E6NA 3L42A 2I2LA 2L8DA 3CCVQ 4EMGA 2CH4A 2PUOB 1G2BA 3CMAQ 1LNXA 4M78B 2OTLQ 4M77F 2XDBA 2CREA 1VQOA 4OB1B 3OYJA 2L3PA 4ZGJB 2VXEA 3KFVA 2EJFA 2QASA 1XOVA 2DNUA 2K5FA 1SSHA 3CD6Q 1IGQA 2X51A 3QUIA 5IHKA 2OTJQ 2EGCA 5GMKe 3CCEA 4RMOA 2DAQA 3V8KA 1XTDA 1IRXA 2K9GA 2X35A 5KYNA 4M7AE 3RMSA 1QLYA 2QAZA 2EAYA 1RL2A 1VA7A 2QEXQ 1WHGA 4IURA 1VQ6T 4R0KA 2COYA 3CC4Q 3FIFA 5KYWA 2E5KA 4DOWA 1Q7YC 1QCFA 2RI3A 1QVGA 4XTXA 1QVGS 2CP2A 1M90C 4EMKC 3I55Q 2ZPIB 3ZFJA 2WSCE 1CKAA 2HL3A 4OGCA 3PFSA 3CD6T 4IIMA 3WVEB 2DJZA 2WACA 1E6GA 4XU3A 4D8DA 3CC7T 1YHQA 4J9DA 1B34A 1WQWA 1TXQA 1NJIU 3EHQA 1YJ9Q 4A53A 2M0OA 1BB9A 5EG2A 4NL3A 2YUNA 3MJXA 4IUTA 5GAOn 1HXDA 2KRNA 4E7IA 2XMFA 3GIBA 5A0GA 4A4EA 1ARKA 1RI0A 1Z9ZA 4X9DA 4A4HA 4JJNK 2K3XA 2V1RA 2AKLA 4HT8A 1E6HA 1X6GA 3HKSA 2YRVA 3VS6A 1N8RC 1YJWQ 1UECA 2PZ1A 4HVVA 4LXCA 4X34A 1N6AA 3CPWS 2GFAA 5FU6B 3ULRB 2DA9A 1SKUB 1JXMA 1VQ6A 4ANJA 4FSSA 3M0PA 4C8QD 1UGQB 3H0FA 4MMKA 2RO0A 3GOXA 2OTLA 1ZQ1A 5CKHA 2QQSA 4FT2A 4LDUA 1VQLQ 1JRIA 2X4XA 2EFIA 1ZBJA 4C8QA 2DD5A 3LWIA 2MMPA 4BE1A 2NUPA 1SHFA 4PNOA 4M78G 3JRZA 1PKTA 1PD0A 1ZSZC 4N4IA 2LCCA 1QP3A 1D09B 1ZUUA 3PE0A 4QKUA 3GBQA 3LLRA 2SRCA 1OX8A 1V76A 1ABQA 4M75E 3EFRA 2CT3A 3VUZA 3FJPA 2EWNA 4NL2A 4M7AC 3UWNA 1WFWA 1NLOC 3LYIA 1Q81U 1Q7YU 4M78E 4MZTA 4IUPA 2NUZA 2F2XA 3SB2A 2X4JA 1VYVA 1K73C 1VQKQ 2DTIA 3CCET 2P84A 1YIJQ 2BZXA 2QTVA 3FDRA 3QO3A 4HT9A 1RAGB 4FW2A 1K73U 2RQUA 3CCST 5CKBA 2X4YA 1NE8A 4HA8A 4A54A 7AT1B 5GAMg 3L2QA 5GAN4 2B86A 3EG9A 1B34B 4PJOC 1H641 1PSEA 1UFFA 4KH0B 3VS2A 3VS1A 2X3WD 3F70A 3X26B 1AHJB 5KE2A 4OMOA 2QI2A 5AT1B 1XQHA 4M77C 2F5KA 1OX9A 1OU9A 1KD1R 3OYDA 3G71Q 1MHNA 4ZTFA 2V8IA 5I21A 2R5MA 2MK5A 3NTKA 2DD4A 2CGHA 2MWPA 3IQLA 2F2VA 1SF9A 2VXFA 3Q1JA 4LDVA 3JB9J 2AT1B 2P4TA 4JDSA 2QA4Q 3QYGB 3VS5A 4CC3A 2DZ9A 4FT4A 1VQ5T 3URGA 1GXIE 2RJDA 4AT1B 1UB4A 5FRMA 1O75A 4OB2B 1VQMT 1PWTA 1K73R 3EG2A 4BUGA 3OS1A 2E12A 1W2BA 1KC8U 1N9SA 2JVVA 4KBMB 2XI9A 3CCUT 1VQ6Q 1PG5B 3CPWP 4R56A 4C8QB 1ABOA 5KYXA 1ZHIA 2KT1A 1M5Q1 3M0RA 1WIEA 2IG0A 2E64A 1GFDA 3A8OB 4PJLA 1ZA1B 1WXUA 1YHQT 1Y96B 2HCKA 3G7ZA 1VYTA 1OOTA 2JS0A 2KNBB 1FMVA 3A8LB 2LJ1A 2PNIA 1KIKA 3BDUA 5FWBA 4HCBA 2J6KA 1IREB 1YCYA 5HK0A 2A7YA 1QWEA 2W10A 5LJ5f 3CMEQ 1PCXA 2RK1A 1M2VB 1EFNA 4QQGA 2MYSA 2LQNA 3VS3A 2DL7A 3TEEA 4XTWA 1RAAB 2VWFA 4L5GA 2XIDA 3JB9D 2QA4T 1R77A 4DOVA 2CZ1B 1IZ6A 1FYNA 2HQHA 2DMOA 1RAHB 3MEUA 3CCSA 1X6BA 2ZZDA 2JS2A 1LJOA 2ECZA 4JLGA 3L2RA 1N8RR 3REAB 1YIJA 5KYWB 4PFZA 2M02A 2EYYA 4RTXA 2K4YA 2HL5C 2VASA 1SRMA 2Y90A 4F04B 3CCVT 4LNPA 1ZX6A 2A36A 1MMAA 5GAN8 3M5AA 1VIEA 1MMDA 2FZGB 3HSBA 4LN2A 5GAMe 3L1AA 4OMNA 4C5GA 1VQOT 5D7UA 1D3BA 2VGMA 3EG3A 3CCUQ 2GCXA 4KRTA 4IIOA 5D6WA 5FU6C 2M9UA 1WQ7A 4M7DF 2RHYA 2JUFA 3X28B 4XTZA 3V8JA 4ME7A 1IB8A 2RJCA 2KT8A 4KGXB 4QVCA 2CUBA 2A0FB 5LJ3d 1IO6A 3QDFA 4EDUA 1WI7A 2DF6A 3RNJA 2V1QA 1X69A 2JJ9A 5DM7R 1QWFA 2CP0A 1I0CA 4DEXA 2EYQA 4N4GA 2E10A 4J8OA 3G6EQ 1PM3A 2HSEB 1PD1A 1RACB 1K8AC 1ZUKA 2CDTA 2CYZB 2DBKA 4CC2A 1R8OB 2EPDA 1M90R 1B07A 2HZYA 3GNGA 1T0HA 1H3HA 3G6ET 3JCMe 2VUBA 3RUXA 3CMAA 3L2UA 5LJ5d 4M7AG 4M77B 4ORZA 1C6VX 3SWNC 1MMGA 1YJWT 4BB7A 3PNWC 4ESRA 1TOVA 4KUDK 4IUQA 2D1XA 3JCMQ 3JAME 6AT1B 3WXMB 3OS0A 2ZPHB 3A8GB 1KQ1A 4FYXB 2MCNA 1PSFA 5FRNA 4DQ2A 4KGZB 2LMJA 3QHSA 2WSEE 1AOJA 4N0AA 2YLCA 3L2ZA 2JMCA 3M57A 3CCQQ 3OYCA 1YJ9T 3VYHB 4FL6A 2XK0A 1Q86U 3G4ST 1TS9A 1BIBA 3UATA 1J3TA 4Y91A 5C0MA 1WYXA 5IH2A 5CAIA 3GF5A 3EGXA 3MEAA 4AFUC 2YHTA 4F16A 4BY6C 1GCQC 3CMET 1WLPB 1WHMA 4E7LA 2D8JA 4ATOA 5DLOA 4QQDA 3QJ6A 2CZ6B 2KE9A 1UEBA 2LX9A 4B6MA 1K9MC 1PHTA 5KYUA 1Y57A 5J3BA 4JJDA 4L59A 2GF7A 1AD5A 5GAOr 1VQ8Q 1GCPA 3JB9F 2QTXA 1VQPT 2YSQA 1OV3A 5A0LA 5CQYA 1VQLA 3ZL7C 3VS0A 3OYYA 2DFUA 1WHJA 1S1NA 4QVZA 3CCLA 2FB7A 2RA2A 3HRTA 3RESA 1AWJA 3OBWA 4JRIA 1VQ7T 5GMKj 2XICA 3RDVA 1MGQA 2ED1A 4KULA 4E7HA 1WNLA 3A8HB 3I56T 4XK8E 4LDYA 3CCRQ 3VJPA 2CZ0B 1IXDA 1GBRA 3GNFB 1VUBA 4PJMA 4RCBA 1NLPC 1N5ZA 4XU2A 2Y4YA 2QDYB 3CC7A 2BKDN 4C8QF 4BY6B 1E7OA 1JJ2P 3ASKA 1YITQ 5GAN6 2J7IA 5GAN7 1VQPA 2JMAA 3H8ZA 2LNHB 4DA4A 2LC4A 1M8MA 3M56A 2QG9B 3UA7A 2AK5A 2IIMA 3M9QA 3SWNA 4BDZA 1Y71A 2HKQB 4MDWA 1YN8A 2YRCA 1K76A 2W0ZA 1M2OA 4QT7A 4QVDA 3G71T 2QQBA 3M4GA 2E3IA 2PTKA 4JS4A 1RUWA 2XG8D 2RNAA 2Y4XA 5CQXA 3FEOA
chains in the Genus database with same CATH topology
2AZVA 1SHFA 2JTEA 5GJVB 1PKTA 1AWOA 4F14A 2DE0X 1U06A 1ZUUA 2EYWA 3PE0A 2EQIA 3GBQA 3SHWA 2SRCA 4RTYA 1ZUYA 1ABQA 4OMPA 2CT3A 4CC7A 1MV3A 4AG1C 4JJBA 2RQVA 4LUDA 1KFZA 2J6OA 1YWPA 2ED0A 1GFCA 1WFWA 3A98A 2EGAA 1NLOC 4E6RA 2HDAA 3TSZA 2BZ8A 1W1FA 2C0IA 1YNZA 2F2XA 2NUZA 2YT6A 1VYVA 1M3BA 2RMOA 3VRYA 1BK2A 1TUDA 1K0SA 2BZXA 2DVJA 2BZYA 3UF4A 1TG0A 2DX1A 2VKNA 2RQUA 1BBZA 1RI9A 4RTWA 1GCQA 3EG1A 2B86A 2EVRA 1OPKA 2HSPA 1UFFA 3H0IA 4LE9A 4ZNXA 3VS2A 3VS1A 2KRMA 2X3WD 5FW9A 2EGEA 3QWXX 1W70A 3I5RA 1NEBA 4OMOA 5I11A 2L0AA 3H0HA 1JO8A 1AZEA 1FMKA 1ZLMA 2KXDA 4RTTA 3IQLA 2F2VA 1T3SA 1Y0MA 2F2WA 2KXCA 1NM7A 1PNJA 2J6FA 1RLPC 1V1CA 2K79A 3M0QA 3VS5A 4CC3A 3I35A 2M51A 1NEGA 1HSQA 4A63B 1T3LA 4HCKA 1SEMA 2KYMA 2NWMA 1PWTA 1X43A 3EG2A 4X1VA 3U23A 4JJCA 1WXTA 2D8HA 1PRMC 2LJ3A 1CSKA 2C0OA 3EG0A 2K3BA 2O2OA 1HD3A 3THKA 1ABOA 2L3QA 1Z9QA 3CQTA 1PKSA 2EBPA 2KT1A 3M0RA 1WIEA 3REBB 4WCIA 1GFDA 1LCKA 3VRZA 1K0XA 1WXUA 2HCKA 3NHNA 1VYTA 1OOTA 2JS0A 2KNBB 1U5SA 2YDLA 2LJ1A 2PNIA 1KIKA 5FWBA 2J6KA 1QKXA 1QKWA 2EW3A 2KEAA 2JM8A 2LJ0A 1NYGA 1QWEA 1YCSB 2W10A 4EIKA 3SEMA 1AWWA 2LZ6B 2ESWA 1EFNA 1MUZA 2QDLA 2LQNA 1CKBA 3VS3A 2DL7A 2LX7A 1AWXA 2A37A 4Z8AA 2GTJA 1X2KA 2GGRA 2VWFA 4J9EA 5IHNA 2DJQA 3VS4A 1GRIA 3O5ZA 2KGTA 1FYNA 2DMOA 2RQWA 1M30A 2FG0A 4JZ3A 1X6BA 1UJYA 2J06A 2FPEA 5EC7A 4HVUA 1VYUA 3M0UA 2RF0A 4Y92A 5ECAA 3TSWA 1H92A 1JXOA 2JS2A 2ECZA 2RQRA 1SHGA 3REAB 2FPFA 5HCKA 1YWOA 2OJ2A 1SPKA 1W6XA 2O9SA 2EYYA 2D0NA 2YUOA 3PVQA 4RTXA 2A28A 1K1ZA 1SRMA 1X27A 2EYZA 4LNPA 4RTUA 1ZX6A 1NYFA 2A36A 2GBQA 4D8KA 4LN2A 2OI3A 1PRLC 2I0NA 2P4RA 1AVZC 4OMNA 1M3CA 3EG3A 4HVWA 2FEIA 4KRTA 4IIOA 3EHRA 2DLPA 4LUEA 2L2PA 2FRYA 1OPLA 2H8HA 5IXFA 2KROA 1WX6A 2KT8A 2MIOA 2HEQA 2GNCA 3LH5A 4AG2C 3UA6A 2CUBA 1UJ0A 1A0NB 1IO6A 2DL8A 2FRWA 2M0YA 2BTTA 4RTZA 1AZGB 1WI7A 2DF6A 3RNJA 1AEYA 2V1QA 1X69A 4M4ZA 4J9HA 4JPBW 3M0SA 1JQQA 1UUEA 3QWYA 2DYBA 1QWFA 1I0CA 2CT4A 2FPDA 4DEXA 2AZSA 1B3QA 1MV0B 2G6FX 2JW4A 2L3SA 3JV3A 4J9FA 2KBTA 4K11A 1UHCA 2O9VA 1ZUKA 2CDTA 2DBKA 4CC2A 1BU1A 2EPDA 2HBWA 1B07A 1T0HA 2K6DA 1T0JA 1H3HA 3NGPA 3I9QA 2AKKA 1HJDA 2CUDA 4AFSC 2LQWA 2OAWA 1K9AA 3H41A 2GQIA 4J9GA 2CSQA 4ORZA 1KSWA 3NPFA 5IXBA 2RN8A 2JT4A 2ABLA 4AFZC 1OEBA 4JZ4A 1GBQA 1X2QA 2MOXA 1NG2A 3I5SA 4ESRA 1WXBA 2EYXA 2CH4A 2J05A 1G2BA 4Z89A 3FJ5A 2D1XA 2CREA 2O88A 1H8KA 2L3PA 1UGVA 3KFVA 1WDXA 1XOVA 2DNUA 1SSHA 2KYBA 3C0CA 2MCNA 5IHKA 2LMJA 2EGCA 4RTVA 1YP5A 1AOJA 4GLMA 1I1JA 2YUQA 4OMQA 2JMCA 2CH4W 2C0TA 2K9GA 1I07A 1QLYA 3RBBB 2SEMA 1VA7A 4R0KA 5L23A 3UATA 1G83A 1J3TA 1WYXA 5IH2A 4AFUC 2E5KA 2GTOA 2KRSA 4OMMA 4F16A 1QCFA 1GCQC 5I22A 2RPNA 1WLPB 3M0TA 2D8JA 5GJWB 1UG1A 1UE9A 3TVTA 3R6NA 2DBMA 2K7AA 2KE9A 2YUPA 2ROTA 1PHTA 1Y57A 4OMLA 2LP5A 4JJDA 1AD5A 1RLQC 1M3AA 1GCPA 1CKAA 4IIMA 1UDLA 2DRKA 2YSQA 1OV3A 3ZL7C 3VS0A 1E6GA 2DL4A 4D8DA 1U3OA 2LCSA 1S1NA 4J9DA 1JEGA 2DM1A 2RQTA 1GL5A 2JM9A 3VS7A 4HXJA 1AWJA 3EHQA 4J9BA 4Z88A 1SRLA 2ENMA 2O31A 1BB9A 1TUCA 2KR3A 1M27C 2ED1A 2YUNA 4AFQC 4GBQA 5IHIA 5FWCA 2KRNA 2XMFA 1ARKA 1Z9ZA 2FO0A 2V1RA 2AKLA 2DILA 3NMZC 1E6HA 1X6GA 2DRMA 1ZSGA 3EGUA 3VS6A 1GBRA 1UECA 2A08A 2JXBA 2PZ1A 2ROLA 4HVVA 1NLPC 1N5ZA 4F17A 2EKHA 1E7OA 4RUGA 2DL5A 1KJWA 2J7IA 3ULRB 1UHFA 2DA9A 4J9CA 1JXMA 1K4US 2JMAA 1WA7A 4CC4B 2LNHB 4FSSA 1M8MA 3M0PA 3UA7A 2AK5A 2CSIA 2IIMA 3H0FA 1JU5C 1YN8A 1K76A 2W0ZA 4DEYA 4QT7A 2DL3A 2VVKA 1ZBJA 3PVLA 1UTIA 2PTKA 2K2MA 1RUWA 4J9IA 2RNAA 2X3XD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AZV A;  1SHF A;  2JTE A;  5GJV B;  1PKT A;  1AWO A;  4F14 A;  2DE0 X;  1U06 A;  1ZUU A;  2EYW A;  3PE0 A;  2EQI A;  3GBQ A;  3SHW A;  2SRC A;  4RTY A;  1ZUY A;  1ABQ A;  4OMP A;  2CT3 A;  4CC7 A;  1MV3 A;  4AG1 C;  4JJB A;  2RQV A;  4LUD A;  1KFZ A;  2J6O A;  1YWP A;  2ED0 A;  1GFC A;  1WFW A;  3A98 A;  2EGA A;  1NLO C;  4E6R A;  2HDA A;  3TSZ A;  2BZ8 A;  1W1F A;  2C0I A;  1YNZ A;  2F2X A;  2NUZ A;  2YT6 A;  1VYV A;  1M3B A;  2RMO A;  3VRY A;  1BK2 A;  1TUD A;  1K0S A;  2BZX A;  2DVJ A;  2BZY A;  3UF4 A;  1TG0 A;  2DX1 A;  2VKN A;  2RQU A;  1BBZ A;  1RI9 A;  4RTW A;  1GCQ A;  3EG1 A;  2B86 A;  2EVR A;  1OPK A;  2HSP A;  1UFF A;  3H0I A;  4LE9 A;  4ZNX A;  3VS2 A;  3VS1 A;  2KRM A;  2X3W D;  5FW9 A;  2EGE A;  3QWX X;  1W70 A;  3I5R A;  1NEB A;  4OMO A;  5I11 A;  2L0A A;  3H0H A;  1JO8 A;  1AZE A;  1FMK A;  1ZLM A;  2KXD A;  4RTT A;  3IQL A;  2F2V A;  1T3S A;  1Y0M A;  2F2W A;  2KXC A;  1NM7 A;  1PNJ A;  2J6F A;  1RLP C;  1V1C A;  2K79 A;  3M0Q A;  3VS5 A;  4CC3 A;  3I35 A;  2M51 A;  1NEG A;  1HSQ A;  4A63 B;  1T3L A;  4HCK A;  1SEM A;  2KYM A;  2NWM A;  1PWT A;  1X43 A;  3EG2 A;  4X1V A;  3U23 A;  4JJC A;  1WXT A;  2D8H A;  1PRM C;  2LJ3 A;  1CSK A;  2C0O A;  3EG0 A;  2K3B A;  2O2O A;  1HD3 A;  3THK A;  1ABO A;  2L3Q A;  1Z9Q A;  3CQT A;  1PKS A;  2EBP A;  2KT1 A;  3M0R A;  1WIE A;  3REB B;  4WCI A;  1GFD A;  1LCK A;  3VRZ A;  1K0X A;  1WXU A;  2HCK A;  3NHN A;  1VYT A;  1OOT A;  2JS0 A;  2KNB B;  1U5S A;  2YDL A;  2LJ1 A;  2PNI A;  1KIK A;  5FWB A;  2J6K A;  1QKX A;  1QKW A;  2EW3 A;  2KEA A;  2JM8 A;  2LJ0 A;  1NYG A;  1QWE A;  1YCS B;  2W10 A;  4EIK A;  3SEM A;  1AWW A;  2LZ6 B;  2ESW A;  1EFN A;  1MUZ A;  2QDL A;  2LQN A;  1CKB A;  3VS3 A;  2DL7 A;  2LX7 A;  1AWX A;  2A37 A;  4Z8A A;  2GTJ A;  1X2K A;  2GGR A;  2VWF A;  4J9E A;  5IHN A;  2DJQ A;  3VS4 A;  1GRI A;  3O5Z A;  2KGT A;  1FYN A;  2DMO A;  2RQW A;  1M30 A;  2FG0 A;  4JZ3 A;  1X6B A;  1UJY A;  2J06 A;  2FPE A;  5EC7 A;  4HVU A;  1VYU A;  3M0U A;  2RF0 A;  4Y92 A;  5ECA A;  3TSW A;  1H92 A;  1JXO A;  2JS2 A;  2ECZ A;  2RQR A;  1SHG A;  3REA B;  2FPF A;  5HCK A;  1YWO A;  2OJ2 A;  1SPK A;  1W6X A;  2O9S A;  2EYY A;  2D0N A;  2YUO A;  3PVQ A;  4RTX A;  2A28 A;  1K1Z A;  1SRM A;  1X27 A;  2EYZ A;  4LNP A;  4RTU A;  1ZX6 A;  1NYF A;  2A36 A;  2GBQ A;  4D8K A;  4LN2 A;  2OI3 A;  1PRL C;  2I0N A;  2P4R A;  1AVZ C;  4OMN A;  1M3C A;  3EG3 A;  4HVW A;  2FEI A;  4KRT A;  4IIO A;  3EHR A;  2DLP A;  4LUE A;  2L2P A;  2FRY A;  1OPL A;  2H8H A;  5IXF A;  2KRO A;  1WX6 A;  2KT8 A;  2MIO A;  2HEQ A;  2GNC A;  3LH5 A;  4AG2 C;  3UA6 A;  2CUB A;  1UJ0 A;  1A0N B;  1IO6 A;  2DL8 A;  2FRW A;  2M0Y A;  2BTT A;  4RTZ A;  1AZG B;  1WI7 A;  2DF6 A;  3RNJ A;  1AEY A;  2V1Q A;  1X69 A;  4M4Z A;  4J9H A;  4JPB W;  3M0S A;  1JQQ A;  1UUE A;  3QWY A;  2DYB A;  1QWF A;  1I0C A;  2CT4 A;  2FPD A;  4DEX A;  2AZS A;  1B3Q A;  1MV0 B;  2G6F X;  2JW4 A;  2L3S A;  3JV3 A;  4J9F A;  2KBT A;  4K11 A;  1UHC A;  2O9V A;  1ZUK A;  2CDT A;  2DBK A;  4CC2 A;  1BU1 A;  2EPD A;  2HBW A;  1B07 A;  1T0H A;  2K6D A;  1T0J A;  1H3H A;  3NGP A;  3I9Q A;  2AKK A;  1HJD A;  2CUD A;  4AFS C;  2LQW A;  2OAW A;  1K9A A;  3H41 A;  2GQI A;  4J9G A;  2CSQ A;  4ORZ A;  1KSW A;  3NPF A;  5IXB A;  2RN8 A;  2JT4 A;  2ABL A;  4AFZ C;  1OEB A;  4JZ4 A;  1GBQ A;  1X2Q A;  2MOX A;  1NG2 A;  3I5S A;  4ESR A;  1WXB A;  2EYX A;  2CH4 A;  2J05 A;  1G2B A;  4Z89 A;  3FJ5 A;  2D1X A;  2CRE A;  2O88 A;  1H8K A;  2L3P A;  1UGV A;  3KFV A;  1WDX A;  1XOV A;  2DNU A;  1SSH A;  2KYB A;  3C0C A;  2MCN A;  5IHK A;  2LMJ A;  2EGC A;  4RTV A;  1YP5 A;  1AOJ A;  4GLM A;  1I1J A;  2YUQ A;  4OMQ A;  2JMC A;  2CH4 W;  2C0T A;  2K9G A;  1I07 A;  1QLY A;  3RBB B;  2SEM A;  1VA7 A;  4R0K A;  5L23 A;  3UAT A;  1G83 A;  1J3T A;  1WYX A;  5IH2 A;  4AFU C;  2E5K A;  2GTO A;  2KRS A;  4OMM A;  4F16 A;  1QCF A;  1GCQ C;  5I22 A;  2RPN A;  1WLP B;  3M0T A;  2D8J A;  5GJW B;  1UG1 A;  1UE9 A;  3TVT A;  3R6N A;  2DBM A;  2K7A A;  2KE9 A;  2YUP A;  2ROT A;  1PHT A;  1Y57 A;  4OML A;  2LP5 A;  4JJD A;  1AD5 A;  1RLQ C;  1M3A A;  1GCP A;  1CKA A;  4IIM A;  1UDL A;  2DRK A;  2YSQ A;  1OV3 A;  3ZL7 C;  3VS0 A;  1E6G A;  2DL4 A;  4D8D A;  1U3O A;  2LCS A;  1S1N A;  4J9D A;  1JEG A;  2DM1 A;  2RQT A;  1GL5 A;  2JM9 A;  3VS7 A;  4HXJ A;  1AWJ A;  3EHQ A;  4J9B A;  4Z88 A;  1SRL A;  2ENM A;  2O31 A;  1BB9 A;  1TUC A;  2KR3 A;  1M27 C;  2ED1 A;  2YUN A;  4AFQ C;  4GBQ A;  5IHI A;  5FWC A;  2KRN A;  2XMF A;  1ARK A;  1Z9Z A;  2FO0 A;  2V1R A;  2AKL A;  2DIL A;  3NMZ C;  1E6H A;  1X6G A;  2DRM A;  1ZSG A;  3EGU A;  3VS6 A;  1GBR A;  1UEC A;  2A08 A;  2JXB A;  2PZ1 A;  2ROL A;  4HVV A;  1NLP C;  1N5Z A;  4F17 A;  2EKH A;  1E7O A;  4RUG A;  2DL5 A;  1KJW A;  2J7I A;  3ULR B;  1UHF A;  2DA9 A;  4J9C A;  1JXM A;  1K4U S;  2JMA A;  1WA7 A;  4CC4 B;  2LNH B;  4FSS A;  1M8M A;  3M0P A;  3UA7 A;  2AK5 A;  2CSI A;  2IIM A;  3H0F A;  1JU5 C;  1YN8 A;  1K76 A;  2W0Z A;  4DEY A;  4QT7 A;  2DL3 A;  2VVK A;  1ZBJ A;  3PVL A;  1UTI A;  2PTK A;  2K2M A;  1RUW A;  4J9I A;  2RNA A;  2X3X D; 
#chains in the Genus database with same CATH topology
 2YXY A;  2HQE A;  2BUD A;  2MPX C;  1QVF A;  1D0Z A;  3CC7 Q;  4F14 A;  1SSF A;  4BD3 A;  2DE0 X;  1OI1 A;  3CCJ Q;  1D1C A;  3J81 E;  1YJN T;  5FU7 C;  5D6X A;  2QYZ A;  4XAX B;  1ZUY A;  4J5Y A;  2XHC A;  3EH1 A;  1MV3 A;  1WGS A;  4OVA A;  5CVI A;  4AG1 C;  4JLI A;  2RHI A;  2FL7 A;  2J6O A;  1YWP A;  3OYB A;  4ZN3 A;  1D0Y A;  3A98 A;  4O6J A;  3H6Z A;  2HDA A;  2BZ8 A;  5GAO q;  4OF1 A;  3MCA B;  4J83 A;  2C0I A;  4KH1 B;  2YT6 A;  3KBG A;  4E7S A;  3CC2 A;  3J7A F;  2RMO A;  5GAM h;  3VRY A;  1BK2 A;  2BZY A;  2H3J A;  2EJ9 A;  4C0D B;  4PJN A;  1OUL A;  3NTH A;  4JUV A;  2DX1 A;  1C1A A;  3EG1 A;  3C4S A;  1U1S A;  4M7A A;  4LE9 A;  2QQR A;  3G1J A;  4M7A F;  2KRM A;  3TU4 K;  3QII A;  3QKJ A;  1W70 A;  1NEB A;  1YBY A;  2L0A A;  3OYN A;  3HP9 A;  3S6W A;  2OTJ A;  2OTL T;  2KXD A;  4RG2 A;  4PFP A;  5LL6 S;  2F2W A;  1OYX A;  1H3Z A;  1V1C A;  4C92 C;  3ME9 A;  4DBH A;  1YIJ T;  4A63 B;  1Q82 C;  8AT1 B;  2EQU A;  1K9M U;  2H3E B;  1WJQ A;  1VOM A;  5LJ3 g;  1TH7 A;  4J6X A;  4JJC A;  2FZK B;  1WXT A;  1M1K C;  1PRM C;  3QSU A;  1EIF A;  1G3T A;  2O2O A;  2DEU A;  3QZ9 B;  1Z9Q A;  3CQT A;  5J39 A;  2ZCF B;  4E7J A;  3X24 B;  1NZ9 A;  3VRZ A;  3EFO B;  3TQ7 P;  1U5S A;  2BE7 D;  2QEX T;  4F7U G;  1QKX A;  4CI0 C;  2EW3 A;  4RG8 A;  2KEA A;  3S3M A;  4C5I A;  3JCM h;  4E7Z A;  3JB9 G;  1YCS B;  4EIK A;  2ZAE A;  3SEM A;  5D6Y A;  2ESW A;  1LPL A;  1MUZ A;  2HAX A;  4FYW B;  5GAO m;  2LX7 A;  4ZGD B;  2GTJ A;  3RKY A;  2O4X A;  3AT1 B;  2BIV A;  2GGR A;  5HY6 A;  4J9E A;  5IHN A;  5IAY A;  2RI5 A;  3VS4 A;  3T9N A;  3O5Z A;  4YTL A;  1IGU A;  1M30 A;  1NJI C;  4JZ3 A;  5GMK l;  3OQ5 A;  4II1 A;  5KCH A;  4HVU A;  1VQM A;  5GAN f;  3DB3 A;  2RF0 A;  3TSW A;  2RQR A;  2FPF A;  1W6X A;  2VC8 A;  3CPF A;  3PVQ A;  2A28 A;  4DBQ A;  1K1Z A;  2ATC B;  3AHU A;  4A4F A;  4PKC C;  2EYZ A;  5GAN 3;  2GBQ A;  4X9C A;  1XNI A;  1PRL C;  1N8R U;  2P4R A;  2PQW A;  3QDR B;  2FEI A;  3KUF A;  3EHR A;  4XU0 A;  4JRK A;  1VQ4 T;  1O9S A;  2L2P A;  4LUE A;  3JCM d;  1QVG P;  2FRY A;  3M53 A;  5GMK h;  2MIO A;  2GNC A;  4AG2 C;  3UA6 A;  4BE0 A;  3OYF A;  2KDS A;  2M1H A;  4M7D D;  1R0C B;  1Q86 C;  4C5E A;  4RTZ A;  3DB4 A;  5A0D A;  4JPB W;  2X4W A;  2DYB A;  1KQ2 A;  2CT4 A;  2FPD A;  2DER A;  2AZS A;  3OSV A;  1MV0 B;  1RAB B;  4M75 C;  1ZSZ A;  2DEQ A;  3VV0 A;  2L3S A;  2XD0 A;  4Z02 A;  2DPP B;  2KBT A;  1UHC A;  3E1S A;  1WPY A;  2CP3 A;  2LDM A;  1JJ2 A;  1YI2 T;  2LVM A;  2HBW A;  3OYK A;  2K6D A;  4LD6 A;  1T0J A;  3NGP A;  4C8Q C;  3S3N A;  3CC2 T;  1HJD A;  1Q82 R;  2LQW A;  2G3R A;  3MHX A;  1M1K R;  3CCE Q;  2E5Q A;  4PJO E;  3RER A;  3NPF A;  4BAC A;  5IXB A;  3M4Y A;  2ABL A;  4AFZ C;  1X2Q A;  1GBQ A;  2YLB A;  3CCM A;  1NG2 A;  3VKI A;  3DKM A;  1WXB A;  4J7I A;  2EYX A;  4E2F B;  3EG9 B;  1JB0 E;  1K9M R;  2O4X B;  1VQ9 T;  2PU9 B;  3OYA A;  4F7U F;  3I56 Q;  1VQN A;  2O88 A;  2DTH A;  3BFM A;  1UGV A;  1WDX A;  2QA4 A;  9ATC B;  1M1F A;  5L8R E;  3C0C A;  1KD1 C;  4ZN1 A;  3VUB A;  2R57 A;  4M7D B;  3CMA T;  1FWZ A;  3FRN A;  3G71 A;  1YP5 A;  3JSC A;  1KC8 R;  4GLM A;  2K2V A;  3V7R A;  1QCO A;  2DIQ A;  1V29 B;  1I07 A;  2SEM A;  2DXC A;  1G83 A;  3CCL Q;  2HMA A;  1OZ2 A;  2KRS A;  3I56 A;  2XKO C;  5I22 A;  5GAN e;  2RPN A;  3ER0 A;  3M0T A;  5GJW B;  1UG1 A;  2XDD A;  1YHQ Q;  3R6N A;  3OYE A;  2DBM A;  4OP0 A;  3A5Z B;  1KK7 A;  3CEY A;  3UT1 A;  4OML A;  5CK9 A;  2FHD A;  3JCM W;  2KY9 A;  1BCM A;  2DO3 A;  5GAN d;  4PFO A;  2QGG A;  4PJO F;  5GAM f;  1QVF P;  2CS7 A;  1VQ7 A;  1UDL A;  2DRK A;  4V2S A;  3C12 A;  2Z0W A;  3SDZ A;  2EJG A;  2LCS A;  1WJS A;  2ZPE B;  1JEG A;  1VQL T;  2OX7 A;  1WHK A;  3CXC P;  2JM9 A;  2RH2 A;  4F7U A;  3G4S Q;  3FB9 A;  1SRL A;  2ENM A;  2O31 A;  1TUC A;  2KR3 A;  1M27 C;  2E65 A;  5IHI A;  5FWC A;  5CR2 A;  3C95 A;  2NUT B;  3JCM b;  4EMK B;  1X01 A;  2DIL A;  3NMZ C;  1TTH B;  3PMI A;  1ZSG A;  3EGU A;  4OB3 B;  3JB9 H;  3OYI A;  4F17 A;  3PMT A;  3I55 T;  4RKU E;  4MZP A;  4RUG A;  2DL5 A;  3V7C A;  1KJW A;  1UHF A;  2GFU A;  1K4U S;  4QQ6 A;  4CC4 B;  2CP6 A;  2KAF A;  4ZTJ A;  4RCC A;  3RKX A;  3LH0 A;  1U1T A;  3CBO A;  2E1H A;  1VQN Q;  1UGR B;  1G8X A;  4NS5 A;  4J6Y A;  1N9R A;  1VIF A;  3P8D A;  3OY9 A;  2DL3 A;  3CBP A;  4HCC A;  3PVL A;  1UTI A;  3EFS A;  1IHV A;  2JZ2 A;  2LCL A;  3J80 E;  5C6S A;  4M7D A;  3EGD A;  3JCM X;  2AZV A;  2LT4 A;  1M1G A;  2QK0 A;  5GJV B;  4BDY A;  3MP6 A;  1WHH A;  2EYW A;  3SHW A;  4OMP A;  3QZ5 B;  1M1K U;  2V8K A;  3CXC S;  3NFC A;  4CC7 A;  4JJB A;  2RQV A;  4M78 D;  1ZBX A;  2ED0 A;  3EH2 A;  4M75 D;  2E3H A;  2EGA A;  3UPU A;  1U8R A;  3HTR A;  3QG1 A;  3G6E A;  1YNZ A;  1KQS S;  4KUI A;  1R0B G;  4M77 G;  2NLU A;  2ZPF B;  1M3B A;  5FLX E;  2FVU A;  1TUD A;  1Q81 C;  4FW1 A;  3UF4 A;  1TG0 A;  5GMK i;  2LT1 A;  5A2Q E;  5LJ3 f;  3P8H A;  4PJO G;  1RI9 A;  3GPL A;  1GCQ A;  3OW2 P;  2D6F A;  1OPK A;  4DBF A;  1FMW A;  2DVE A;  3H0I A;  4ZNX A;  2PVG B;  2DKG A;  2LQ8 A;  4LDW A;  4A4G A;  3FC3 A;  2EGE A;  3QWX X;  3I5R A;  4BE2 A;  3A8M B;  1FMK A;  2LRQ A;  2ZGW A;  4WF2 A;  3OSS C;  1NBE B;  3L2V A;  1UGS B;  1KHC A;  2EQM A;  2MI6 A;  5GMK m;  4RTT A;  3ZEH A;  3M54 A;  1Y0M A;  1NM7 A;  4CRI A;  2J6F A;  1RLP C;  2AHJ B;  2YRD A;  3DLL A;  2JNG A;  3I35 A;  2M51 A;  1NEG A;  4HCK A;  1SEM A;  4WTO B;  1ACM B;  2MWO A;  2C06 A;  1WZO A;  1KG1 A;  4X1V A;  4KT0 E;  4JS5 A;  1M2V A;  1G3S A;  3LWH A;  1BI0 A;  3CME A;  4FYY B;  1F1B B;  3CCS Q;  2DK3 A;  5LJ3 e;  1TSF A;  2PVO B;  1I81 A;  5CKF A;  1VQK T;  1Q81 R;  3C94 A;  4C0D C;  1CSK A;  2C0O A;  2MF2 A;  3PIP A;  3I55 A;  5GAN h;  2CKK A;  3EGX B;  4XQ3 A;  2L5Q A;  3H9N A;  3HL8 A;  1QCN A;  1KC8 C;  4B9X A;  3KXT A;  2VB6 A;  4E47 A;  3EGD B;  3REB B;  2K5L A;  4Q5W A;  3LX7 A;  4PK4 A;  1LCK A;  2P0P A;  1K8A R;  2KQW A;  3NHN A;  3OMC A;  2FYK A;  3DLM A;  5KCO A;  1YI2 Q;  4ELY C;  1TUG B;  2LJ0 A;  4XU1 A;  3BE3 A;  4UC4 A;  3SFM A;  1NPP A;  1YJ9 A;  2DXU A;  1AWW A;  4MML A;  2LZ6 B;  4VUB A;  1Y07 A;  2QDL A;  1CKB A;  1M9S A;  2A37 A;  4Z8A A;  1X2K A;  4DBR A;  4BI4 A;  4KGV B;  2DJQ A;  1QVF S;  1GRI A;  3MPU B;  1G3Y A;  2KGT A;  3E9G A;  2FG0 A;  3INZ A;  3N5B B;  1UJY A;  1S72 Q;  2FPE A;  5EC7 A;  3M55 A;  2E70 A;  3M0U A;  1H92 A;  1JXO A;  4PLL A;  5GAN 5;  5FU7 B;  3CBM A;  1Q95 G;  2OJ2 A;  1SPK A;  2O9S A;  4JRP A;  2E41 A;  5GAN 2;  3SD4 A;  4RTU A;  1NYF A;  2R5A A;  2A3L A;  2OI3 A;  2I0N A;  1G3W A;  4PJO B;  1AVZ C;  1M3C A;  3OYL A;  3MP1 A;  4HVW A;  1QP2 A;  3MEV A;  3P8B B;  2DLP A;  5GAN j;  4IUU A;  4GY5 A;  2QEX A;  4N0A C;  4A4K A;  3GP8 A;  3A1P A;  3HPW A;  4N4H A;  2H8H A;  3HHT B;  2KRO A;  5IXF A;  4FYV B;  5IT9 E;  3EAE A;  1WX6 A;  1UGP B;  5KYY B;  3OYM A;  3LH5 A;  2XU8 A;  3OYG A;  1BI3 A;  1UJ0 A;  1I5L A;  2M0Y A;  1BI1 A;  2BTT A;  4F7U B;  2DIG A;  4E7K A;  4IKF A;  1VQ9 Q;  4M4Z A;  3M0S A;  1JQQ A;  1UUE A;  3CCM T;  4C92 B;  2RJE A;  1FXX A;  2F1L A;  3CPW A;  5CKD A;  2KI7 A;  2NUT A;  1MMN A;  4C92 D;  1YI2 A;  3G4S A;  2K5I A;  1FX7 A;  2RM4 A;  5GAM j;  1D3B B;  1BU1 A;  3PGG A;  1TWB A;  2QQ9 A;  2AKK A;  3X20 B;  4AFS C;  1VQ4 Q;  1K8A U;  1K9A A;  2ZPG B;  2KMT A;  5CKE A;  2GQI A;  2V26 A;  4L6V 5;  1KSW A;  3OS2 A;  3M58 A;  3OB9 A;  4QW2 A;  2JT4 A;  2EIF A;  1OEB A;  5GAM d;  2HQX A;  3CC4 T;  2MOX A;  4OGE A;  1LVK A;  3GLX A;  1I5O B;  2VYT A;  3I5S A;  1NPR A;  4XTU A;  4TVR A;  1YIT T;  3QBY A;  1QW1 A;  2J05 A;  3CXC A;  4Z89 A;  3FJ5 A;  1H8K A;  3HRU A;  2AIR B;  1LOJ A;  1Q7Y R;  5KYU B;  2KYB A;  2JN0 A;  2P0K A;  3VU3 C;  3MKD A;  2E6Z A;  3MET A;  1KQS A;  4NOY A;  4RTV A;  1I1J A;  2YUQ A;  3CCL T;  4OMQ A;  3CCR T;  3MP8 A;  2D9T A;  4M77 A;  1Y7X A;  1S72 A;  2CH4 W;  2C0T A;  3RBB B;  2YWW A;  1C0M A;  3OBY A;  2VGN A;  4M78 C;  4F7U E;  1VQ8 A;  5L23 A;  5DY9 A;  4J6W A;  4Y28 E;  4AMC A;  4PJO A;  1IHW A;  2GTO A;  4OMM A;  1YFN A;  1P92 A;  3LGL A;  3TVT A;  1UE9 A;  3OYH A;  1Y96 A;  2OAU A;  2V8J A;  4LDX A;  2K7A A;  2YUP A;  2RB6 A;  2ROT A;  2LP5 A;  4M75 G;  2COZ A;  1RLQ C;  1M3A A;  4PLI A;  3OS5 A;  4D6W A;  4IUV A;  1WJR A;  2EQK A;  4XTY A;  4C92 A;  2DL4 A;  3WVD B;  1U3O A;  1OZ3 A;  2FZC B;  3QYH B;  2DM1 A;  2RQT A;  1Q86 R;  3VS7 A;  1GL5 A;  4HXJ A;  2CZ7 B;  4J9B A;  4Z88 A;  3VYG A;  1W2B S;  1RAF B;  4AFQ C;  3E19 A;  4GBQ A;  4M7D E;  3NTI A;  4FIB A;  2KK4 A;  2FO0 A;  3TRE A;  2DRM A;  4M7D C;  1N27 A;  1DJ7 B;  2A08 A;  2JXB A;  2ROL A;  2F69 A;  2LNV A;  2X9H A;  2EKH A;  1S72 T;  2DXT A;  1W4S A;  2KSS A;  2RD1 A;  3QJY A;  4J9C A;  1NJI R;  1WA7 A;  1HK9 A;  3MEW A;  2WSF E;  2CSI A;  2JTM A;  4FM4 B;  5GAN g;  3L2W A;  1JU5 C;  1EX4 A;  2VV5 A;  3JCM f;  3LGF A;  3CCM Q;  4OMF B;  2OTJ T;  1XJW B;  4DEY A;  2VVK A;  3RIR A;  2O01 E;  2K2M A;  3PIO A;  1BYM A;  4J9I A;  2X3X D;  1MND A;  4C0Z A;  2DYI A;  1YJW A;  3CCU A;  3QXE B;  3JCM V;  1VQP Q;  4M7D G;  1M90 U;  2JTE A;  4FU6 A;  5AYF A;  1AWO A;  2PVD B;  3D7S B;  1U06 A;  2CP7 A;  3ZBD A;  2EQI A;  4RTY A;  3HRS A;  4M7A B;  4M75 B;  4P5N A;  2D0Q B;  1KQS P;  3V7S A;  4LUD A;  1KFZ A;  4XTV A;  3SWN B;  3BDL A;  4ZGE B;  1W2B P;  1GFC A;  1D1B A;  4HKE A;  3M59 A;  1YJN Q;  1OQK A;  4E6R A;  2R58 A;  3TSZ A;  3RR6 A;  1W1F A;  1ZSZ B;  1EZZ B;  1X75 C;  1BKB A;  1VQ5 A;  1OU8 A;  1VQN T;  1WHL A;  2MAM A;  3FLG A;  2B8A A;  3S3O A;  3E9F A;  3OW2 S;  2RHZ A;  1K0S A;  2RK2 A;  5J26 A;  2DVJ A;  2NYS A;  1MNE A;  4GLK A;  5I2S A;  2JTF A;  2M16 A;  3OA6 A;  2ZPB B;  4C8Q E;  2DZC A;  2VKN A;  2HNI A;  1BBZ A;  4RTW A;  5GAO l;  2PUK B;  1KHI A;  2EVR A;  2RJF A;  5CIU A;  3CCJ T;  2HSP A;  4M75 F;  1D1A A;  5DLQ E;  5HKC A;  1RAE B;  4M77 E;  5FW9 A;  1YJN A;  2K57 A;  1TU0 B;  3V8L A;  5I11 A;  4R55 A;  3H0H A;  1G5V A;  5KYY A;  1JO8 A;  1AZE A;  3CC2 Q;  1ZLM A;  1QQJ A;  1T3S A;  1BI2 A;  3EFO A;  4C92 G;  1BIA A;  2KXC A;  3CCQ T;  1I8F A;  1PNJ A;  2K79 A;  1JJ2 S;  3M0Q A;  3X25 B;  1HSQ A;  1T3L A;  1AT1 B;  1X6O A;  3TCJ A;  2KVQ G;  2KYM A;  2NWM A;  1X43 A;  3BW1 A;  2DXB A;  3U23 A;  2IPO B;  4EMH A;  4EPC A;  3BY7 A;  2L89 A;  2RHU A;  2P0Q A;  3JCM J;  2D8H A;  2LJ3 A;  2DET A;  2XDP A;  1M4Z A;  3EG0 A;  3JCM c;  1VQM Q;  2K3B A;  3PT9 A;  1HD3 A;  3THK A;  2L3Q A;  1PKS A;  2EBP A;  2CP5 A;  3HFN A;  4WCI A;  3O8V A;  4C0F A;  1K0X A;  4BI8 B;  2DTO A;  2YDL A;  2QGF B;  3OMG A;  1VQ4 A;  1QKW A;  2JM8 A;  4BI3 A;  4OB0 B;  1NYG A;  2NUP B;  5HK3 A;  2EKO A;  4M75 A;  1VQ5 Q;  4PL6 A;  5M9O A;  5LJ3 j;  1VQ7 Q;  3RKW A;  1VQO Q;  4HCZ A;  2F5T X;  3CCV A;  1AWX A;  4M78 F;  4MZM A;  4M78 A;  1VQK A;  5FRO A;  4C0G A;  1VQ8 T;  1QMC A;  2RQW A;  4C92 E;  2RHX A;  2EQJ A;  2JOY A;  4FSX A;  2IVW A;  2J06 A;  2HKN A;  5CO7 A;  5LJ5 g;  1B7T A;  1KD1 U;  4EMK A;  1VYU A;  5KE3 A;  4Y92 A;  5ECA A;  3CCR A;  2E4H A;  3PTA A;  4J7F A;  1SHG A;  5HCK A;  1YWO A;  4JRQ A;  3HFO A;  2YUO A;  2D0N A;  2RI2 A;  5LJ5 j;  3CD6 A;  4O5V A;  1JBM A;  1X27 A;  2BE9 B;  4D8K A;  4B9W A;  2QXF A;  1VQ9 A;  3MO8 A;  3CCQ A;  5LJ5 e;  1QVP A;  3JB9 I;  3OW2 A;  2HBP A;  8ATC B;  1D0X A;  5GAO p;  1OPL A;  1RAI B;  3CC4 A;  3CCJ A;  2LTO A;  3RMQ A;  3QPH A;  2HEQ A;  1A0N B;  1M8V A;  3E2U A;  2DL8 A;  2FRW A;  2HD0 A;  5LJ5 h;  2GQV A;  3JCM g;  4C5H A;  3UDC A;  1AZG B;  1Q82 U;  4MDX A;  1AEY A;  4J9H A;  1I4K 1;  3QWY A;  1BCO A;  4FCY A;  4ELZ C;  5CCA A;  1B3Q A;  2G6F X;  3R6O A;  2JW4 A;  4M7A D;  2K3Y A;  3JV3 A;  4J9F A;  4K11 A;  1RAD B;  2O9V A;  3JCM P;  4LD9 K;  2L3R A;  1SG5 A;  4C92 F;  2LQK A;  2QQA A;  3I9Q A;  1YIT A;  4M77 D;  2CUD A;  5LJ3 h;  2OAW A;  3H41 A;  4PJJ A;  5KH6 A;  4C8Q G;  5KYX B;  4J9G A;  2CSQ A;  1HYO A;  3LW5 E;  5I2M A;  2RN8 A;  2COW A;  5IN1 A;  4JZ4 A;  1PC0 A;  1ZA2 B;  4PJO D;  2E6N A;  3L42 A;  2I2L A;  2L8D A;  3CCV Q;  4EMG A;  2CH4 A;  2PUO B;  1G2B A;  3CMA Q;  1LNX A;  4M78 B;  2OTL Q;  4M77 F;  2XDB A;  2CRE A;  1VQO A;  4OB1 B;  3OYJ A;  2L3P A;  4ZGJ B;  2VXE A;  3KFV A;  2EJF A;  2QAS A;  1XOV A;  2DNU A;  2K5F A;  1SSH A;  3CD6 Q;  1IGQ A;  2X51 A;  3QUI A;  5IHK A;  2OTJ Q;  2EGC A;  5GMK e;  3CCE A;  4RMO A;  2DAQ A;  3V8K A;  1XTD A;  1IRX A;  2K9G A;  2X35 A;  5KYN A;  4M7A E;  3RMS A;  1QLY A;  2QAZ A;  2EAY A;  1RL2 A;  1VA7 A;  2QEX Q;  1WHG A;  4IUR A;  1VQ6 T;  4R0K A;  2COY A;  3CC4 Q;  3FIF A;  5KYW A;  2E5K A;  4DOW A;  1Q7Y C;  1QCF A;  2RI3 A;  1QVG A;  4XTX A;  1QVG S;  2CP2 A;  1M90 C;  4EMK C;  3I55 Q;  2ZPI B;  3ZFJ A;  2WSC E;  1CKA A;  2HL3 A;  4OGC A;  3PFS A;  3CD6 T;  4IIM A;  3WVE B;  2DJZ A;  2WAC A;  1E6G A;  4XU3 A;  4D8D A;  3CC7 T;  1YHQ A;  4J9D A;  1B34 A;  1WQW A;  1TXQ A;  1NJI U;  3EHQ A;  1YJ9 Q;  4A53 A;  2M0O A;  1BB9 A;  5EG2 A;  4NL3 A;  2YUN A;  3MJX A;  4IUT A;  5GAO n;  1HXD A;  2KRN A;  4E7I A;  2XMF A;  3GIB A;  5A0G A;  4A4E A;  1ARK A;  1RI0 A;  1Z9Z A;  4X9D A;  4A4H A;  4JJN K;  2K3X A;  2V1R A;  2AKL A;  4HT8 A;  1E6H A;  1X6G A;  3HKS A;  2YRV A;  3VS6 A;  1N8R C;  1YJW Q;  1UEC A;  2PZ1 A;  4HVV A;  4LXC A;  4X34 A;  1N6A A;  3CPW S;  2GFA A;  5FU6 B;  3ULR B;  2DA9 A;  1SKU B;  1JXM A;  1VQ6 A;  4ANJ A;  4FSS A;  3M0P A;  4C8Q D;  1UGQ B;  3H0F A;  4MMK A;  2RO0 A;  3GOX A;  2OTL A;  1ZQ1 A;  5CKH A;  2QQS A;  4FT2 A;  4LDU A;  1VQL Q;  1JRI A;  2X4X A;  2EFI A;  1ZBJ A;  4C8Q A;  2DD5 A;  3LWI A;  2MMP A;  4BE1 A;  2NUP A;  1SHF A;  4PNO A;  4M78 G;  3JRZ A;  1PKT A;  1PD0 A;  1ZSZ C;  4N4I A;  2LCC A;  1QP3 A;  1D09 B;  1ZUU A;  3PE0 A;  4QKU A;  3GBQ A;  3LLR A;  2SRC A;  1OX8 A;  1V76 A;  1ABQ A;  4M75 E;  3EFR A;  2CT3 A;  3VUZ A;  3FJP A;  2EWN A;  4NL2 A;  4M7A C;  3UWN A;  1WFW A;  1NLO C;  3LYI A;  1Q81 U;  1Q7Y U;  4M78 E;  4MZT A;  4IUP A;  2NUZ A;  2F2X A;  3SB2 A;  2X4J A;  1VYV A;  1K73 C;  1VQK Q;  2DTI A;  3CCE T;  2P84 A;  1YIJ Q;  2BZX A;  2QTV A;  3FDR A;  3QO3 A;  4HT9 A;  1RAG B;  4FW2 A;  1K73 U;  2RQU A;  3CCS T;  5CKB A;  2X4Y A;  1NE8 A;  4HA8 A;  4A54 A;  7AT1 B;  5GAM g;  3L2Q A;  5GAN 4;  2B86 A;  3EG9 A;  1B34 B;  4PJO C;  1H64 1;  1PSE A;  1UFF A;  4KH0 B;  3VS2 A;  3VS1 A;  2X3W D;  3F70 A;  3X26 B;  1AHJ B;  5KE2 A;  4OMO A;  2QI2 A;  5AT1 B;  1XQH A;  4M77 C;  2F5K A;  1OX9 A;  1OU9 A;  1KD1 R;  3OYD A;  3G71 Q;  1MHN A;  4ZTF A;  2V8I A;  5I21 A;  2R5M A;  2MK5 A;  3NTK A;  2DD4 A;  2CGH A;  2MWP A;  3IQL A;  2F2V A;  1SF9 A;  2VXF A;  3Q1J A;  4LDV A;  3JB9 J;  2AT1 B;  2P4T A;  4JDS A;  2QA4 Q;  3QYG B;  3VS5 A;  4CC3 A;  2DZ9 A;  4FT4 A;  1VQ5 T;  3URG A;  1GXI E;  2RJD A;  4AT1 B;  1UB4 A;  5FRM A;  1O75 A;  4OB2 B;  1VQM T;  1PWT A;  1K73 R;  3EG2 A;  4BUG A;  3OS1 A;  2E12 A;  1W2B A;  1KC8 U;  1N9S A;  2JVV A;  4KBM B;  2XI9 A;  3CCU T;  1VQ6 Q;  1PG5 B;  3CPW P;  4R56 A;  4C8Q B;  1ABO A;  5KYX A;  1ZHI A;  2KT1 A;  1M5Q 1;  3M0R A;  1WIE A;  2IG0 A;  2E64 A;  1GFD A;  3A8O B;  4PJL A;  1ZA1 B;  1WXU A;  1YHQ T;  1Y96 B;  2HCK A;  3G7Z A;  1VYT A;  1OOT A;  2JS0 A;  2KNB B;  1FMV A;  3A8L B;  2LJ1 A;  2PNI A;  1KIK A;  3BDU A;  5FWB A;  4HCB A;  2J6K A;  1IRE B;  1YCY A;  5HK0 A;  2A7Y A;  1QWE A;  2W10 A;  5LJ5 f;  3CME Q;  1PCX A;  2RK1 A;  1M2V B;  1EFN A;  4QQG A;  2MYS A;  2LQN A;  3VS3 A;  2DL7 A;  3TEE A;  4XTW A;  1RAA B;  2VWF A;  4L5G A;  2XID A;  3JB9 D;  2QA4 T;  1R77 A;  4DOV A;  2CZ1 B;  1IZ6 A;  1FYN A;  2HQH A;  2DMO A;  1RAH B;  3MEU A;  3CCS A;  1X6B A;  2ZZD A;  2JS2 A;  1LJO A;  2ECZ A;  4JLG A;  3L2R A;  1N8R R;  3REA B;  1YIJ A;  5KYW B;  4PFZ A;  2M02 A;  2EYY A;  4RTX A;  2K4Y A;  2HL5 C;  2VAS A;  1SRM A;  2Y90 A;  4F04 B;  3CCV T;  4LNP A;  1ZX6 A;  2A36 A;  1MMA A;  5GAN 8;  3M5A A;  1VIE A;  1MMD A;  2FZG B;  3HSB A;  4LN2 A;  5GAM e;  3L1A A;  4OMN A;  4C5G A;  1VQO T;  5D7U A;  1D3B A;  2VGM A;  3EG3 A;  3CCU Q;  2GCX A;  4KRT A;  4IIO A;  5D6W A;  5FU6 C;  2M9U A;  1WQ7 A;  4M7D F;  2RHY A;  2JUF A;  3X28 B;  4XTZ A;  3V8J A;  4ME7 A;  1IB8 A;  2RJC A;  2KT8 A;  4KGX B;  4QVC A;  2CUB A;  2A0F B;  5LJ3 d;  1IO6 A;  3QDF A;  4EDU A;  1WI7 A;  2DF6 A;  3RNJ A;  2V1Q A;  1X69 A;  2JJ9 A;  5DM7 R;  1QWF A;  2CP0 A;  1I0C A;  4DEX A;  2EYQ A;  4N4G A;  2E10 A;  4J8O A;  3G6E Q;  1PM3 A;  2HSE B;  1PD1 A;  1RAC B;  1K8A C;  1ZUK A;  2CDT A;  2CYZ B;  2DBK A;  4CC2 A;  1R8O B;  2EPD A;  1M90 R;  1B07 A;  2HZY A;  3GNG A;  1T0H A;  1H3H A;  3G6E T;  3JCM e;  2VUB A;  3RUX A;  3CMA A;  3L2U A;  5LJ5 d;  4M7A G;  4M77 B;  4ORZ A;  1C6V X;  3SWN C;  1MMG A;  1YJW T;  4BB7 A;  3PNW C;  4ESR A;  1TOV A;  4KUD K;  4IUQ A;  2D1X A;  3JCM Q;  3JAM E;  6AT1 B;  3WXM B;  3OS0 A;  2ZPH B;  3A8G B;  1KQ1 A;  4FYX B;  2MCN A;  1PSF A;  5FRN A;  4DQ2 A;  4KGZ B;  2LMJ A;  3QHS A;  2WSE E;  1AOJ A;  4N0A A;  2YLC A;  3L2Z A;  2JMC A;  3M57 A;  3CCQ Q;  3OYC A;  1YJ9 T;  3VYH B;  4FL6 A;  2XK0 A;  1Q86 U;  3G4S T;  1TS9 A;  1BIB A;  3UAT A;  1J3T A;  4Y91 A;  5C0M A;  1WYX A;  5IH2 A;  5CAI A;  3GF5 A;  3EGX A;  3MEA A;  4AFU C;  2YHT A;  4F16 A;  4BY6 C;  1GCQ C;  3CME T;  1WLP B;  1WHM A;  4E7L A;  2D8J A;  4ATO A;  5DLO A;  4QQD A;  3QJ6 A;  2CZ6 B;  2KE9 A;  1UEB A;  2LX9 A;  4B6M A;  1K9M C;  1PHT A;  5KYU A;  1Y57 A;  5J3B A;  4JJD A;  4L59 A;  2GF7 A;  1AD5 A;  5GAO r;  1VQ8 Q;  1GCP A;  3JB9 F;  2QTX A;  1VQP T;  2YSQ A;  1OV3 A;  5A0L A;  5CQY A;  1VQL A;  3ZL7 C;  3VS0 A;  3OYY A;  2DFU A;  1WHJ A;  1S1N A;  4QVZ A;  3CCL A;  2FB7 A;  2RA2 A;  3HRT A;  3RES A;  1AWJ A;  3OBW A;  4JRI A;  1VQ7 T;  5GMK j;  2XIC A;  3RDV A;  1MGQ A;  2ED1 A;  4KUL A;  4E7H A;  1WNL A;  3A8H B;  3I56 T;  4XK8 E;  4LDY A;  3CCR Q;  3VJP A;  2CZ0 B;  1IXD A;  1GBR A;  3GNF B;  1VUB A;  4PJM A;  4RCB A;  1NLP C;  1N5Z A;  4XU2 A;  2Y4Y A;  2QDY B;  3CC7 A;  2BKD N;  4C8Q F;  4BY6 B;  1E7O A;  1JJ2 P;  3ASK A;  1YIT Q;  5GAN 6;  2J7I A;  5GAN 7;  1VQP A;  2JMA A;  3H8Z A;  2LNH B;  4DA4 A;  2LC4 A;  1M8M A;  3M56 A;  2QG9 B;  3UA7 A;  2AK5 A;  2IIM A;  3M9Q A;  3SWN A;  4BDZ A;  1Y71 A;  2HKQ B;  4MDW A;  1YN8 A;  2YRC A;  1K76 A;  2W0Z A;  1M2O A;  4QT7 A;  4QVD A;  3G71 T;  2QQB A;  3M4G A;  2E3I A;  2PTK A;  4JS4 A;  1RUW A;  2XG8 D;  2RNA A;  2Y4X A;  5CQX A;  3FEO A; 
#chains in the Genus database with same CATH homology
 2AZV A;  1SHF A;  2JTE A;  5GJV B;  1PKT A;  1AWO A;  4F14 A;  2DE0 X;  1U06 A;  1ZUU A;  2EYW A;  3PE0 A;  2EQI A;  3GBQ A;  3SHW A;  2SRC A;  4RTY A;  1ZUY A;  1ABQ A;  4OMP A;  2CT3 A;  4CC7 A;  1MV3 A;  4AG1 C;  4JJB A;  2RQV A;  4LUD A;  1KFZ A;  2J6O A;  1YWP A;  2ED0 A;  1GFC A;  1WFW A;  3A98 A;  2EGA A;  1NLO C;  4E6R A;  2HDA A;  3TSZ A;  2BZ8 A;  1W1F A;  2C0I A;  1YNZ A;  2F2X A;  2NUZ A;  2YT6 A;  1VYV A;  1M3B A;  2RMO A;  3VRY A;  1BK2 A;  1TUD A;  1K0S A;  2BZX A;  2DVJ A;  2BZY A;  3UF4 A;  1TG0 A;  2DX1 A;  2VKN A;  2RQU A;  1BBZ A;  1RI9 A;  4RTW A;  1GCQ A;  3EG1 A;  2B86 A;  2EVR A;  1OPK A;  2HSP A;  1UFF A;  3H0I A;  4LE9 A;  4ZNX A;  3VS2 A;  3VS1 A;  2KRM A;  2X3W D;  5FW9 A;  2EGE A;  3QWX X;  1W70 A;  3I5R A;  1NEB A;  4OMO A;  5I11 A;  2L0A A;  3H0H A;  1JO8 A;  1AZE A;  1FMK A;  1ZLM A;  2KXD A;  4RTT A;  3IQL A;  2F2V A;  1T3S A;  1Y0M A;  2F2W A;  2KXC A;  1NM7 A;  1PNJ A;  2J6F A;  1RLP C;  1V1C A;  2K79 A;  3M0Q A;  3VS5 A;  4CC3 A;  3I35 A;  2M51 A;  1NEG A;  1HSQ A;  4A63 B;  1T3L A;  4HCK A;  1SEM A;  2KYM A;  2NWM A;  1PWT A;  1X43 A;  3EG2 A;  4X1V A;  3U23 A;  4JJC A;  1WXT A;  2D8H A;  1PRM C;  2LJ3 A;  1CSK A;  2C0O A;  3EG0 A;  2K3B A;  2O2O A;  1HD3 A;  3THK A;  1ABO A;  2L3Q A;  1Z9Q A;  3CQT A;  1PKS A;  2EBP A;  2KT1 A;  3M0R A;  1WIE A;  3REB B;  4WCI A;  1GFD A;  1LCK A;  3VRZ A;  1K0X A;  1WXU A;  2HCK A;  3NHN A;  1VYT A;  1OOT A;  2JS0 A;  2KNB B;  1U5S A;  2YDL A;  2LJ1 A;  2PNI A;  1KIK A;  5FWB A;  2J6K A;  1QKX A;  1QKW A;  2EW3 A;  2KEA A;  2JM8 A;  2LJ0 A;  1NYG A;  1QWE A;  1YCS B;  2W10 A;  4EIK A;  3SEM A;  1AWW A;  2LZ6 B;  2ESW A;  1EFN A;  1MUZ A;  2QDL A;  2LQN A;  1CKB A;  3VS3 A;  2DL7 A;  2LX7 A;  1AWX A;  2A37 A;  4Z8A A;  2GTJ A;  1X2K A;  2GGR A;  2VWF A;  4J9E A;  5IHN A;  2DJQ A;  3VS4 A;  1GRI A;  3O5Z A;  2KGT A;  1FYN A;  2DMO A;  2RQW A;  1M30 A;  2FG0 A;  4JZ3 A;  1X6B A;  1UJY A;  2J06 A;  2FPE A;  5EC7 A;  4HVU A;  1VYU A;  3M0U A;  2RF0 A;  4Y92 A;  5ECA A;  3TSW A;  1H92 A;  1JXO A;  2JS2 A;  2ECZ A;  2RQR A;  1SHG A;  3REA B;  2FPF A;  5HCK A;  1YWO A;  2OJ2 A;  1SPK A;  1W6X A;  2O9S A;  2EYY A;  2D0N A;  2YUO A;  3PVQ A;  4RTX A;  2A28 A;  1K1Z A;  1SRM A;  1X27 A;  2EYZ A;  4LNP A;  4RTU A;  1ZX6 A;  1NYF A;  2A36 A;  2GBQ A;  4D8K A;  4LN2 A;  2OI3 A;  1PRL C;  2I0N A;  2P4R A;  1AVZ C;  4OMN A;  1M3C A;  3EG3 A;  4HVW A;  2FEI A;  4KRT A;  4IIO A;  3EHR A;  2DLP A;  4LUE A;  2L2P A;  2FRY A;  1OPL A;  2H8H A;  5IXF A;  2KRO A;  1WX6 A;  2KT8 A;  2MIO A;  2HEQ A;  2GNC A;  3LH5 A;  4AG2 C;  3UA6 A;  2CUB A;  1UJ0 A;  1A0N B;  1IO6 A;  2DL8 A;  2FRW A;  2M0Y A;  2BTT A;  4RTZ A;  1AZG B;  1WI7 A;  2DF6 A;  3RNJ A;  1AEY A;  2V1Q A;  1X69 A;  4M4Z A;  4J9H A;  4JPB W;  3M0S A;  1JQQ A;  1UUE A;  3QWY A;  2DYB A;  1QWF A;  1I0C A;  2CT4 A;  2FPD A;  4DEX A;  2AZS A;  1B3Q A;  1MV0 B;  2G6F X;  2JW4 A;  2L3S A;  3JV3 A;  4J9F A;  2KBT A;  4K11 A;  1UHC A;  2O9V A;  1ZUK A;  2CDT A;  2DBK A;  4CC2 A;  1BU1 A;  2EPD A;  2HBW A;  1B07 A;  1T0H A;  2K6D A;  1T0J A;  1H3H A;  3NGP A;  3I9Q A;  2AKK A;  1HJD A;  2CUD A;  4AFS C;  2LQW A;  2OAW A;  1K9A A;  3H41 A;  2GQI A;  4J9G A;  2CSQ A;  4ORZ A;  1KSW A;  3NPF A;  5IXB A;  2RN8 A;  2JT4 A;  2ABL A;  4AFZ C;  1OEB A;  4JZ4 A;  1GBQ A;  1X2Q A;  2MOX A;  1NG2 A;  3I5S A;  4ESR A;  1WXB A;  2EYX A;  2CH4 A;  2J05 A;  1G2B A;  4Z89 A;  3FJ5 A;  2D1X A;  2CRE A;  2O88 A;  1H8K A;  2L3P A;  1UGV A;  3KFV A;  1WDX A;  1XOV A;  2DNU A;  1SSH A;  2KYB A;  3C0C A;  2MCN A;  5IHK A;  2LMJ A;  2EGC A;  4RTV A;  1YP5 A;  1AOJ A;  4GLM A;  1I1J A;  2YUQ A;  4OMQ A;  2JMC A;  2CH4 W;  2C0T A;  2K9G A;  1I07 A;  1QLY A;  3RBB B;  2SEM A;  1VA7 A;  4R0K A;  5L23 A;  3UAT A;  1G83 A;  1J3T A;  1WYX A;  5IH2 A;  4AFU C;  2E5K A;  2GTO A;  2KRS A;  4OMM A;  4F16 A;  1QCF A;  1GCQ C;  5I22 A;  2RPN A;  1WLP B;  3M0T A;  2D8J A;  5GJW B;  1UG1 A;  1UE9 A;  3TVT A;  3R6N A;  2DBM A;  2K7A A;  2KE9 A;  2YUP A;  2ROT A;  1PHT A;  1Y57 A;  4OML A;  2LP5 A;  4JJD A;  1AD5 A;  1RLQ C;  1M3A A;  1GCP A;  1CKA A;  4IIM A;  1UDL A;  2DRK A;  2YSQ A;  1OV3 A;  3ZL7 C;  3VS0 A;  1E6G A;  2DL4 A;  4D8D A;  1U3O A;  2LCS A;  1S1N A;  4J9D A;  1JEG A;  2DM1 A;  2RQT A;  1GL5 A;  2JM9 A;  3VS7 A;  4HXJ A;  1AWJ A;  3EHQ A;  4J9B A;  4Z88 A;  1SRL A;  2ENM A;  2O31 A;  1BB9 A;  1TUC A;  2KR3 A;  1M27 C;  2ED1 A;  2YUN A;  4AFQ C;  4GBQ A;  5IHI A;  5FWC A;  2KRN A;  2XMF A;  1ARK A;  1Z9Z A;  2FO0 A;  2V1R A;  2AKL A;  2DIL A;  3NMZ C;  1E6H A;  1X6G A;  2DRM A;  1ZSG A;  3EGU A;  3VS6 A;  1GBR A;  1UEC A;  2A08 A;  2JXB A;  2PZ1 A;  2ROL A;  4HVV A;  1NLP C;  1N5Z A;  4F17 A;  2EKH A;  1E7O A;  4RUG A;  2DL5 A;  1KJW A;  2J7I A;  3ULR B;  1UHF A;  2DA9 A;  4J9C A;  1JXM A;  1K4U S;  2JMA A;  1WA7 A;  4CC4 B;  2LNH B;  4FSS A;  1M8M A;  3M0P A;  3UA7 A;  2AK5 A;  2CSI A;  2IIM A;  3H0F A;  1JU5 C;  1YN8 A;  1K76 A;  2W0Z A;  4DEY A;  4QT7 A;  2DL3 A;  2VVK A;  1ZBJ A;  3PVL A;  1UTI A;  2PTK A;  2K2M A;  1RUW A;  4J9I A;  2RNA A;  2X3X D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...