1HSQA

Solution structure of the sh3 domain of phospholipase cgamma
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
71
structure length
71
Chain Sequence
GSPTFKCAVKALFDYKAQREDELTFIKSAIIQNVEKQEGGWWRGDYGGKKQLWFPSNYVEEMVNPEGIHRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOSPHOLIPASE C-GAMMA (SH3 DOMAIN)
publication title Solution structure of the SH3 domain of phospholipase C-gamma.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Phosphoric diester hydrolase
total genus 4
structure length 71
sequence length 71
ec nomenclature ec 3.1.4.11: Phosphoinositide phospholipase C.
pdb deposition date 1994-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1hsqA00
1NEBA 1G83A 2LQNA 1KIKA 2HCKA 2K3BA 2MIOA 1AD5A 4OMLA 4E6RA 2JM8A 2EGEA 2KBTA 1I1JA 1M3BA 1X2QA 2PNIA 1A0NB 1YN8A 1GFCA 1JXMA 1X6BA 1NLOC 2CDTA 1B07A 1Z9QA 2L3SA 2L2PA 1NYGA 2RQUA 1QKWA 1GL5A 3TSWA 2DRMA 1QCFA 3KFVA 3M0UA 4J9HA 2OI3A 2DLPA 2DYBA 2J6KA 3C0CA 1PHTA 4RTTA 3GBQA 1GCPA 2BTTA 1HD3A 1VYVA 1X43A 2O2OA 1RLPC 2W10A 2VVKA 2D8HA 3EGUA 1YP5A 1YNZA 2ROTA 1UG1A 1B3QA 2V1QA 2AKLA 4J9CA 2QDLA 3VS6A 1ZLMA 3VS4A 2JMAA 2X3XD 5I11A 2NWMA 2YUPA 2HBWA 3VS0A 1Y0MA 1ZSGA 1H3HA 1WDXA 1T0JA 4JJDA 2DBKA 1UJYA 2EBPA 1YWOA 2KRSA 2D0NA 1UE9A 3JV3A 4ESRA 4AG2C 2GTJA 2JTEA 2EW3A 1AVZC 5I22A 1QLYA 1MV0B 3NMZC 1KFZA 3PVLA 1MV3A 4J9EA 1PWTA 4Y92A 2BZ8A 3H0HA 4F17A 1V1CA 4LE9A 2KGTA 3M0QA 3QWYA 4CC3A 5FW9A 1AZEA 3VRYA 3EHRA 1AOJA 1SPKA 4DEXA 2O88A 1RUWA 1NEGA 3M0SA 2JT4A 1OOTA 3PVQA 3PE0A 2DL3A 2AZSA 2K7AA 5ECAA 3EG1A 4LNPA 3LH5A 2FRYA 1FMKA 2JS2A 4M4ZA 2BZYA 1S1NA 3SEMA 2DE0X 1WFWA 2F2VA 2P4RA 2GQIA 2DRKA 1BU1A 2KE9A 2DBMA 1JU5C 2LNHB 1CKAA 1GRIA 2K6DA 2C0IA 2EYYA 1T0HA 4CC7A 2SRCA 4Z88A 4JZ4A 2F2WA 1WXBA 3ULRB 3CQTA 4HVWA 4R0KA 1CKBA 4QT7A 3IQLA 3U23A 1NG2A 2ESWA 2GNCA 1SRMA 3O5ZA 1ZUYA 2KROA 1AWJA 1XOVA 1K1ZA 2ROLA 2VKNA 4ORZA 2RNAA 2EPDA 2EGCA 1JXOA 4JPBW 2JM9A 1UGVA 2XMFA 5GJVB 2MOXA 5IHKA 1M3AA 3UA7A 2EVRA 4J9FA 1K76A 1H92A 2J6FA 1M3CA 1HSQA 1MUZA 1UDLA 2FPFA 1CSKA 3EG0A 1GFDA 2SEMA 1K0XA 1TUCA 4J9GA 5IXFA 5FWCA 3I5RA 2AK5A 2C0OA 2YUNA 2KT8A 2J05A 1SEMA 4IIMA 4OMOA 2GTOA 2LQWA 2LP5A 4OMPA 2J7IA 1KJWA 2AZVA 2EYXA 4OMMA 2ENMA 1SSHA 1Z9ZA 3H0FA 2JS0A 3QWXX 4ZNXA 2O9VA 2KYBA 1WIEA 2CH4W 2EGAA 2DVJA 2VWFA 1K0SA 1M8MA 4HVUA 1WI7A 2KRNA 1QKXA 2CSIA 3VS7A 3R6NA 5IHIA 1WLPB 2DF6A 2KXDA 4DEYA 2DA9A 2KT1A 4GLMA 2X3WD 3M0RA 1AWOA 2L3QA 4CC4B 1N5ZA 2CT3A 1AWXA 2RPNA 4AG1C 2CREA 4D8DA 1SRLA 1OPLA 2ABLA 2PTKA 3VS5A 1PKSA 2RQRA 1I0CA 3NHNA 4HXJA 2K9GA 5IH2A 1WA7A 4HVVA 5IXBA 1WXUA 1JEGA 2I0NA 2RQTA 2A37A 2JXBA 2JMCA 2RF0A 1PKTA 2K79A 1UECA 3VS3A 1KSWA 1OPKA 1TG0A 2DX1A 2W0ZA 2BZXA 4RTVA 2DJQA 2L3PA 2DMOA 4IIOA 1UTIA 2KEAA 2HSPA 1M30A 3I35A 4RTWA 3M0TA 2FG0A 4RTUA 1NYFA 1ZBJA 1GCQC 3UA6A 1UHFA 1YCSB 3NPFA 1UFFA 2YSQA 4CC2A 2G6FX 3EHQA 3REBB 1FYNA 1E6HA 3TSZA 4J9IA 2LJ3A 2F2XA 3RNJA 2GGRA 3FJ5A 4X1VA 2AKKA 1ZUKA 2L0AA 2LJ0A 2EQIA 4EIKA 2RMOA 1VA7A 2CUDA 5GJWB 4A63B 4KRTA 3NGPA 2A28A 2CT4A 1BB9A 2DL5A 1GBQA 1YWPA 3M0PA 2HDAA 2FRWA 2CH4A 2LX7A 3SHWA 2YUQA 1IO6A 1T3LA 2FO0A 3TVTA 1PNJA 1WXTA 4AFZC 1U3OA 1WX6A 2KNBB 4J9DA 2DILA 2FEIA 2MCNA 3I5SA 5FWBA 1RI9A 2EKHA 3VRZA 2CSQA 1PRLC 4J9BA 2O31A 4RTXA 1M27C 1RLQC 2ECZA 2YUOA 4JZ3A 3UATA 4JJCA 2KRMA 1PRMC 2DM1A 2V1RA 2C0TA 2GBQA 1Y57A 2YDLA 1E6GA 5HCKA 4LN2A 4OMNA 3A98A 3REAB 2ED1A 2RQVA 2H8HA 2OJ2A 1AWWA 4K11A 1ABQA 1EFNA 1OV3A 4AFSC 2RN8A 2LJ1A 3I9QA 2IIMA 1UJ0A 2M51A 1W6XA 1AEYA 2ED0A 1OEBA 2J6OA 4GBQA 2D1XA 1VYUA 2O9SA 2FPDA 4LUEA 1J3TA 1K9AA 2LMJA 1ABOA 1JO8A 1ZUUA 4RUGA 2KXCA 1W70A 3H41A 2DL8A 2KR3A 4OMQA 4D8KA 1QWFA 2JW4A 1G2BA 4F16A 1X69A 2DNUA 1WYXA 1SHFA 2DL4A 1AZGB 2EYZA 1ZX6A 5IHNA 2A36A 5EC7A 2EYWA 2K2MA 1K4US 4RTZA 4F14A 4WCIA 2E5KA 4FSSA 2OAWA 1GBRA 2CUBA 1JQQA 1E7OA 1UHCA 2RQWA 1X2KA 1U06A 1VYTA 2KYMA 1UUEA 2PZ1A 1NLPC 2M0YA 4Z89A 2J06A 3VS1A 1NM7A 3H0IA 2FPEA 2DL7A 4LUDA 2A08A 4AFQC 1I07A 3UF4A 3RBBB 2LCSA 2HEQA 1QWEA 3EG2A 1X6GA 4JJBA 1W1FA 2D8JA 3ZL7C 5L23A 1T3SA 2B86A 2NUZA 1U5SA 1LCKA 3VS2A 4RTYA 1HJDA 1GCQA 1TUDA 2LZ6B 4HCKA 1H8KA 1ARKA 1BK2A 2YT6A 3EG3A 3THKA 4AFUC 1X27A 4Z8AA 1SHGA 1BBZA
chains in the Genus database with same CATH superfamily
1NEBA 2DIGA 2HQEA 1G83A 2LQNA 3L2QA 4OMLA 2FZGB 1M3BA 1X2QA 1LJOA 2PNIA 1S72A 1YN8A 1M1KC 4GLKA 3QUIA 1R8OB 3OYYA 3PGGA 4XU0A 4M7DF 1Z9QA 2L2PA 2VXFA 1VQ5A 5GMKm 1VQ8A 1NYGA 2RQUA 1QKWA 3JCMJ 2OTJQ 5GAOn 1B34B 1VIEA 2DRMA 1QCFA 1Q82U 4IUQA 1Q82C 2OI3A 2HBPA 1HYOA 4RTTA 5IN1A 1O75A 4XAXB 1XJWB 4E7KA 2VVKA 2RHYA 3URGA 3EGUA 3CC2A 3CCLT 1R0BG 2DYIA 3A1PA 5I11A 3J81E 2CP7A 5GAMg 4RMOA 4M7AA 3J80E 4JJDA 1UJYA 2EBPA 2EQJA 5CIUA 4AG2C 2ZPFB 1BCOA 2E4HA 2GTJA 2JTEA 3G4SQ 1AVZC 1WJRA 4KH1B 4B9XA 1QLYA 2O4XA 5I22A 3CCJA 1BI2A 1KFZA 1JJ2P 1IHWA 3RKXA 4J9EA 2XICA 4Y92A 2VUBA 2EQUA 4XK8E 2CS7A 4ZN1A 1K8AC 1I8FA 3H0HA 4P5NA 4F17A 4PJOD 3QWYA 4J7IA 4M7DE 1AZEA 3EHRA 1SPKA 1NPRA 2LDMA 4LDXA 1OOTA 3PVQA 3DLLA 4QKUA 5DLOA 3L2UA 2BKDN 1KQ1A 2AZSA 4NS5A 2HQHA 4LNPA 3CCEA 2B8AA 3BFMA 4LXCA 4IKFA 1NBEB 1FMKA 2OTJT 4M4ZA 2DE0X 2LT4A 2E3IA 3A8MB 4M78A 1RAAB 3VUZA 1W2BP 2K6DA 2VC8A 2XI9A 3EGXB 3E9GA 2EYYA 3CC7A 1T0HA 4JLIA 2K5FA 2QEXT 2SRCA 2COWA 3JCMc 4M7DC 4BB7A 1H3ZA 3CCRQ 3EGDB 4M7AB 4XTWA 5HK3A 1KQSS 1ZBXA 1ZSZB 2I2LA 1ZUYA 4RG2A 4AT1B 1K1ZA 3NFCA 2ROLA 2KVQG 2VKNA 1N27A 5LJ5d 3OYAA 2ZPHB 1Q7YR 4XU3A 1K73R 1WJSA 2JM9A 1RAFB 4OF1A 1UGVA 3CD6T 4R55A 5IHKA 4MZTA 3UA7A 3I56T 2OX7A 3C95A 1CSKA 2X51A 1TUCA 2K5LA 2AK5A 2YUNA 3ME9A 1VQ7A 2J05A 6AT1B 2IVWA 4OMFB 1Y07A 3HTRA 5LL6S 2HKNA 2BE7D 2J7IA 2PUKB 4OMMA 2EJGA 5KYYA 3M9QA 1SSHA 5AT1B 4DBQA 1DJ7B 3KUFA 2DVJA 4HVUA 4FIBA 3RDVA 2KRNA 4XTYA 1QKXA 1N9SA 3VS7A 4D6WA 5GAMe 3R6NA 2PVDB 2DF6A 4WTOB 4DEYA 3JCMg 5GANf 3QHSA 4XTVA 1M2VA 4N0AC 3M0RA 4A54A 2RPNA 2DEUA 2Y4YA 1Q86R 2QQ9A 3N5BB 4DOWA 2KDSA 3P8HA 1PKSA 2QAZA 2AT1B 3G71Q 1YITA 2RQTA 2A37A 4ZGEB 2K79A 2CP6A 1RAEB 2DX1A 3OMCA 2BZXA 4M75F 2L3PA 1YJWQ 1OX9A 4PL6A 2ZZDA 3JCMP 3L1AA 1R0CB 4C0ZA 1IREB 1VQ9A 3M0TA 2FG0A 1KK7A 1UHFA 1OZ2A 4CC2A 2DETA 4BUGA 4ZGDB 3JCMQ 3JB9J 1QVPA 3JCMW 4PJJA 3REBB 3E1SA 2DO3A 1FMWA 3LLRA 1X75C 1P92A 2DAQA 4J9IA 2HNIA 1C1AA 3L42A 5GAN6 1VQMQ 4HCBA 4FCYA 2M0OA 5GJWB 1M2VB 1W4SA 3HP9A 4PLIA 1YIJA 3RERA 3M0PA 1YWPA 2HDAA 2CH4A 2MK5A 3QBYA 3BDUA 3RESA 3OYKA 3SHWA 5HY6A 2YUQA 1T3LA 4M7DA 3TVTA 3G71T 4J9DA 2MCNA 3M59A 4IUPA 1JB0E 1QW1A 1PRLC 4J9BA 1G5VA 4GY5A 3CXCP 2G3RA 2O31A 1WHKA 2HL3A 4MZMA 1JRIA 4KUIA 4JZ3A 3UATA 4LDVA 3D7SB 2KRMA 1RACB 3A5ZB 2DJZA 3FB9A 1IB8A 1Y96B 2GQVA 3RKYA 2GBQA 1YJWT 1Y57A 1E6GA 5HCKA 4OMNA 3CPWS 4X34A 2M1HA 3REAB 2XHCA 2BIVA 1VQKQ 3EAEA 1C6VX 3VU3C 4AFSC 2RN8A 2D9TA 3OB9A 1AT1B 2IIMA 2M51A 3P8BB 1QCNA 1QVFA 3DLMA 2DTHA 2F69A 4E7HA 2D1XA 3TQ7P 5HKCA 4M75C 1PCXA 1K9AA 2LMJA 1M5Q1 2XG8D 1NJIC 3V8KA 3OW2P 2RJFA 1VQMT 4D8KA 4DBRA 4OMQA 1YI2A 2JW4A 1K9MR 1ZQ1A 5KYXA 4C0DB 2LVMA 5KH6A 5LJ5j 1AZGB 4C5EA 4M7DB 2ZPIB 2A36A 4PNOA 3CCLA 3DB3A 4WCIA 4N0AA 5KYUA 1GBRA 2ATCB 3QG1A 4OGEA 2QQBA 1E7OA 1X2KA 1VYTA 1VQOQ 1NLPC 4Z89A 1OU9A 2LRQA 3VS1A 4C8QD 3X26B 3X25B 5GANd 3GNGA 4C92D 4ANJA 2A08A 4AFQC 1I07A 3RBBB 2QGFB 2CZ7B 1B7TA 2MYSA 4KGZB 4C92G 1W1FA 5L23A 3ZL7C 4FW2A 1T3SA 1K9MU 7AT1B 2B86A 2NUZA 5GAMf 4M78F 1WQ7A 4RTYA 2COYA 1HJDA 3BW1A 3FC3A 1QVGP 1WHHA 4M77F 2RHUA 2L8DA 2OTJA 4AFUC 4Z8AA 2CKKA 2XIDA 2A3LA 4PFOA 2RK2A 1HK9A 2EGEA 2HMAA 3GLXA 1N8RU 1YFNA 3SDZA 5LJ3h 3CCSQ 5KYUB 2YRDA 3UPUA 1BYMA 1GFCA 3GIBA 3AHUA 1JXMA 4A4EA 4XTXA 3CMAA 1M1GA 1B07A 2NYSA 3CBOA 2CP2A 3CCVA 2QQRA 1M4ZA 2E12A 1VQOT 1O9SA 4MDWA 2E1HA 3KFVA 4J9HA 3G4SA 1VQ4Q 3JB9I 2DLPA 2DYBA 5DY9A 3V7SA 3QJYA 1PHTA 1TUGB 2AIRB 3GBQA 3JCMh 4FM4B 2BTTA 2Y4XA 3MP6A 4BI8B 3C12A 1RLPC 3P8DA 1KC8R 2EWNA 2PQWA 3E9FA 4M78E 2KK4A 3HKSA 1N6AA 2R5AA 1X01A 4FYYB 5GMKj 2QDLA 3FLGA 1ZLMA 2X3XD 2KQWA 4F7UF 2NWMA 1JJ2A 3JSCA 4M77E 5KYWB 3OYGA 1T0JA 2XDDA 5FU7C 4Q5WA 4YTLA 2DBKA 4EMKC 1QVFP 2P0QA 3CCUA 1OI1A 2FL7A 4ESRA 2EW3A 2QGGA 1MV0B 2XDPA 3NMZC 3A8LB 4M75A 2RJCA 4EPCA 3A8OB 3CBPA 4LD9K 2QTXA 4L5GA 3MO8A 4LE9A 2KGTA 2RB6A 1FWZA 4CC3A 1AOJA 3CCST 1WHMA 4DEXA 3CCRA 3UT1A 2DEQA 2FZCB 4M77C 1W2BA 3I55Q 3M0SA 2JT4A 3PE0A 3QZ5B 4PJOC 4ZTJA 2K7AA 2JTMA 5ECAA 3AT1B 5GAN8 2JS2A 3SEMA 2GFUA 1WFWA 2F2VA 2P4RA 1WNLA 2GQIA 5J3BA 1VQLQ 2ZCFB 1VQ4T 1JU5C 2NUTB 1KD1U 5D6WA 1KD1C 2DXTA 1GRIA 5CO7A 2C0IA 2K5IA 3DKMA 3V7RA 1VQPT 5J26A 4F7UE 2YHTA 2F2WA 3G6EQ 3ULRB 4JRQA 3EH1A 2E6ZA 3LGLA 4JJNK 3HHTB 2E5QA 3U23A 2ESWA 1SRMA 3O5ZA 1MGQA 2KROA 1XOVA 2QK0A 2RD1A 4L6V5 2ZPBB 3OYIA 3QSUA 1VUBA 2QG9B 3OQ5A 4L59A 2CP5A 2RHIA 2RHXA 4ELYC 2EGCA 1JXOA 4RCCA 2L3RA 4JPBW 4IUVA 2XMFA 2MOXA 5GMKh 1TWBA 3CC4Q 2EVRA 4J9FA 4KUDK 5CVIA 1M3CA 1HSQA 1UDLA 5GMKi 1K0XA 5IXFA 5GAMd 3OMGA 4E7ZA 2WSEE 1SEMA 4A4KA 3JB9F 4IIMA 2HL5C 5DLQE 4M7AD 3I55T 2GTOA 4C5HA 3QYHB 1KJWA 2AZVA 2QEXQ 1KHIA 1TXQA 4FU6A 1Z9ZA 3H0FA 2JS0A 3H8ZA 3QWXX 8ATCB 4M7AG 4ZNXA 2MWOA 4RG8A 1WIEA 1LNXA 1MMAA 2LT1A 3LH0A 4PJLA 1K0SA 3VV0A 3ZBDA 1K8AR 1VQLT 2BE9B 1EIFA 3CCQT 1WLPB 1YJWA 2DA9A 1YJNT 2K3XA 4LD6A 2OAUA 2LQ8A 2X3WD 3VYHB 1AWOA 2L3QA 4CC4B 2CYZB 3G6ET 3LWIA 2CT3A 3CD6Q 3X28B 1OPLA 3I56Q 2PTKA 3META 4KULA 3VS5A 3OS0A 2RQRA 2FVUA 4HXJA 2DK3A 2V8JA 5IH2A 4HT9A 4HVVA 4KH0B 5IXBA 4ZN3A 1IRXA 1WPYA 1PKTA 3LYIA 4EMKA 1YJ9Q 1TG0A 3OYCA 1VQMA 2W0ZA 3CC4T 2DJQA 4EMHA 2JZ2A 3VYGA 1IHVA 1MNDA 3OS5A 4M78G 2KEAA 3OYMA 3HFOA 4RTWA 2EKOA 4RTUA 3O8VA 1GCQC 4R56A 2HD0A 5HK0A 3NPFA 2EJFA 2X35A 2G6FX 3OYFA 1H641 1FYNA 3G1JA 1IXDA 1E6HA 3TSZA 1F1BB 4M77A 2F5TX 2F2XA 2KY9A 2GGRA 4PJOA 4JS5A 1RAIB 2MPXC 1YHQQ 1VQNQ 1Q95G 1VA7A 2CUDA 4O6JA 5IT9E 3NGPA 5J39A 1BB9A 3RMSA 2O4XB 1Q81R 3CXCA 3L2ZA 2LX7A 3M58A 3HRSA 3OSVA 1VQKA 1OZ3A 1IGQA 2XD0A 2FHDA 2VYTA 4XU2A 3EFOA 2KNBB 5FU6C 4V2SA 3DB4A 2X4WA 4DOVA 2IG0A 5FWBA 2R57A 3VRZA 3C4SA 5LJ3g 4RTXA 5CAIA 5KCOA 4PFPA 5EG2A 1YJ9T 4JJCA 2DM1A 4XTZA 2X4YA 3JRZA 4LN2A 1PM3A 2KAFA 3L2VA 4M78B 2XDBA 2E41A 2EQKA 3UWNA 3OW2A 4F7UA 2H8HA 2OJ2A 4K11A 1EFNA 1LVKA 3OS2A 5CKHA 4FT4A 5CKEA 1Q81U 1UJ0A 4M77B 4LDUA 1Q7YU 1K73U 4MDXA 5AYFA 2ED0A 1OEBA 1RADB 3QDFA 2O01E 4F04B 2HKQB 1M8VA 1ABOA 1JO8A 2OTLT 1VQOA 2K3YA 2KXCA 4TVRA 1YHQT 3TCJA 1VQNT 1OQKA 2DL8A 1QWFA 4PK4A 4XU1A 3S6WA 2DZCA 1KQSP 4F16A 1V29B 3M4GA 3CMEQ 1NE8A 1X69A 3EFSA 3H9NA 4FL6A 2FB7A 1SHFA 5A0GA 2DL4A 5IHNA 2EYWA 5D7UA 2JN0A 4F14A 3QIIA 2E5KA 4BE1A 4OVAA 3JCMV 3M54A 2DXBA 1UUEA 3PMIA 3FJPA 2COZA 4J6YA 4ZTFA 3VKIA 4B6MA 3CPWA 1NM7A 5KYYB 5GAN7 2KSSA 4LUDA 2VASA 3UF4A 1LOJA 1QVGA 3Q1JA 3M53A 1Q86U 1Q86C 4F7UB 2L5QA 3EG2A 4C8QC 2D8JA 1PD0A 1TU0B 3MEUA 4M7DD 3CBMA 1U5SA 4DA4A 1LCKA 1GCQA 2RI3A 4JS4A 4M7DG 1SG5A 4CRIA 2DXUA 3HPWA 2YT6A 1WZOA 1S72T 3FIFA 3M56A 1SHGA 1BIBA 3CEYA 3C94A 2HCKA 4A53A 4E7IA 5GAOl 1SSFA 1AD5A 3RKWA 2QA4Q 4E6RA 1VQ8T 2KBTA 5CKFA 3CMET 4M75E 4PJNA 1A0NB 2A0FB 1PG5B 5LJ3e 4ATOA 2EAYA 3EFRA 4PFZA 3CC7Q 5KCHA 1NJIR 4B9WA 2LTOA 5C0MA 4EMGA 3WVEB 8AT1B 3CC2T 1ACMB 3LW5E 2E6NA 1GL5A 3V8LA 2YLCA 5GAN4 4AMCA 3M0UA 1BI0A 2J6KA 1MMGA 2EJ9A 1GCPA 3ZFJA 2W10A 2D8HA 2E65A 4OB1B 3JCMe 3PMTA 2ROTA 1UG1A 1Y7XA 2JTFA 2V1QA 4BDZA 3JB9H 3VS4A 2LC4A 2JMAA 1IZ6A 3LGFA 3VS0A 1Y0MA 1ZSGA 3I55A 1H3HA 1QCOA 3ZEHA 1WDXA 4JLGA 4Z02A 2KRSA 2Y90A 2D0NA 2RJDA 3JV3A 4RKUE 5C6SA 1VQ7Q 5GAN3 3CPFA 3S3OA 2JVVA 2QA4T 1YBYA 2BZ8A 1MMDA 2DPPB 3M0QA 5FW9A 1FXXA 5CR2A 2DIQA 3G6EA 4BDYA 1C0MA 5A0DA 4J6WA 2VB6A 2MMPA 4OB2B 2DERA 3CC7T 5FU6B 4JRIA 4HA8A 2BZYA 2H3JA 3HSBA 1N9RA 1JBMA 4ME7A 3FEOA 3MKDA 1K9MC 1BU1A 3E2UA 2RI5A 3CPWP 1CKAA 2NUPA 4NL3A 3CC4A 2QQSA 4BE2A 2D6FA 1WXBA 2QQAA 3CQTA 1D0XA 4HVWA 2WSCE 1BI3A 4PJOF 2H3EB 4R0KA 1QP3A 4QT7A 5KYXB 2GNCA 5KE2A 2ZGWA 2DD4A 1XQHA 1R77A 4C8QA 3OYHA 2DKGA 2QEXA 1N8RC 4ORZA 4J8OA 2EIFA 2RNAA 2EPDA 3RUXA 2HAXA 1VQ7T 2AHJB 4QQ6A 5GJVB 3QJ6A 3M55A 3UDCA 5GMKe 2LNVA 2J6FA 1MUZA 2FPFA 4KGVB 1D0ZA 2VV5A 2SEMA 4J9GA 2LCLA 3I5RA 2C0OA 3INZA 5LJ5h 5M9OA 3CD6A 2CP0A 4N4HA 5GAN2 2K4YA 3I56A 4NL2A 1VQPQ 4OMPA 4J7FA 2EYXA 1UGSB 1M90R 2E64A 3LWHA 2O9VA 1G8XA 2CH4W 2EGAA 4PLLA 2VWFA 3OSSC 1M8MA 4IUUA 4M75D 1ZSZC 3LX7A 1WI7A 4LDWA 1I4K1 4DBFA 3FDRA 5IAYA 1YJ9A 4C5GA 1VIFA 2GFAA 5FLXE 2IPOB 2KXDA 4PJOE 1KHCA 4M75G 4GLMA 2RHZA 1D3BA 3QYGB 2QYZA 4AG1C 1HXDA 1SRLA 1QMCA 1M1FA 2JNGA 1I0CA 1VQ9T 1JEGA 1NZ9A 3M57A 1KQ2A 2JXBA 2EFIA 5LJ3f 1PD1A 4O5VA 3RR6A 1YHQA 1KC8U 1KC8C 1M90U 2DMOA 3M5AA 1M30A 2BUDA 3I35A 2HQXA 1ZBJA 3UA6A 3OYNA 3CCQQ 1B34A 4A4HA 1YJNQ 3EHQA 1M1KR 1NPPA 1YIJT 3JCMf 2LJ3A 1D1CA 3MEVA 3RNJA 2M9UA 1WQWA 3FJ5A 4Y91A 1ZUKA 3QZ9B 2L0AA 2LJ0A 3GOXA 4EIKA 1TSFA 3V8JA 1MNEA 1ZHIA 4FYXB 1X6OA 1UB4A 4KRTA 2A28A 1Q82R 1JJ2S 1GBQA 3R6OA 4M75B 3OY9A 2DTIA 4JRKA 3CCMQ 2FO0A 3TU4K 1PNJA 1WXTA 1WX6A 2QDYB 2K2VA 3I5SA 1RI9A 5KE3A 5FRMA 3OBWA 1M1KU 1M27C 2ECZA 2YUOA 5GANj 4A4GA 1PRMC 3FRNA 2P4TA 3G71A 3MCAB 4X9CA 1WHJA 4QQGA 1WHGA 1W2BS 3CMEA 3A98A 2ED1A 2EYQA 4ELZC 4BI4A 1ABQA 4WF2A 1YI2T 1W6XA 4QQDA 1KQSA 1M2OA 2YRCA 2F5KA 2R58A 2J6OA 4GBQA 3EGXA 2FPDA 4LUEA 1J3TA 4J83A 3HFNA 2V8KA 1ZUUA 4RUGA 4E7JA 1W70A 3H41A 2P0PA 3CMAQ 2KR3A 4FSXA 3EGDA 5DM7R 1UGQB 2JJ9A 1G2BA 1ZSZA 2A7YA 2DNUA 3CCVQ 1ZX6A 4M78D 1K4US 4RTZA 2PU9B 3F70A 3CCMT 5A2QE 4OGCA 3EH2A 4M77D 4FYVB 4HT8A 2JOYA 1JQQA 1K8AU 1TS9A 4PJMA 4BY6C 3MPUB 2M0YA 1OX8A 4M77G 2J06A 5FROA 5I2SA 3H0IA 2FPEA 4PJOG 2CZ0B 3CCUQ 2XKOC 2QA4A 1X6GA 5CQYA 4JJBA 3OA6A 1GXIE 2OTLQ 5KYNA 5GAOp 3WVDB 1VQ6Q 1I5OB 3VS2A 1SKUB 5GANh 4C0DC 2E10A 4DQ2A 3L2RA 4J6XA 4FYWB 4HCKA 5LJ3d 1H8KA 3EG3A 5GMKl 2QI2A 3THKA 1VOMA 1X27A 1TOVA 4N4IA 2CGHA 1KIKA 1MHNA 2FYKA 3PFSA 3CMAT 2K3BA 2MIOA 4C8QF 3PTAA 1WJQA 1MMNA 5GAOq 2JM8A 5FU7B 4C92F 3SB2A 4EMKB 1I1JA 3CCVT 3GP8A 1KG1A 3G4ST 3X24B 1X6BA 3JCMd 1NLOC 2CDTA 4F7UG 4KGXB 2L3SA 4KT0E 4MMLA 2Z0WA 1BKBA 2L89A 3JCMX 4E2FB 3MJXA 5LJ5g 2WACA 3TSWA 1M9SA 1EX4A 5GAOm 1OULA 1Q81C 3C0CA 1Q7YC 1K73C 1HD3A 1VYVA 1X43A 4PJOB 1G3WA 2O2OA 3CCUT 1YP5A 1YNZA 1QQJA 1S72Q 2JUFA 1B3QA 2AKLA 4J9CA 1D0YA 4VUBA 3VS6A 4JRPA 4E7LA 2YUPA 2HBWA 5CCAA 1VQ6T 1ZA1B 2R5MA 3JCMb 1VQ5Q 1VQ8Q 2XK0A 1YWOA 1UE9A 4E47A 5D6YA 1BI1A 3L2WA 4BE0A 3SFMA 4C8QE 3CCRT 3EFOB 4OB0B 4BI3A 4C92E 2QASA 3PVLA 1MV3A 3CXCS 1PWTA 3BY7A 2LX9A 2M16A 1D1BA 3GPLA 3CC2Q 1BIAA 1V1CA 2XU8A 5GAMj 3VRYA 2YWWA 1SF9A 2O88A 1RUWA 1NEGA 3M4YA 2DL3A 5GAN5 1ZA2B 3EG1A 5FRNA 2DD5A 3LH5A 2FRYA 1Y96A 2HSEB 1TH7A 1S1NA 2CP3A 3CCJQ 3CCSA 2WSFE 2DRKA 4C92C 2KE9A 2DBMA 2LNHB 3OBYA 3VUBA 3T9NA 3OW2S 4CC7A 1FX7A 2HZYA 4Z88A 5CKBA 4JZ4A 3JB9D 3HL8A 1CKBA 3IQLA 1NG2A 1VQ4A 1U8RA 3JB9G 1VQ5T 1AWJA 3CCEQ 2VGNA 1VQPA 5CQXA 4JUVA 1G3YA 1D1AA 3NTKA 2LQKA 2YRVA 1M3AA 3ASKA 4DBHA 4PKCC 3QPHA 1K76A 3PT9A 1H92A 3EG0A 1GFDA 3SWNC 1RL2A 3QDRB 4IURA 5FWCA 3A8GB 1U1TA 1I5LA 2KT8A 4BACA 1YCYA 4Y28E 5LJ5e 3VJPA 4OMOA 3TREA 2V26A 2LQWA 2LP5A 2QTVA 2ENMA 3TEEA 3RMQA 1BCMA 1G3TA 1AHJB 2KYBA 2CZ1B 2VGMA 3MP8A 5GAMh 4BY6B 2RM4A 3CCJT 4OB3B 2PUOB 1QVGS 2P0KA 2CSIA 3S3MA 5IHIA 2RJEA 4J5YA 3BE3A 2KT1A 2YXYA 5LJ3j 1U1SA 3E19A 1N5ZA 1AWXA 1NJIU 2CREA 4D8DA 1VQLA 2ABLA 3MEWA 2ZAEA 3PIOA 2K57A 3CCQA 1RAHB 3HRTA 4M7AF 3NHNA 3X20B 2X4JA 3CCET 1YJNA 2K9GA 3GNFB 1WA7A 1WXUA 2P84A 1V76A 2I0NA 2X9HA 2JMCA 2RF0A 1UECA 3VS3A 1KSWA 1OPKA 4MZPA 3HRUA 2MAMA 4RTVA 3OS1A 3EG9A 1PSFA 4IUTA 4IIOA 2RI2A 5L8RE 1UTIA 3V7CA 2HSPA 4C0GA 4NOYA 4RCBA 1NYFA 1D09B 3QKJA 5I2MA 2RK1A 1YCSB 1UFFA 2YSQA 1N8RR 1FMVA 2KMTA 3CCMA 1XTDA 3OYEA 2D0QB 3NTHA 1YITQ 4C8QG 4X1VA 3JAME 2AKKA 2EQIA 1VQKT 1QVFS 2RMOA 4II1A 3OYJA 4XQ3A 2V8IA 4ZGJB 4LDYA 4A63B 1WGSA 5GANg 4C0FA 4C92A 1LPLA 2CT4A 3PNWC 5A0LA 2DZ9A 1VQ9Q 2DVEA 5KYWA 2DL5A 3MEAA 2FRWA 4QVZA 2E3HA 3OYLA 4M7AE 2M02A 2QXFA 1IO6A 1I81A 3J7AF 4AFZC 1U3OA 2MWPA 2DILA 2FEIA 2YLBA 2GCXA 4OP0A 4A4FA 1UGPB 2EKHA 1EZZB 2CSQA 3EG9B 1RLQC 3G7ZA 2KI7A 2V1RA 1YIJQ 2C0TA 2YDLA 2ZPEB 4HKEA 1OYXA 3QXEB 5CKDA 4M7AC 3RIRA 2GF7A 4X9DA 2NUPB 1PSEA 4MMKA 2RQVA 1AWWA 4FT2A 4E7SA 1OV3A 2F1LA 2MF2A 2LJ1A 3OYDA 3I9QA 3SWNA 3ER0A 2RH2A 3A8HB 1AEYA 4FW1A 2NUTA 3H6ZA 1YITT 2C06A 1RAGB 1VYUA 2O9SA 3KXTA 1G3SA 5CK9A 2RA2A 4C8QB 3KBGA 4C92B 3GF5A 4HCCA 2DFUA 3MHXA 2DXCA 2E70A 1KD1R 2NLUA 1WYXA 1TTHB 4KBMB 4EDUA 3WXMB 2EYZA 5EC7A 4HCZA 2OTLA 3OYBA 2K2MA 3SD4A 2LCCA 2ZPGB 1UGRB 1VQNA 4XTUA 4FSSA 9ATCB 1M90C 2OAWA 1VQ6A 2PVGB 2CUBA 2FZKB 1UHCA 2RQWA 4M78C 1U06A 2KYMA 2PZ1A 5GAOr 4JDSA 1IGUA 2MI6A 4QVDA 5LJ5f 4BD3A 4CI0C 1YI2Q 3MP1A 2DL7A 2PVOB 5I21A 3BDLA 1RI0A 4QW2A 5D6XA 2LCSA 1PC0A 2HEQA 2CZ6B 3QO3A 1QWEA 3CCLQ 3PIPA 3SWNB 1OU8A 3NTIA 2RO0A 2VXEA 2X4XA 4N4GA 4UC4A 1XNIA 1RABB 1D3BB 3S3NA 1TUDA 2LZ6B 4QVCA 5GANe 1UEBA 1ARKA 1BK2A 1Y71A 2EQMA 2DTOA 1QP2A 4C5IA 1WHLA 1BBZA
chains in the Genus database with same CATH topology
1NEBA 1G83A 2LQNA 1KIKA 2HCKA 2K3BA 2MIOA 1AD5A 4OMLA 4E6RA 2JM8A 2EGEA 2KBTA 1I1JA 1M3BA 1X2QA 2PNIA 1A0NB 1YN8A 1GFCA 1JXMA 1X6BA 1NLOC 2CDTA 1B07A 1Z9QA 2L3SA 2L2PA 1NYGA 2RQUA 1QKWA 1GL5A 3TSWA 2DRMA 1QCFA 3KFVA 3M0UA 4J9HA 2OI3A 2DLPA 2DYBA 2J6KA 3C0CA 1PHTA 4RTTA 3GBQA 1GCPA 2BTTA 1HD3A 1VYVA 1X43A 2O2OA 1RLPC 2W10A 2VVKA 2D8HA 3EGUA 1YP5A 1YNZA 2ROTA 1UG1A 1B3QA 2V1QA 2AKLA 4J9CA 2QDLA 3VS6A 1ZLMA 3VS4A 2JMAA 2X3XD 5I11A 2NWMA 2YUPA 2HBWA 3VS0A 1Y0MA 1ZSGA 1H3HA 1WDXA 1T0JA 4JJDA 2DBKA 1UJYA 2EBPA 1YWOA 2KRSA 2D0NA 1UE9A 3JV3A 4ESRA 4AG2C 2GTJA 2JTEA 2EW3A 1AVZC 5I22A 1QLYA 1MV0B 3NMZC 1KFZA 3PVLA 1MV3A 4J9EA 1PWTA 4Y92A 2BZ8A 3H0HA 4F17A 1V1CA 4LE9A 2KGTA 3M0QA 3QWYA 4CC3A 5FW9A 1AZEA 3VRYA 3EHRA 1AOJA 1SPKA 4DEXA 2O88A 1RUWA 1NEGA 3M0SA 2JT4A 1OOTA 3PVQA 3PE0A 2DL3A 2AZSA 2K7AA 5ECAA 3EG1A 4LNPA 3LH5A 2FRYA 1FMKA 2JS2A 4M4ZA 2BZYA 1S1NA 3SEMA 2DE0X 1WFWA 2F2VA 2P4RA 2GQIA 2DRKA 1BU1A 2KE9A 2DBMA 1JU5C 2LNHB 1CKAA 1GRIA 2K6DA 2C0IA 2EYYA 1T0HA 4CC7A 2SRCA 4Z88A 4JZ4A 2F2WA 1WXBA 3ULRB 3CQTA 4HVWA 4R0KA 1CKBA 4QT7A 3IQLA 3U23A 1NG2A 2ESWA 2GNCA 1SRMA 3O5ZA 1ZUYA 2KROA 1AWJA 1XOVA 1K1ZA 2ROLA 2VKNA 4ORZA 2RNAA 2EPDA 2EGCA 1JXOA 4JPBW 2JM9A 1UGVA 2XMFA 5GJVB 2MOXA 5IHKA 1M3AA 3UA7A 2EVRA 4J9FA 1K76A 1H92A 2J6FA 1M3CA 1HSQA 1MUZA 1UDLA 2FPFA 1CSKA 3EG0A 1GFDA 2SEMA 1K0XA 1TUCA 4J9GA 5IXFA 5FWCA 3I5RA 2AK5A 2C0OA 2YUNA 2KT8A 2J05A 1SEMA 4IIMA 4OMOA 2GTOA 2LQWA 2LP5A 4OMPA 2J7IA 1KJWA 2AZVA 2EYXA 4OMMA 2ENMA 1SSHA 1Z9ZA 3H0FA 2JS0A 3QWXX 4ZNXA 2O9VA 2KYBA 1WIEA 2CH4W 2EGAA 2DVJA 2VWFA 1K0SA 1M8MA 4HVUA 1WI7A 2KRNA 1QKXA 2CSIA 3VS7A 3R6NA 5IHIA 1WLPB 2DF6A 2KXDA 4DEYA 2DA9A 2KT1A 4GLMA 2X3WD 3M0RA 1AWOA 2L3QA 4CC4B 1N5ZA 2CT3A 1AWXA 2RPNA 4AG1C 2CREA 4D8DA 1SRLA 1OPLA 2ABLA 2PTKA 3VS5A 1PKSA 2RQRA 1I0CA 3NHNA 4HXJA 2K9GA 5IH2A 1WA7A 4HVVA 5IXBA 1WXUA 1JEGA 2I0NA 2RQTA 2A37A 2JXBA 2JMCA 2RF0A 1PKTA 2K79A 1UECA 3VS3A 1KSWA 1OPKA 1TG0A 2DX1A 2W0ZA 2BZXA 4RTVA 2DJQA 2L3PA 2DMOA 4IIOA 1UTIA 2KEAA 2HSPA 1M30A 3I35A 4RTWA 3M0TA 2FG0A 4RTUA 1NYFA 1ZBJA 1GCQC 3UA6A 1UHFA 1YCSB 3NPFA 1UFFA 2YSQA 4CC2A 2G6FX 3EHQA 3REBB 1FYNA 1E6HA 3TSZA 4J9IA 2LJ3A 2F2XA 3RNJA 2GGRA 3FJ5A 4X1VA 2AKKA 1ZUKA 2L0AA 2LJ0A 2EQIA 4EIKA 2RMOA 1VA7A 2CUDA 5GJWB 4A63B 4KRTA 3NGPA 2A28A 2CT4A 1BB9A 2DL5A 1GBQA 1YWPA 3M0PA 2HDAA 2FRWA 2CH4A 2LX7A 3SHWA 2YUQA 1IO6A 1T3LA 2FO0A 3TVTA 1PNJA 1WXTA 4AFZC 1U3OA 1WX6A 2KNBB 4J9DA 2DILA 2FEIA 2MCNA 3I5SA 5FWBA 1RI9A 2EKHA 3VRZA 2CSQA 1PRLC 4J9BA 2O31A 4RTXA 1M27C 1RLQC 2ECZA 2YUOA 4JZ3A 3UATA 4JJCA 2KRMA 1PRMC 2DM1A 2V1RA 2C0TA 2GBQA 1Y57A 2YDLA 1E6GA 5HCKA 4LN2A 4OMNA 3A98A 3REAB 2ED1A 2RQVA 2H8HA 2OJ2A 1AWWA 4K11A 1ABQA 1EFNA 1OV3A 4AFSC 2RN8A 2LJ1A 3I9QA 2IIMA 1UJ0A 2M51A 1W6XA 1AEYA 2ED0A 1OEBA 2J6OA 4GBQA 2D1XA 1VYUA 2O9SA 2FPDA 4LUEA 1J3TA 1K9AA 2LMJA 1ABOA 1JO8A 1ZUUA 4RUGA 2KXCA 1W70A 3H41A 2DL8A 2KR3A 4OMQA 4D8KA 1QWFA 2JW4A 1G2BA 4F16A 1X69A 2DNUA 1WYXA 1SHFA 2DL4A 1AZGB 2EYZA 1ZX6A 5IHNA 2A36A 5EC7A 2EYWA 2K2MA 1K4US 4RTZA 4F14A 4WCIA 2E5KA 4FSSA 2OAWA 1GBRA 2CUBA 1JQQA 1E7OA 1UHCA 2RQWA 1X2KA 1U06A 1VYTA 2KYMA 1UUEA 2PZ1A 1NLPC 2M0YA 4Z89A 2J06A 3VS1A 1NM7A 3H0IA 2FPEA 2DL7A 4LUDA 2A08A 4AFQC 1I07A 3UF4A 3RBBB 2LCSA 2HEQA 1QWEA 3EG2A 1X6GA 4JJBA 1W1FA 2D8JA 3ZL7C 5L23A 1T3SA 2B86A 2NUZA 1U5SA 1LCKA 3VS2A 4RTYA 1HJDA 1GCQA 1TUDA 2LZ6B 4HCKA 1H8KA 1ARKA 1BK2A 2YT6A 3EG3A 3THKA 4AFUC 1X27A 4Z8AA 1SHGA 1BBZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NEB A;  1G83 A;  2LQN A;  1KIK A;  2HCK A;  2K3B A;  2MIO A;  1AD5 A;  4OML A;  4E6R A;  2JM8 A;  2EGE A;  2KBT A;  1I1J A;  1M3B A;  1X2Q A;  2PNI A;  1A0N B;  1YN8 A;  1GFC A;  1JXM A;  1X6B A;  1NLO C;  2CDT A;  1B07 A;  1Z9Q A;  2L3S A;  2L2P A;  1NYG A;  2RQU A;  1QKW A;  1GL5 A;  3TSW A;  2DRM A;  1QCF A;  3KFV A;  3M0U A;  4J9H A;  2OI3 A;  2DLP A;  2DYB A;  2J6K A;  3C0C A;  1PHT A;  4RTT A;  3GBQ A;  1GCP A;  2BTT A;  1HD3 A;  1VYV A;  1X43 A;  2O2O A;  1RLP C;  2W10 A;  2VVK A;  2D8H A;  3EGU A;  1YP5 A;  1YNZ A;  2ROT A;  1UG1 A;  1B3Q A;  2V1Q A;  2AKL A;  4J9C A;  2QDL A;  3VS6 A;  1ZLM A;  3VS4 A;  2JMA A;  2X3X D;  5I11 A;  2NWM A;  2YUP A;  2HBW A;  3VS0 A;  1Y0M A;  1ZSG A;  1H3H A;  1WDX A;  1T0J A;  4JJD A;  2DBK A;  1UJY A;  2EBP A;  1YWO A;  2KRS A;  2D0N A;  1UE9 A;  3JV3 A;  4ESR A;  4AG2 C;  2GTJ A;  2JTE A;  2EW3 A;  1AVZ C;  5I22 A;  1QLY A;  1MV0 B;  3NMZ C;  1KFZ A;  3PVL A;  1MV3 A;  4J9E A;  1PWT A;  4Y92 A;  2BZ8 A;  3H0H A;  4F17 A;  1V1C A;  4LE9 A;  2KGT A;  3M0Q A;  3QWY A;  4CC3 A;  5FW9 A;  1AZE A;  3VRY A;  3EHR A;  1AOJ A;  1SPK A;  4DEX A;  2O88 A;  1RUW A;  1NEG A;  3M0S A;  2JT4 A;  1OOT A;  3PVQ A;  3PE0 A;  2DL3 A;  2AZS A;  2K7A A;  5ECA A;  3EG1 A;  4LNP A;  3LH5 A;  2FRY A;  1FMK A;  2JS2 A;  4M4Z A;  2BZY A;  1S1N A;  3SEM A;  2DE0 X;  1WFW A;  2F2V A;  2P4R A;  2GQI A;  2DRK A;  1BU1 A;  2KE9 A;  2DBM A;  1JU5 C;  2LNH B;  1CKA A;  1GRI A;  2K6D A;  2C0I A;  2EYY A;  1T0H A;  4CC7 A;  2SRC A;  4Z88 A;  4JZ4 A;  2F2W A;  1WXB A;  3ULR B;  3CQT A;  4HVW A;  4R0K A;  1CKB A;  4QT7 A;  3IQL A;  3U23 A;  1NG2 A;  2ESW A;  2GNC A;  1SRM A;  3O5Z A;  1ZUY A;  2KRO A;  1AWJ A;  1XOV A;  1K1Z A;  2ROL A;  2VKN A;  4ORZ A;  2RNA A;  2EPD A;  2EGC A;  1JXO A;  4JPB W;  2JM9 A;  1UGV A;  2XMF A;  5GJV B;  2MOX A;  5IHK A;  1M3A A;  3UA7 A;  2EVR A;  4J9F A;  1K76 A;  1H92 A;  2J6F A;  1M3C A;  1HSQ A;  1MUZ A;  1UDL A;  2FPF A;  1CSK A;  3EG0 A;  1GFD A;  2SEM A;  1K0X A;  1TUC A;  4J9G A;  5IXF A;  5FWC A;  3I5R A;  2AK5 A;  2C0O A;  2YUN A;  2KT8 A;  2J05 A;  1SEM A;  4IIM A;  4OMO A;  2GTO A;  2LQW A;  2LP5 A;  4OMP A;  2J7I A;  1KJW A;  2AZV A;  2EYX A;  4OMM A;  2ENM A;  1SSH A;  1Z9Z A;  3H0F A;  2JS0 A;  3QWX X;  4ZNX A;  2O9V A;  2KYB A;  1WIE A;  2CH4 W;  2EGA A;  2DVJ A;  2VWF A;  1K0S A;  1M8M A;  4HVU A;  1WI7 A;  2KRN A;  1QKX A;  2CSI A;  3VS7 A;  3R6N A;  5IHI A;  1WLP B;  2DF6 A;  2KXD A;  4DEY A;  2DA9 A;  2KT1 A;  4GLM A;  2X3W D;  3M0R A;  1AWO A;  2L3Q A;  4CC4 B;  1N5Z A;  2CT3 A;  1AWX A;  2RPN A;  4AG1 C;  2CRE A;  4D8D A;  1SRL A;  1OPL A;  2ABL A;  2PTK A;  3VS5 A;  1PKS A;  2RQR A;  1I0C A;  3NHN A;  4HXJ A;  2K9G A;  5IH2 A;  1WA7 A;  4HVV A;  5IXB A;  1WXU A;  1JEG A;  2I0N A;  2RQT A;  2A37 A;  2JXB A;  2JMC A;  2RF0 A;  1PKT A;  2K79 A;  1UEC A;  3VS3 A;  1KSW A;  1OPK A;  1TG0 A;  2DX1 A;  2W0Z A;  2BZX A;  4RTV A;  2DJQ A;  2L3P A;  2DMO A;  4IIO A;  1UTI A;  2KEA A;  2HSP A;  1M30 A;  3I35 A;  4RTW A;  3M0T A;  2FG0 A;  4RTU A;  1NYF A;  1ZBJ A;  1GCQ C;  3UA6 A;  1UHF A;  1YCS B;  3NPF A;  1UFF A;  2YSQ A;  4CC2 A;  2G6F X;  3EHQ A;  3REB B;  1FYN A;  1E6H A;  3TSZ A;  4J9I A;  2LJ3 A;  2F2X A;  3RNJ A;  2GGR A;  3FJ5 A;  4X1V A;  2AKK A;  1ZUK A;  2L0A A;  2LJ0 A;  2EQI A;  4EIK A;  2RMO A;  1VA7 A;  2CUD A;  5GJW B;  4A63 B;  4KRT A;  3NGP A;  2A28 A;  2CT4 A;  1BB9 A;  2DL5 A;  1GBQ A;  1YWP A;  3M0P A;  2HDA A;  2FRW A;  2CH4 A;  2LX7 A;  3SHW A;  2YUQ A;  1IO6 A;  1T3L A;  2FO0 A;  3TVT A;  1PNJ A;  1WXT A;  4AFZ C;  1U3O A;  1WX6 A;  2KNB B;  4J9D A;  2DIL A;  2FEI A;  2MCN A;  3I5S A;  5FWB A;  1RI9 A;  2EKH A;  3VRZ A;  2CSQ A;  1PRL C;  4J9B A;  2O31 A;  4RTX A;  1M27 C;  1RLQ C;  2ECZ A;  2YUO A;  4JZ3 A;  3UAT A;  4JJC A;  2KRM A;  1PRM C;  2DM1 A;  2V1R A;  2C0T A;  2GBQ A;  1Y57 A;  2YDL A;  1E6G A;  5HCK A;  4LN2 A;  4OMN A;  3A98 A;  3REA B;  2ED1 A;  2RQV A;  2H8H A;  2OJ2 A;  1AWW A;  4K11 A;  1ABQ A;  1EFN A;  1OV3 A;  4AFS C;  2RN8 A;  2LJ1 A;  3I9Q A;  2IIM A;  1UJ0 A;  2M51 A;  1W6X A;  1AEY A;  2ED0 A;  1OEB A;  2J6O A;  4GBQ A;  2D1X A;  1VYU A;  2O9S A;  2FPD A;  4LUE A;  1J3T A;  1K9A A;  2LMJ A;  1ABO A;  1JO8 A;  1ZUU A;  4RUG A;  2KXC A;  1W70 A;  3H41 A;  2DL8 A;  2KR3 A;  4OMQ A;  4D8K A;  1QWF A;  2JW4 A;  1G2B A;  4F16 A;  1X69 A;  2DNU A;  1WYX A;  1SHF A;  2DL4 A;  1AZG B;  2EYZ A;  1ZX6 A;  5IHN A;  2A36 A;  5EC7 A;  2EYW A;  2K2M A;  1K4U S;  4RTZ A;  4F14 A;  4WCI A;  2E5K A;  4FSS A;  2OAW A;  1GBR A;  2CUB A;  1JQQ A;  1E7O A;  1UHC A;  2RQW A;  1X2K A;  1U06 A;  1VYT A;  2KYM A;  1UUE A;  2PZ1 A;  1NLP C;  2M0Y A;  4Z89 A;  2J06 A;  3VS1 A;  1NM7 A;  3H0I A;  2FPE A;  2DL7 A;  4LUD A;  2A08 A;  4AFQ C;  1I07 A;  3UF4 A;  3RBB B;  2LCS A;  2HEQ A;  1QWE A;  3EG2 A;  1X6G A;  4JJB A;  1W1F A;  2D8J A;  3ZL7 C;  5L23 A;  1T3S A;  2B86 A;  2NUZ A;  1U5S A;  1LCK A;  3VS2 A;  4RTY A;  1HJD A;  1GCQ A;  1TUD A;  2LZ6 B;  4HCK A;  1H8K A;  1ARK A;  1BK2 A;  2YT6 A;  3EG3 A;  3THK A;  4AFU C;  1X27 A;  4Z8A A;  1SHG A;  1BBZ A; 
#chains in the Genus database with same CATH topology
 1NEB A;  2DIG A;  2HQE A;  1G83 A;  2LQN A;  3L2Q A;  4OML A;  2FZG B;  1M3B A;  1X2Q A;  1LJO A;  2PNI A;  1S72 A;  1YN8 A;  1M1K C;  4GLK A;  3QUI A;  1R8O B;  3OYY A;  3PGG A;  4XU0 A;  4M7D F;  1Z9Q A;  2L2P A;  2VXF A;  1VQ5 A;  5GMK m;  1VQ8 A;  1NYG A;  2RQU A;  1QKW A;  3JCM J;  2OTJ Q;  5GAO n;  1B34 B;  1VIE A;  2DRM A;  1QCF A;  1Q82 U;  4IUQ A;  1Q82 C;  2OI3 A;  2HBP A;  1HYO A;  4RTT A;  5IN1 A;  1O75 A;  4XAX B;  1XJW B;  4E7K A;  2VVK A;  2RHY A;  3URG A;  3EGU A;  3CC2 A;  3CCL T;  1R0B G;  2DYI A;  3A1P A;  5I11 A;  3J81 E;  2CP7 A;  5GAM g;  4RMO A;  4M7A A;  3J80 E;  4JJD A;  1UJY A;  2EBP A;  2EQJ A;  5CIU A;  4AG2 C;  2ZPF B;  1BCO A;  2E4H A;  2GTJ A;  2JTE A;  3G4S Q;  1AVZ C;  1WJR A;  4KH1 B;  4B9X A;  1QLY A;  2O4X A;  5I22 A;  3CCJ A;  1BI2 A;  1KFZ A;  1JJ2 P;  1IHW A;  3RKX A;  4J9E A;  2XIC A;  4Y92 A;  2VUB A;  2EQU A;  4XK8 E;  2CS7 A;  4ZN1 A;  1K8A C;  1I8F A;  3H0H A;  4P5N A;  4F17 A;  4PJO D;  3QWY A;  4J7I A;  4M7D E;  1AZE A;  3EHR A;  1SPK A;  1NPR A;  2LDM A;  4LDX A;  1OOT A;  3PVQ A;  3DLL A;  4QKU A;  5DLO A;  3L2U A;  2BKD N;  1KQ1 A;  2AZS A;  4NS5 A;  2HQH A;  4LNP A;  3CCE A;  2B8A A;  3BFM A;  4LXC A;  4IKF A;  1NBE B;  1FMK A;  2OTJ T;  4M4Z A;  2DE0 X;  2LT4 A;  2E3I A;  3A8M B;  4M78 A;  1RAA B;  3VUZ A;  1W2B P;  2K6D A;  2VC8 A;  2XI9 A;  3EGX B;  3E9G A;  2EYY A;  3CC7 A;  1T0H A;  4JLI A;  2K5F A;  2QEX T;  2SRC A;  2COW A;  3JCM c;  4M7D C;  4BB7 A;  1H3Z A;  3CCR Q;  3EGD B;  4M7A B;  4XTW A;  5HK3 A;  1KQS S;  1ZBX A;  1ZSZ B;  2I2L A;  1ZUY A;  4RG2 A;  4AT1 B;  1K1Z A;  3NFC A;  2ROL A;  2KVQ G;  2VKN A;  1N27 A;  5LJ5 d;  3OYA A;  2ZPH B;  1Q7Y R;  4XU3 A;  1K73 R;  1WJS A;  2JM9 A;  1RAF B;  4OF1 A;  1UGV A;  3CD6 T;  4R55 A;  5IHK A;  4MZT A;  3UA7 A;  3I56 T;  2OX7 A;  3C95 A;  1CSK A;  2X51 A;  1TUC A;  2K5L A;  2AK5 A;  2YUN A;  3ME9 A;  1VQ7 A;  2J05 A;  6AT1 B;  2IVW A;  4OMF B;  1Y07 A;  3HTR A;  5LL6 S;  2HKN A;  2BE7 D;  2J7I A;  2PUK B;  4OMM A;  2EJG A;  5KYY A;  3M9Q A;  1SSH A;  5AT1 B;  4DBQ A;  1DJ7 B;  3KUF A;  2DVJ A;  4HVU A;  4FIB A;  3RDV A;  2KRN A;  4XTY A;  1QKX A;  1N9S A;  3VS7 A;  4D6W A;  5GAM e;  3R6N A;  2PVD B;  2DF6 A;  4WTO B;  4DEY A;  3JCM g;  5GAN f;  3QHS A;  4XTV A;  1M2V A;  4N0A C;  3M0R A;  4A54 A;  2RPN A;  2DEU A;  2Y4Y A;  1Q86 R;  2QQ9 A;  3N5B B;  4DOW A;  2KDS A;  3P8H A;  1PKS A;  2QAZ A;  2AT1 B;  3G71 Q;  1YIT A;  2RQT A;  2A37 A;  4ZGE B;  2K79 A;  2CP6 A;  1RAE B;  2DX1 A;  3OMC A;  2BZX A;  4M75 F;  2L3P A;  1YJW Q;  1OX9 A;  4PL6 A;  2ZZD A;  3JCM P;  3L1A A;  1R0C B;  4C0Z A;  1IRE B;  1VQ9 A;  3M0T A;  2FG0 A;  1KK7 A;  1UHF A;  1OZ2 A;  4CC2 A;  2DET A;  4BUG A;  4ZGD B;  3JCM Q;  3JB9 J;  1QVP A;  3JCM W;  4PJJ A;  3REB B;  3E1S A;  2DO3 A;  1FMW A;  3LLR A;  1X75 C;  1P92 A;  2DAQ A;  4J9I A;  2HNI A;  1C1A A;  3L42 A;  5GAN 6;  1VQM Q;  4HCB A;  4FCY A;  2M0O A;  5GJW B;  1M2V B;  1W4S A;  3HP9 A;  4PLI A;  1YIJ A;  3RER A;  3M0P A;  1YWP A;  2HDA A;  2CH4 A;  2MK5 A;  3QBY A;  3BDU A;  3RES A;  3OYK A;  3SHW A;  5HY6 A;  2YUQ A;  1T3L A;  4M7D A;  3TVT A;  3G71 T;  4J9D A;  2MCN A;  3M59 A;  4IUP A;  1JB0 E;  1QW1 A;  1PRL C;  4J9B A;  1G5V A;  4GY5 A;  3CXC P;  2G3R A;  2O31 A;  1WHK A;  2HL3 A;  4MZM A;  1JRI A;  4KUI A;  4JZ3 A;  3UAT A;  4LDV A;  3D7S B;  2KRM A;  1RAC B;  3A5Z B;  2DJZ A;  3FB9 A;  1IB8 A;  1Y96 B;  2GQV A;  3RKY A;  2GBQ A;  1YJW T;  1Y57 A;  1E6G A;  5HCK A;  4OMN A;  3CPW S;  4X34 A;  2M1H A;  3REA B;  2XHC A;  2BIV A;  1VQK Q;  3EAE A;  1C6V X;  3VU3 C;  4AFS C;  2RN8 A;  2D9T A;  3OB9 A;  1AT1 B;  2IIM A;  2M51 A;  3P8B B;  1QCN A;  1QVF A;  3DLM A;  2DTH A;  2F69 A;  4E7H A;  2D1X A;  3TQ7 P;  5HKC A;  4M75 C;  1PCX A;  1K9A A;  2LMJ A;  1M5Q 1;  2XG8 D;  1NJI C;  3V8K A;  3OW2 P;  2RJF A;  1VQM T;  4D8K A;  4DBR A;  4OMQ A;  1YI2 A;  2JW4 A;  1K9M R;  1ZQ1 A;  5KYX A;  4C0D B;  2LVM A;  5KH6 A;  5LJ5 j;  1AZG B;  4C5E A;  4M7D B;  2ZPI B;  2A36 A;  4PNO A;  3CCL A;  3DB3 A;  4WCI A;  4N0A A;  5KYU A;  1GBR A;  2ATC B;  3QG1 A;  4OGE A;  2QQB A;  1E7O A;  1X2K A;  1VYT A;  1VQO Q;  1NLP C;  4Z89 A;  1OU9 A;  2LRQ A;  3VS1 A;  4C8Q D;  3X26 B;  3X25 B;  5GAN d;  3GNG A;  4C92 D;  4ANJ A;  2A08 A;  4AFQ C;  1I07 A;  3RBB B;  2QGF B;  2CZ7 B;  1B7T A;  2MYS A;  4KGZ B;  4C92 G;  1W1F A;  5L23 A;  3ZL7 C;  4FW2 A;  1T3S A;  1K9M U;  7AT1 B;  2B86 A;  2NUZ A;  5GAM f;  4M78 F;  1WQ7 A;  4RTY A;  2COY A;  1HJD A;  3BW1 A;  3FC3 A;  1QVG P;  1WHH A;  4M77 F;  2RHU A;  2L8D A;  2OTJ A;  4AFU C;  4Z8A A;  2CKK A;  2XID A;  2A3L A;  4PFO A;  2RK2 A;  1HK9 A;  2EGE A;  2HMA A;  3GLX A;  1N8R U;  1YFN A;  3SDZ A;  5LJ3 h;  3CCS Q;  5KYU B;  2YRD A;  3UPU A;  1BYM A;  1GFC A;  3GIB A;  3AHU A;  1JXM A;  4A4E A;  4XTX A;  3CMA A;  1M1G A;  1B07 A;  2NYS A;  3CBO A;  2CP2 A;  3CCV A;  2QQR A;  1M4Z A;  2E12 A;  1VQO T;  1O9S A;  4MDW A;  2E1H A;  3KFV A;  4J9H A;  3G4S A;  1VQ4 Q;  3JB9 I;  2DLP A;  2DYB A;  5DY9 A;  3V7S A;  3QJY A;  1PHT A;  1TUG B;  2AIR B;  3GBQ A;  3JCM h;  4FM4 B;  2BTT A;  2Y4X A;  3MP6 A;  4BI8 B;  3C12 A;  1RLP C;  3P8D A;  1KC8 R;  2EWN A;  2PQW A;  3E9F A;  4M78 E;  2KK4 A;  3HKS A;  1N6A A;  2R5A A;  1X01 A;  4FYY B;  5GMK j;  2QDL A;  3FLG A;  1ZLM A;  2X3X D;  2KQW A;  4F7U F;  2NWM A;  1JJ2 A;  3JSC A;  4M77 E;  5KYW B;  3OYG A;  1T0J A;  2XDD A;  5FU7 C;  4Q5W A;  4YTL A;  2DBK A;  4EMK C;  1QVF P;  2P0Q A;  3CCU A;  1OI1 A;  2FL7 A;  4ESR A;  2EW3 A;  2QGG A;  1MV0 B;  2XDP A;  3NMZ C;  3A8L B;  4M75 A;  2RJC A;  4EPC A;  3A8O B;  3CBP A;  4LD9 K;  2QTX A;  4L5G A;  3MO8 A;  4LE9 A;  2KGT A;  2RB6 A;  1FWZ A;  4CC3 A;  1AOJ A;  3CCS T;  1WHM A;  4DEX A;  3CCR A;  3UT1 A;  2DEQ A;  2FZC B;  4M77 C;  1W2B A;  3I55 Q;  3M0S A;  2JT4 A;  3PE0 A;  3QZ5 B;  4PJO C;  4ZTJ A;  2K7A A;  2JTM A;  5ECA A;  3AT1 B;  5GAN 8;  2JS2 A;  3SEM A;  2GFU A;  1WFW A;  2F2V A;  2P4R A;  1WNL A;  2GQI A;  5J3B A;  1VQL Q;  2ZCF B;  1VQ4 T;  1JU5 C;  2NUT B;  1KD1 U;  5D6W A;  1KD1 C;  2DXT A;  1GRI A;  5CO7 A;  2C0I A;  2K5I A;  3DKM A;  3V7R A;  1VQP T;  5J26 A;  4F7U E;  2YHT A;  2F2W A;  3G6E Q;  3ULR B;  4JRQ A;  3EH1 A;  2E6Z A;  3LGL A;  4JJN K;  3HHT B;  2E5Q A;  3U23 A;  2ESW A;  1SRM A;  3O5Z A;  1MGQ A;  2KRO A;  1XOV A;  2QK0 A;  2RD1 A;  4L6V 5;  2ZPB B;  3OYI A;  3QSU A;  1VUB A;  2QG9 B;  3OQ5 A;  4L59 A;  2CP5 A;  2RHI A;  2RHX A;  4ELY C;  2EGC A;  1JXO A;  4RCC A;  2L3R A;  4JPB W;  4IUV A;  2XMF A;  2MOX A;  5GMK h;  1TWB A;  3CC4 Q;  2EVR A;  4J9F A;  4KUD K;  5CVI A;  1M3C A;  1HSQ A;  1UDL A;  5GMK i;  1K0X A;  5IXF A;  5GAM d;  3OMG A;  4E7Z A;  2WSE E;  1SEM A;  4A4K A;  3JB9 F;  4IIM A;  2HL5 C;  5DLQ E;  4M7A D;  3I55 T;  2GTO A;  4C5H A;  3QYH B;  1KJW A;  2AZV A;  2QEX Q;  1KHI A;  1TXQ A;  4FU6 A;  1Z9Z A;  3H0F A;  2JS0 A;  3H8Z A;  3QWX X;  8ATC B;  4M7A G;  4ZNX A;  2MWO A;  4RG8 A;  1WIE A;  1LNX A;  1MMA A;  2LT1 A;  3LH0 A;  4PJL A;  1K0S A;  3VV0 A;  3ZBD A;  1K8A R;  1VQL T;  2BE9 B;  1EIF A;  3CCQ T;  1WLP B;  1YJW A;  2DA9 A;  1YJN T;  2K3X A;  4LD6 A;  2OAU A;  2LQ8 A;  2X3W D;  3VYH B;  1AWO A;  2L3Q A;  4CC4 B;  2CYZ B;  3G6E T;  3LWI A;  2CT3 A;  3CD6 Q;  3X28 B;  1OPL A;  3I56 Q;  2PTK A;  3MET A;  4KUL A;  3VS5 A;  3OS0 A;  2RQR A;  2FVU A;  4HXJ A;  2DK3 A;  2V8J A;  5IH2 A;  4HT9 A;  4HVV A;  4KH0 B;  5IXB A;  4ZN3 A;  1IRX A;  1WPY A;  1PKT A;  3LYI A;  4EMK A;  1YJ9 Q;  1TG0 A;  3OYC A;  1VQM A;  2W0Z A;  3CC4 T;  2DJQ A;  4EMH A;  2JZ2 A;  3VYG A;  1IHV A;  1MND A;  3OS5 A;  4M78 G;  2KEA A;  3OYM A;  3HFO A;  4RTW A;  2EKO A;  4RTU A;  3O8V A;  1GCQ C;  4R56 A;  2HD0 A;  5HK0 A;  3NPF A;  2EJF A;  2X35 A;  2G6F X;  3OYF A;  1H64 1;  1FYN A;  3G1J A;  1IXD A;  1E6H A;  3TSZ A;  1F1B B;  4M77 A;  2F5T X;  2F2X A;  2KY9 A;  2GGR A;  4PJO A;  4JS5 A;  1RAI B;  2MPX C;  1YHQ Q;  1VQN Q;  1Q95 G;  1VA7 A;  2CUD A;  4O6J A;  5IT9 E;  3NGP A;  5J39 A;  1BB9 A;  3RMS A;  2O4X B;  1Q81 R;  3CXC A;  3L2Z A;  2LX7 A;  3M58 A;  3HRS A;  3OSV A;  1VQK A;  1OZ3 A;  1IGQ A;  2XD0 A;  2FHD A;  2VYT A;  4XU2 A;  3EFO A;  2KNB B;  5FU6 C;  4V2S A;  3DB4 A;  2X4W A;  4DOV A;  2IG0 A;  5FWB A;  2R57 A;  3VRZ A;  3C4S A;  5LJ3 g;  4RTX A;  5CAI A;  5KCO A;  4PFP A;  5EG2 A;  1YJ9 T;  4JJC A;  2DM1 A;  4XTZ A;  2X4Y A;  3JRZ A;  4LN2 A;  1PM3 A;  2KAF A;  3L2V A;  4M78 B;  2XDB A;  2E41 A;  2EQK A;  3UWN A;  3OW2 A;  4F7U A;  2H8H A;  2OJ2 A;  4K11 A;  1EFN A;  1LVK A;  3OS2 A;  5CKH A;  4FT4 A;  5CKE A;  1Q81 U;  1UJ0 A;  4M77 B;  4LDU A;  1Q7Y U;  1K73 U;  4MDX A;  5AYF A;  2ED0 A;  1OEB A;  1RAD B;  3QDF A;  2O01 E;  4F04 B;  2HKQ B;  1M8V A;  1ABO A;  1JO8 A;  2OTL T;  1VQO A;  2K3Y A;  2KXC A;  4TVR A;  1YHQ T;  3TCJ A;  1VQN T;  1OQK A;  2DL8 A;  1QWF A;  4PK4 A;  4XU1 A;  3S6W A;  2DZC A;  1KQS P;  4F16 A;  1V29 B;  3M4G A;  3CME Q;  1NE8 A;  1X69 A;  3EFS A;  3H9N A;  4FL6 A;  2FB7 A;  1SHF A;  5A0G A;  2DL4 A;  5IHN A;  2EYW A;  5D7U A;  2JN0 A;  4F14 A;  3QII A;  2E5K A;  4BE1 A;  4OVA A;  3JCM V;  3M54 A;  2DXB A;  1UUE A;  3PMI A;  3FJP A;  2COZ A;  4J6Y A;  4ZTF A;  3VKI A;  4B6M A;  3CPW A;  1NM7 A;  5KYY B;  5GAN 7;  2KSS A;  4LUD A;  2VAS A;  3UF4 A;  1LOJ A;  1QVG A;  3Q1J A;  3M53 A;  1Q86 U;  1Q86 C;  4F7U B;  2L5Q A;  3EG2 A;  4C8Q C;  2D8J A;  1PD0 A;  1TU0 B;  3MEU A;  4M7D D;  3CBM A;  1U5S A;  4DA4 A;  1LCK A;  1GCQ A;  2RI3 A;  4JS4 A;  4M7D G;  1SG5 A;  4CRI A;  2DXU A;  3HPW A;  2YT6 A;  1WZO A;  1S72 T;  3FIF A;  3M56 A;  1SHG A;  1BIB A;  3CEY A;  3C94 A;  2HCK A;  4A53 A;  4E7I A;  5GAO l;  1SSF A;  1AD5 A;  3RKW A;  2QA4 Q;  4E6R A;  1VQ8 T;  2KBT A;  5CKF A;  3CME T;  4M75 E;  4PJN A;  1A0N B;  2A0F B;  1PG5 B;  5LJ3 e;  4ATO A;  2EAY A;  3EFR A;  4PFZ A;  3CC7 Q;  5KCH A;  1NJI R;  4B9W A;  2LTO A;  5C0M A;  4EMG A;  3WVE B;  8AT1 B;  3CC2 T;  1ACM B;  3LW5 E;  2E6N A;  1GL5 A;  3V8L A;  2YLC A;  5GAN 4;  4AMC A;  3M0U A;  1BI0 A;  2J6K A;  1MMG A;  2EJ9 A;  1GCP A;  3ZFJ A;  2W10 A;  2D8H A;  2E65 A;  4OB1 B;  3JCM e;  3PMT A;  2ROT A;  1UG1 A;  1Y7X A;  2JTF A;  2V1Q A;  4BDZ A;  3JB9 H;  3VS4 A;  2LC4 A;  2JMA A;  1IZ6 A;  3LGF A;  3VS0 A;  1Y0M A;  1ZSG A;  3I55 A;  1H3H A;  1QCO A;  3ZEH A;  1WDX A;  4JLG A;  4Z02 A;  2KRS A;  2Y90 A;  2D0N A;  2RJD A;  3JV3 A;  4RKU E;  5C6S A;  1VQ7 Q;  5GAN 3;  3CPF A;  3S3O A;  2JVV A;  2QA4 T;  1YBY A;  2BZ8 A;  1MMD A;  2DPP B;  3M0Q A;  5FW9 A;  1FXX A;  5CR2 A;  2DIQ A;  3G6E A;  4BDY A;  1C0M A;  5A0D A;  4J6W A;  2VB6 A;  2MMP A;  4OB2 B;  2DER A;  3CC7 T;  5FU6 B;  4JRI A;  4HA8 A;  2BZY A;  2H3J A;  3HSB A;  1N9R A;  1JBM A;  4ME7 A;  3FEO A;  3MKD A;  1K9M C;  1BU1 A;  3E2U A;  2RI5 A;  3CPW P;  1CKA A;  2NUP A;  4NL3 A;  3CC4 A;  2QQS A;  4BE2 A;  2D6F A;  1WXB A;  2QQA A;  3CQT A;  1D0X A;  4HVW A;  2WSC E;  1BI3 A;  4PJO F;  2H3E B;  4R0K A;  1QP3 A;  4QT7 A;  5KYX B;  2GNC A;  5KE2 A;  2ZGW A;  2DD4 A;  1XQH A;  1R77 A;  4C8Q A;  3OYH A;  2DKG A;  2QEX A;  1N8R C;  4ORZ A;  4J8O A;  2EIF A;  2RNA A;  2EPD A;  3RUX A;  2HAX A;  1VQ7 T;  2AHJ B;  4QQ6 A;  5GJV B;  3QJ6 A;  3M55 A;  3UDC A;  5GMK e;  2LNV A;  2J6F A;  1MUZ A;  2FPF A;  4KGV B;  1D0Z A;  2VV5 A;  2SEM A;  4J9G A;  2LCL A;  3I5R A;  2C0O A;  3INZ A;  5LJ5 h;  5M9O A;  3CD6 A;  2CP0 A;  4N4H A;  5GAN 2;  2K4Y A;  3I56 A;  4NL2 A;  1VQP Q;  4OMP A;  4J7F A;  2EYX A;  1UGS B;  1M90 R;  2E64 A;  3LWH A;  2O9V A;  1G8X A;  2CH4 W;  2EGA A;  4PLL A;  2VWF A;  3OSS C;  1M8M A;  4IUU A;  4M75 D;  1ZSZ C;  3LX7 A;  1WI7 A;  4LDW A;  1I4K 1;  4DBF A;  3FDR A;  5IAY A;  1YJ9 A;  4C5G A;  1VIF A;  2GFA A;  5FLX E;  2IPO B;  2KXD A;  4PJO E;  1KHC A;  4M75 G;  4GLM A;  2RHZ A;  1D3B A;  3QYG B;  2QYZ A;  4AG1 C;  1HXD A;  1SRL A;  1QMC A;  1M1F A;  2JNG A;  1I0C A;  1VQ9 T;  1JEG A;  1NZ9 A;  3M57 A;  1KQ2 A;  2JXB A;  2EFI A;  5LJ3 f;  1PD1 A;  4O5V A;  3RR6 A;  1YHQ A;  1KC8 U;  1KC8 C;  1M90 U;  2DMO A;  3M5A A;  1M30 A;  2BUD A;  3I35 A;  2HQX A;  1ZBJ A;  3UA6 A;  3OYN A;  3CCQ Q;  1B34 A;  4A4H A;  1YJN Q;  3EHQ A;  1M1K R;  1NPP A;  1YIJ T;  3JCM f;  2LJ3 A;  1D1C A;  3MEV A;  3RNJ A;  2M9U A;  1WQW A;  3FJ5 A;  4Y91 A;  1ZUK A;  3QZ9 B;  2L0A A;  2LJ0 A;  3GOX A;  4EIK A;  1TSF A;  3V8J A;  1MNE A;  1ZHI A;  4FYX B;  1X6O A;  1UB4 A;  4KRT A;  2A28 A;  1Q82 R;  1JJ2 S;  1GBQ A;  3R6O A;  4M75 B;  3OY9 A;  2DTI A;  4JRK A;  3CCM Q;  2FO0 A;  3TU4 K;  1PNJ A;  1WXT A;  1WX6 A;  2QDY B;  2K2V A;  3I5S A;  1RI9 A;  5KE3 A;  5FRM A;  3OBW A;  1M1K U;  1M27 C;  2ECZ A;  2YUO A;  5GAN j;  4A4G A;  1PRM C;  3FRN A;  2P4T A;  3G71 A;  3MCA B;  4X9C A;  1WHJ A;  4QQG A;  1WHG A;  1W2B S;  3CME A;  3A98 A;  2ED1 A;  2EYQ A;  4ELZ C;  4BI4 A;  1ABQ A;  4WF2 A;  1YI2 T;  1W6X A;  4QQD A;  1KQS A;  1M2O A;  2YRC A;  2F5K A;  2R58 A;  2J6O A;  4GBQ A;  3EGX A;  2FPD A;  4LUE A;  1J3T A;  4J83 A;  3HFN A;  2V8K A;  1ZUU A;  4RUG A;  4E7J A;  1W70 A;  3H41 A;  2P0P A;  3CMA Q;  2KR3 A;  4FSX A;  3EGD A;  5DM7 R;  1UGQ B;  2JJ9 A;  1G2B A;  1ZSZ A;  2A7Y A;  2DNU A;  3CCV Q;  1ZX6 A;  4M78 D;  1K4U S;  4RTZ A;  2PU9 B;  3F70 A;  3CCM T;  5A2Q E;  4OGC A;  3EH2 A;  4M77 D;  4FYV B;  4HT8 A;  2JOY A;  1JQQ A;  1K8A U;  1TS9 A;  4PJM A;  4BY6 C;  3MPU B;  2M0Y A;  1OX8 A;  4M77 G;  2J06 A;  5FRO A;  5I2S A;  3H0I A;  2FPE A;  4PJO G;  2CZ0 B;  3CCU Q;  2XKO C;  2QA4 A;  1X6G A;  5CQY A;  4JJB A;  3OA6 A;  1GXI E;  2OTL Q;  5KYN A;  5GAO p;  3WVD B;  1VQ6 Q;  1I5O B;  3VS2 A;  1SKU B;  5GAN h;  4C0D C;  2E10 A;  4DQ2 A;  3L2R A;  4J6X A;  4FYW B;  4HCK A;  5LJ3 d;  1H8K A;  3EG3 A;  5GMK l;  2QI2 A;  3THK A;  1VOM A;  1X27 A;  1TOV A;  4N4I A;  2CGH A;  1KIK A;  1MHN A;  2FYK A;  3PFS A;  3CMA T;  2K3B A;  2MIO A;  4C8Q F;  3PTA A;  1WJQ A;  1MMN A;  5GAO q;  2JM8 A;  5FU7 B;  4C92 F;  3SB2 A;  4EMK B;  1I1J A;  3CCV T;  3GP8 A;  1KG1 A;  3G4S T;  3X24 B;  1X6B A;  3JCM d;  1NLO C;  2CDT A;  4F7U G;  4KGX B;  2L3S A;  4KT0 E;  4MML A;  2Z0W A;  1BKB A;  2L89 A;  3JCM X;  4E2F B;  3MJX A;  5LJ5 g;  2WAC A;  3TSW A;  1M9S A;  1EX4 A;  5GAO m;  1OUL A;  1Q81 C;  3C0C A;  1Q7Y C;  1K73 C;  1HD3 A;  1VYV A;  1X43 A;  4PJO B;  1G3W A;  2O2O A;  3CCU T;  1YP5 A;  1YNZ A;  1QQJ A;  1S72 Q;  2JUF A;  1B3Q A;  2AKL A;  4J9C A;  1D0Y A;  4VUB A;  3VS6 A;  4JRP A;  4E7L A;  2YUP A;  2HBW A;  5CCA A;  1VQ6 T;  1ZA1 B;  2R5M A;  3JCM b;  1VQ5 Q;  1VQ8 Q;  2XK0 A;  1YWO A;  1UE9 A;  4E47 A;  5D6Y A;  1BI1 A;  3L2W A;  4BE0 A;  3SFM A;  4C8Q E;  3CCR T;  3EFO B;  4OB0 B;  4BI3 A;  4C92 E;  2QAS A;  3PVL A;  1MV3 A;  3CXC S;  1PWT A;  3BY7 A;  2LX9 A;  2M16 A;  1D1B A;  3GPL A;  3CC2 Q;  1BIA A;  1V1C A;  2XU8 A;  5GAM j;  3VRY A;  2YWW A;  1SF9 A;  2O88 A;  1RUW A;  1NEG A;  3M4Y A;  2DL3 A;  5GAN 5;  1ZA2 B;  3EG1 A;  5FRN A;  2DD5 A;  3LH5 A;  2FRY A;  1Y96 A;  2HSE B;  1TH7 A;  1S1N A;  2CP3 A;  3CCJ Q;  3CCS A;  2WSF E;  2DRK A;  4C92 C;  2KE9 A;  2DBM A;  2LNH B;  3OBY A;  3VUB A;  3T9N A;  3OW2 S;  4CC7 A;  1FX7 A;  2HZY A;  4Z88 A;  5CKB A;  4JZ4 A;  3JB9 D;  3HL8 A;  1CKB A;  3IQL A;  1NG2 A;  1VQ4 A;  1U8R A;  3JB9 G;  1VQ5 T;  1AWJ A;  3CCE Q;  2VGN A;  1VQP A;  5CQX A;  4JUV A;  1G3Y A;  1D1A A;  3NTK A;  2LQK A;  2YRV A;  1M3A A;  3ASK A;  4DBH A;  4PKC C;  3QPH A;  1K76 A;  3PT9 A;  1H92 A;  3EG0 A;  1GFD A;  3SWN C;  1RL2 A;  3QDR B;  4IUR A;  5FWC A;  3A8G B;  1U1T A;  1I5L A;  2KT8 A;  4BAC A;  1YCY A;  4Y28 E;  5LJ5 e;  3VJP A;  4OMO A;  3TRE A;  2V26 A;  2LQW A;  2LP5 A;  2QTV A;  2ENM A;  3TEE A;  3RMQ A;  1BCM A;  1G3T A;  1AHJ B;  2KYB A;  2CZ1 B;  2VGM A;  3MP8 A;  5GAM h;  4BY6 B;  2RM4 A;  3CCJ T;  4OB3 B;  2PUO B;  1QVG S;  2P0K A;  2CSI A;  3S3M A;  5IHI A;  2RJE A;  4J5Y A;  3BE3 A;  2KT1 A;  2YXY A;  5LJ3 j;  1U1S A;  3E19 A;  1N5Z A;  1AWX A;  1NJI U;  2CRE A;  4D8D A;  1VQL A;  2ABL A;  3MEW A;  2ZAE A;  3PIO A;  2K57 A;  3CCQ A;  1RAH B;  3HRT A;  4M7A F;  3NHN A;  3X20 B;  2X4J A;  3CCE T;  1YJN A;  2K9G A;  3GNF B;  1WA7 A;  1WXU A;  2P84 A;  1V76 A;  2I0N A;  2X9H A;  2JMC A;  2RF0 A;  1UEC A;  3VS3 A;  1KSW A;  1OPK A;  4MZP A;  3HRU A;  2MAM A;  4RTV A;  3OS1 A;  3EG9 A;  1PSF A;  4IUT A;  4IIO A;  2RI2 A;  5L8R E;  1UTI A;  3V7C A;  2HSP A;  4C0G A;  4NOY A;  4RCB A;  1NYF A;  1D09 B;  3QKJ A;  5I2M A;  2RK1 A;  1YCS B;  1UFF A;  2YSQ A;  1N8R R;  1FMV A;  2KMT A;  3CCM A;  1XTD A;  3OYE A;  2D0Q B;  3NTH A;  1YIT Q;  4C8Q G;  4X1V A;  3JAM E;  2AKK A;  2EQI A;  1VQK T;  1QVF S;  2RMO A;  4II1 A;  3OYJ A;  4XQ3 A;  2V8I A;  4ZGJ B;  4LDY A;  4A63 B;  1WGS A;  5GAN g;  4C0F A;  4C92 A;  1LPL A;  2CT4 A;  3PNW C;  5A0L A;  2DZ9 A;  1VQ9 Q;  2DVE A;  5KYW A;  2DL5 A;  3MEA A;  2FRW A;  4QVZ A;  2E3H A;  3OYL A;  4M7A E;  2M02 A;  2QXF A;  1IO6 A;  1I81 A;  3J7A F;  4AFZ C;  1U3O A;  2MWP A;  2DIL A;  2FEI A;  2YLB A;  2GCX A;  4OP0 A;  4A4F A;  1UGP B;  2EKH A;  1EZZ B;  2CSQ A;  3EG9 B;  1RLQ C;  3G7Z A;  2KI7 A;  2V1R A;  1YIJ Q;  2C0T A;  2YDL A;  2ZPE B;  4HKE A;  1OYX A;  3QXE B;  5CKD A;  4M7A C;  3RIR A;  2GF7 A;  4X9D A;  2NUP B;  1PSE A;  4MMK A;  2RQV A;  1AWW A;  4FT2 A;  4E7S A;  1OV3 A;  2F1L A;  2MF2 A;  2LJ1 A;  3OYD A;  3I9Q A;  3SWN A;  3ER0 A;  2RH2 A;  3A8H B;  1AEY A;  4FW1 A;  2NUT A;  3H6Z A;  1YIT T;  2C06 A;  1RAG B;  1VYU A;  2O9S A;  3KXT A;  1G3S A;  5CK9 A;  2RA2 A;  4C8Q B;  3KBG A;  4C92 B;  3GF5 A;  4HCC A;  2DFU A;  3MHX A;  2DXC A;  2E70 A;  1KD1 R;  2NLU A;  1WYX A;  1TTH B;  4KBM B;  4EDU A;  3WXM B;  2EYZ A;  5EC7 A;  4HCZ A;  2OTL A;  3OYB A;  2K2M A;  3SD4 A;  2LCC A;  2ZPG B;  1UGR B;  1VQN A;  4XTU A;  4FSS A;  9ATC B;  1M90 C;  2OAW A;  1VQ6 A;  2PVG B;  2CUB A;  2FZK B;  1UHC A;  2RQW A;  4M78 C;  1U06 A;  2KYM A;  2PZ1 A;  5GAO r;  4JDS A;  1IGU A;  2MI6 A;  4QVD A;  5LJ5 f;  4BD3 A;  4CI0 C;  1YI2 Q;  3MP1 A;  2DL7 A;  2PVO B;  5I21 A;  3BDL A;  1RI0 A;  4QW2 A;  5D6X A;  2LCS A;  1PC0 A;  2HEQ A;  2CZ6 B;  3QO3 A;  1QWE A;  3CCL Q;  3PIP A;  3SWN B;  1OU8 A;  3NTI A;  2RO0 A;  2VXE A;  2X4X A;  4N4G A;  4UC4 A;  1XNI A;  1RAB B;  1D3B B;  3S3N A;  1TUD A;  2LZ6 B;  4QVC A;  5GAN e;  1UEB A;  1ARK A;  1BK2 A;  1Y71 A;  2EQM A;  2DTO A;  1QP2 A;  4C5I A;  1WHL A;  1BBZ A; 
#chains in the Genus database with same CATH homology
 1NEB A;  1G83 A;  2LQN A;  1KIK A;  2HCK A;  2K3B A;  2MIO A;  1AD5 A;  4OML A;  4E6R A;  2JM8 A;  2EGE A;  2KBT A;  1I1J A;  1M3B A;  1X2Q A;  2PNI A;  1A0N B;  1YN8 A;  1GFC A;  1JXM A;  1X6B A;  1NLO C;  2CDT A;  1B07 A;  1Z9Q A;  2L3S A;  2L2P A;  1NYG A;  2RQU A;  1QKW A;  1GL5 A;  3TSW A;  2DRM A;  1QCF A;  3KFV A;  3M0U A;  4J9H A;  2OI3 A;  2DLP A;  2DYB A;  2J6K A;  3C0C A;  1PHT A;  4RTT A;  3GBQ A;  1GCP A;  2BTT A;  1HD3 A;  1VYV A;  1X43 A;  2O2O A;  1RLP C;  2W10 A;  2VVK A;  2D8H A;  3EGU A;  1YP5 A;  1YNZ A;  2ROT A;  1UG1 A;  1B3Q A;  2V1Q A;  2AKL A;  4J9C A;  2QDL A;  3VS6 A;  1ZLM A;  3VS4 A;  2JMA A;  2X3X D;  5I11 A;  2NWM A;  2YUP A;  2HBW A;  3VS0 A;  1Y0M A;  1ZSG A;  1H3H A;  1WDX A;  1T0J A;  4JJD A;  2DBK A;  1UJY A;  2EBP A;  1YWO A;  2KRS A;  2D0N A;  1UE9 A;  3JV3 A;  4ESR A;  4AG2 C;  2GTJ A;  2JTE A;  2EW3 A;  1AVZ C;  5I22 A;  1QLY A;  1MV0 B;  3NMZ C;  1KFZ A;  3PVL A;  1MV3 A;  4J9E A;  1PWT A;  4Y92 A;  2BZ8 A;  3H0H A;  4F17 A;  1V1C A;  4LE9 A;  2KGT A;  3M0Q A;  3QWY A;  4CC3 A;  5FW9 A;  1AZE A;  3VRY A;  3EHR A;  1AOJ A;  1SPK A;  4DEX A;  2O88 A;  1RUW A;  1NEG A;  3M0S A;  2JT4 A;  1OOT A;  3PVQ A;  3PE0 A;  2DL3 A;  2AZS A;  2K7A A;  5ECA A;  3EG1 A;  4LNP A;  3LH5 A;  2FRY A;  1FMK A;  2JS2 A;  4M4Z A;  2BZY A;  1S1N A;  3SEM A;  2DE0 X;  1WFW A;  2F2V A;  2P4R A;  2GQI A;  2DRK A;  1BU1 A;  2KE9 A;  2DBM A;  1JU5 C;  2LNH B;  1CKA A;  1GRI A;  2K6D A;  2C0I A;  2EYY A;  1T0H A;  4CC7 A;  2SRC A;  4Z88 A;  4JZ4 A;  2F2W A;  1WXB A;  3ULR B;  3CQT A;  4HVW A;  4R0K A;  1CKB A;  4QT7 A;  3IQL A;  3U23 A;  1NG2 A;  2ESW A;  2GNC A;  1SRM A;  3O5Z A;  1ZUY A;  2KRO A;  1AWJ A;  1XOV A;  1K1Z A;  2ROL A;  2VKN A;  4ORZ A;  2RNA A;  2EPD A;  2EGC A;  1JXO A;  4JPB W;  2JM9 A;  1UGV A;  2XMF A;  5GJV B;  2MOX A;  5IHK A;  1M3A A;  3UA7 A;  2EVR A;  4J9F A;  1K76 A;  1H92 A;  2J6F A;  1M3C A;  1HSQ A;  1MUZ A;  1UDL A;  2FPF A;  1CSK A;  3EG0 A;  1GFD A;  2SEM A;  1K0X A;  1TUC A;  4J9G A;  5IXF A;  5FWC A;  3I5R A;  2AK5 A;  2C0O A;  2YUN A;  2KT8 A;  2J05 A;  1SEM A;  4IIM A;  4OMO A;  2GTO A;  2LQW A;  2LP5 A;  4OMP A;  2J7I A;  1KJW A;  2AZV A;  2EYX A;  4OMM A;  2ENM A;  1SSH A;  1Z9Z A;  3H0F A;  2JS0 A;  3QWX X;  4ZNX A;  2O9V A;  2KYB A;  1WIE A;  2CH4 W;  2EGA A;  2DVJ A;  2VWF A;  1K0S A;  1M8M A;  4HVU A;  1WI7 A;  2KRN A;  1QKX A;  2CSI A;  3VS7 A;  3R6N A;  5IHI A;  1WLP B;  2DF6 A;  2KXD A;  4DEY A;  2DA9 A;  2KT1 A;  4GLM A;  2X3W D;  3M0R A;  1AWO A;  2L3Q A;  4CC4 B;  1N5Z A;  2CT3 A;  1AWX A;  2RPN A;  4AG1 C;  2CRE A;  4D8D A;  1SRL A;  1OPL A;  2ABL A;  2PTK A;  3VS5 A;  1PKS A;  2RQR A;  1I0C A;  3NHN A;  4HXJ A;  2K9G A;  5IH2 A;  1WA7 A;  4HVV A;  5IXB A;  1WXU A;  1JEG A;  2I0N A;  2RQT A;  2A37 A;  2JXB A;  2JMC A;  2RF0 A;  1PKT A;  2K79 A;  1UEC A;  3VS3 A;  1KSW A;  1OPK A;  1TG0 A;  2DX1 A;  2W0Z A;  2BZX A;  4RTV A;  2DJQ A;  2L3P A;  2DMO A;  4IIO A;  1UTI A;  2KEA A;  2HSP A;  1M30 A;  3I35 A;  4RTW A;  3M0T A;  2FG0 A;  4RTU A;  1NYF A;  1ZBJ A;  1GCQ C;  3UA6 A;  1UHF A;  1YCS B;  3NPF A;  1UFF A;  2YSQ A;  4CC2 A;  2G6F X;  3EHQ A;  3REB B;  1FYN A;  1E6H A;  3TSZ A;  4J9I A;  2LJ3 A;  2F2X A;  3RNJ A;  2GGR A;  3FJ5 A;  4X1V A;  2AKK A;  1ZUK A;  2L0A A;  2LJ0 A;  2EQI A;  4EIK A;  2RMO A;  1VA7 A;  2CUD A;  5GJW B;  4A63 B;  4KRT A;  3NGP A;  2A28 A;  2CT4 A;  1BB9 A;  2DL5 A;  1GBQ A;  1YWP A;  3M0P A;  2HDA A;  2FRW A;  2CH4 A;  2LX7 A;  3SHW A;  2YUQ A;  1IO6 A;  1T3L A;  2FO0 A;  3TVT A;  1PNJ A;  1WXT A;  4AFZ C;  1U3O A;  1WX6 A;  2KNB B;  4J9D A;  2DIL A;  2FEI A;  2MCN A;  3I5S A;  5FWB A;  1RI9 A;  2EKH A;  3VRZ A;  2CSQ A;  1PRL C;  4J9B A;  2O31 A;  4RTX A;  1M27 C;  1RLQ C;  2ECZ A;  2YUO A;  4JZ3 A;  3UAT A;  4JJC A;  2KRM A;  1PRM C;  2DM1 A;  2V1R A;  2C0T A;  2GBQ A;  1Y57 A;  2YDL A;  1E6G A;  5HCK A;  4LN2 A;  4OMN A;  3A98 A;  3REA B;  2ED1 A;  2RQV A;  2H8H A;  2OJ2 A;  1AWW A;  4K11 A;  1ABQ A;  1EFN A;  1OV3 A;  4AFS C;  2RN8 A;  2LJ1 A;  3I9Q A;  2IIM A;  1UJ0 A;  2M51 A;  1W6X A;  1AEY A;  2ED0 A;  1OEB A;  2J6O A;  4GBQ A;  2D1X A;  1VYU A;  2O9S A;  2FPD A;  4LUE A;  1J3T A;  1K9A A;  2LMJ A;  1ABO A;  1JO8 A;  1ZUU A;  4RUG A;  2KXC A;  1W70 A;  3H41 A;  2DL8 A;  2KR3 A;  4OMQ A;  4D8K A;  1QWF A;  2JW4 A;  1G2B A;  4F16 A;  1X69 A;  2DNU A;  1WYX A;  1SHF A;  2DL4 A;  1AZG B;  2EYZ A;  1ZX6 A;  5IHN A;  2A36 A;  5EC7 A;  2EYW A;  2K2M A;  1K4U S;  4RTZ A;  4F14 A;  4WCI A;  2E5K A;  4FSS A;  2OAW A;  1GBR A;  2CUB A;  1JQQ A;  1E7O A;  1UHC A;  2RQW A;  1X2K A;  1U06 A;  1VYT A;  2KYM A;  1UUE A;  2PZ1 A;  1NLP C;  2M0Y A;  4Z89 A;  2J06 A;  3VS1 A;  1NM7 A;  3H0I A;  2FPE A;  2DL7 A;  4LUD A;  2A08 A;  4AFQ C;  1I07 A;  3UF4 A;  3RBB B;  2LCS A;  2HEQ A;  1QWE A;  3EG2 A;  1X6G A;  4JJB A;  1W1F A;  2D8J A;  3ZL7 C;  5L23 A;  1T3S A;  2B86 A;  2NUZ A;  1U5S A;  1LCK A;  3VS2 A;  4RTY A;  1HJD A;  1GCQ A;  1TUD A;  2LZ6 B;  4HCK A;  1H8K A;  1ARK A;  1BK2 A;  2YT6 A;  3EG3 A;  3THK A;  4AFU C;  1X27 A;  4Z8A A;  1SHG A;  1BBZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...