1HT6A

Crystal structure at 1.5a resolution of the barley alpha-amylase isozyme 1
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
404
structure length
404
Chain Sequence
b'HQVLFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVSNEGYMPGRLYDIDASKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDSRGIYCIFEGGTSDGRLDWGPHMICRDDTKYSDGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLDFARGYSPEMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKVGGAASAGMVFDFTTKGILNAAVEGELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDTGSTQAMWPFPSDKVMQGYAYILTHPGIPCIFYDHFFNWGFKDQIAALVAIRKRNGITATSALKILMHEGDAYVAEIDGKVVVKIGSRYDVGAVIPAGFVTSAHGNDYAVWEK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ALPHA-AMYLASE ISOZYME 1
publication title The structure of barley alpha-amylase isozyme 1 reveals a novel role of domain C in substrate recognition and binding: a pair of sugar tongs
pubmed doi rcsb
source organism Hordeum vulgare
molecule tags Hydrolase
total genus 140
structure length 404
sequence length 404
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2000-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF07821 Alpha-amyl_C2 Alpha-amylase C-terminal beta-sheet domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1ht6A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1ht6A01
2V3DA 3L4UA 3ARRA 4YHGA 7A3HA 3F5KA 4TVCA 1C8XA 4AZ7A 4Q22A 1W3KA 4OBRA 3CMJA 3L4YA 1SMDA 3BVUA 3UCQA 3DDGA 2FGZA 1CENA 4S3JA 1CGWA 2QPUA 3BAWA 1VFOA 1E15A 1ZBKA 2XN1A 3CUJA 3CZEA 4NSBA 1BYDA 3WF2A 1JZ8A 2G41A 1CTNA 1KWGA 1KCKA 1E4NA 2DSZA 4J3VA 1E40A 1U30A 4M1RA 3K4DA 3VSUA 2D0HA 4UQEA 2FHBA 4JHZA 4PRWA 3OGRA 3VIGA 4HA4A 3ALFA 3PZTA 3WUGA 1CXFA 4TTUA 3KZSA 2O9RA 1B0IA 3ZJ7A 2WLYA 3CHEA 1E1FA 3BUPA 3VDBA 3HG3A 4UFJA 1LWJA 2JF7A 4BQ5A 4AZBA 2G4FA 4ATWA 1QOXA 1JIBA 1I1XA 3GBDA 1M03A 1E6PA 4MB3A 3DHUA 1VB9A 2EPKX 3NDYA 1QNSA 3EDDA 1WCGA 4WK9A 3MV01 3VD3A 1BQCA 3WNMA 3WQ5A 1KR0A 1GQJA 3MO4A 4TXEA 3B8SA 2XSAA 5E6YA 1ZU8A 4FNTA 2WW5A 3L4ZA 2WMHA 3ZR6A 4TUFA 3BAJA 4UFHA 2GK1B 5HPOA 3WY4A 3PZ9A 4ZFMA 4D1IA 2D3NA 2EPMX 2A3EA 2ZUVA 5DF0A 2YBTA 4PMVA 3TA9A 4F8XA 5GNYA 2WZEA 3AZSA 3VOCA 2GJRA 1FP8A 3PZOA 4CU8A 3BC9A 3W37A 2RGLA 4XZBA 4QCFA 3AXXA 4LXFA 1E3ZA 2C0HA 1UR1A 1JDAA 3BLKA 5LA2A 2NT1A 3EMQA 2J7DA 4Z2KA 3HG2A 1K9EA 1VJZA 5LA1A 1NWUA 1BVZA 3WIJA 3AMDA 4MDPA 3CO4A 3AICA 4MNMA 4QFUA 3THCA 3AIRA 5E0CA 1G0CA 2V38A 1FHDA 1C90A 3VGEA 1B3WA 2G3IA 3AZTA 1MQRA 5GQBA 4WKHA 3SCTA 1R47A 2EABA 4QDMA 4X9YA 1R33A 9CGTA 3TOPA 2CHOA 3GZAA 5EB8A 4JKMA 2VR4A 3WFLA 3EJPA 5AC5A 2HISA 2CESA 4S3KA 1E0XA 2DIJA 3PZIA 5FOOA 1TMQA 4IISA 1JXKA 2J4GA 2GK1A 1QBAA 1Q6DA 1TQUA 2ESCA 1PX4A 1UKOA 3MUIA 4MADA 4HMEA 3WL1A 2CBIA 1ODZA 2CETA 3WY1A 2ZE0A 2Y8VA 4B3KA 1FOBA 1WDQA 1CEOA 3G6MA 3U57A 4Q7NA 4D6JA 1SR0A 3CPUA 5A6JA 3A5VA 4UFLA 2YFOA 1H0IA 1TCMA 3H54A 3RJYA 1WZKA 1LG1A 2BFGA 1P6WA 3DYOA 1UZ1A 2OW6A 4OUEA 3OZOA 2ZWYA 3MUZ1 2X09A 3AIEA 3VIFA 1UH3A 4JHOA 1V0KA 2ZWZA 1RP9A 1HF6A 4D72A 2W62A 1W1TA 2OWCA 5DMYA 3AROA 2WVTA 2O9TA 1G94A 2VX6A 1XCWA 3TTQA 5M5DA 5EFDA 3PZMA 2XVNA 1OBAA 2XIBA 4AD5A 4FMVA 2VTFA 1OIMA 4M8UA 4HP5A 1CXEA 2OSXA 4D71A 1QI3A 1E4LA 5D8WA 3L4WA 3MMDA 3QGVA 1JZ6A 2WKLA 3GXMA 4FNRA 3W0KA 4MPKA 4JFSA 4KH2A 3AHYA 1H5VA 2XJ7A 4FNUA 1KR1A 3SCUA 4AMXA 1ZJBA 1CBGA 3T0BA 4U5IA 4YN5A 3MMUA 3AOFA 4WLCA 5CSYA 1JF5A 2XVPA 5D9PA 1ISZA 3T2PA 3OZPA 4ZXLA 4B16A 1HWWA 3WDQA 3BCDA 4CD6A 3B9DA 1E6SM 1EIBA 3GNRA 4MAVA 1W3LA 3AMLA 4UZSA 2XM1A 1E5JA 2VI0A 1M53A 3SEPA 3CUHA 1TQWA 3EJTA 2ZOXA 3AFBA 5HOSA 2NT0A 4FNSA 3WH5A 4MNJA 3AHZA 4W89A 4D6CA 3N13A 3SUSA 2EXOA 1TFVA 1WB0A 1G1YA 4WF7A 2WVUA 1VFFA 1S46A 1KCLA 2VZTA 3OA5A 4PCTA 3GTNA 1HP5A 2VL4A 4PTVA 5JBDA 3W27A 3CZGA 3VILA 4W7UA 1CWYA 4Z2JA 2WANA 1OD0A 3WUBA 3WEZA 1V0MA 1C3FA 2DIEA 1FHLA 3FAXA 3MANA 2F61A 3UR8A 4J3XA 8A3HA 1FFRA 3W6LA 3HMCA 3W81A 2VNCA 1ZJAA 1LWHA 3W28A 5CLWA 4AMCA 4PMYA 4LGXA 1NM9A 3NUKA 3KLKA 3B9AA 3BLBA 3RM8A 3T2OA 3WSUA 3EDEA 5A95A 3ARZA 2GDUA 3QHOA 4OKDA 3UESA 3WEOA 1HJSA 1VBRA 2YDQA 2FYVA 3WQ6A 2D1ZA 1VEPA 2VRJA 3MKKA 2XWEA 4JFTA 3L2LA 4GZEA 3ARPA 1V03A 1JL8A 3W6MA 2D20A 2EACA 3A21A 4ZE4A 4W93A 4EKJA 3IK2A 2XG9A 5D8ZA 2DH3A 3BH4A 3DHPA 2VVSA 3FNDA 1V6WA 1E0VA 1LJYA 2QHAA 3FXYA 1E55A 3LPOA 3RJXA 2GVYA 3NSMA 3GH7A 4AZ5A 1O7AA 1EQCA 1F4AA 1RH9A 4Y7EA 2UY5A 4GZJA 4L4PA 1JYXA 3MSDA 1JD7A 3ECQA 4CVUA 1UKTA 3AMGA 1PS3A 1QBBA 3ZO9A 2WHMA 1CXHA 1JI2A 1L8NA 1C93A 1ODUA 1J0IA 1QVBA 1VENA 1QI0A 3VIIA 3A22A 1DWHM 4UCFA 1ESWA 3GH4A 3VGFA 1E6NA 3SUWA 4AWEA 4BA0A 3GXIA 1W32A 1EHAA 4E8CA 1Q4NX 2AAAA 2QMKA 3U7BA 2D22A 1U33A 4IUGA 4WKAA 2J8GA 1J0HA 4P7OA 3II1A 1V6XA 3ZQ9A 1EDTA 1GQKA 3CZKA 3WEMA 2Z1SA 2WKGA 5IHSA 3OLIA 5KZ6A 4D6HA 2ZIDA 3FHAA 4UNIA 1MXDA 5CGTA 3AIQA 4U33A 2XGBA 1GZJA 1MWOA 1MQQA 4JAWA 4HTYA 3BAYA 4NRSA 1OGBA 3WENA 1EOMA 3W29A 3T0DA 3VMPA 3POCA 1ZBWA 2AMGA 4H04A 2ZX5A 3H53A 4DO6A 3AHVA 4DUVA 3WMCA 3VUPA 2WSPA 3ARQA 2VT0A 1QX1A 3CLWA 2J75A 3HG5A 1MYRA 1JGIA 1BPLB 1E3XA 2J74A 1NOFA 2EBNA 3B9EA 3RPMA 1XSKA 4FLOA 4W7WA 2V5DA 1H49A 1HN1A 4HA1A 1E1EA 5TD4A 4KGJA 1BG9A 2DQXA 2VQUA 1HTYA 2GSJA 2WCGA 3GXFA 2D23A 5BCAA 4FNQA 3WDIA 5IFPA 5I79A 3EBVA 1KTCA 3TTSA 4TX6A 1JAEA 3BSGA 2QLYA 1HX0A 3WNNA 4JCLA 3QHNA 3WY3A 3SCPA 3WH6A 3LRMA 1QI2A 1HL8A 1OGSA 1NP0A 2W67A 2X0HA 4CCDA 1KBBA 1YQ2A 1KXTA 2EPNA 4OIFA 2W92A 3ARSA 1UR0A 2OYKA 4TX8A 4B9ZA 1HKJA 7TAAA 4D6IA 3G6LA 1UOKA 1R7AA 4CGTA 1R34A 5C8BB 2J25A 4YHEA 4HOZA 1JF6A 2WNWA 3BXWA 1R7OA 5BRPA 3LMYA 3N15A 3WD3A 2PWHA 2WAGA 1GOIA 1GONA 4AZ6A 3WNKA 1V6UA 2DSKA 3TV8A 5CPTA 1WDPA 1X6LA 2VURA 2WCAA 1VFMA 1DWAM 1UQYA 1V3MA 2WHKA 2ALWA 1KGXA 1B31A 1H11A 4P7QA 3S5YA 5IHRA 3ARWA 3ZM8A 2W63A 3OLGA 1E70M 2F7OA 1E71M 4P7LA 3ARXA 2DT2A 2D0FA 3UG3A 4HZ6A 3RILA 3ZR5A 1E6QM 1J10A 4R5EA 4K68A 2D3LA 1J0ZA 1N82A 4MDOA 2J7BA 1JZ5A 4TVDA 1KB3A 2DPEA 2GFTA 2X0YA 4AZCB 1H2JA 4ATLA 1CGXA 2BY1A 3SURA 3VGDA 3UETA 1CGTA 3SUTA 4N42A 5E09A 3WF4A 3MI6A 1R86A 4W84A 4ZE5A 2WZIA 3K4AA 3WUFA 3S2CA 3EMZA 2XWDA 3BVTA 2PWEA 3HJEA 2QV4A 3A3HA 1R46A 2BV9A 4D6FA 4WSJA 5ABEA 4JL1A 1AVAA 1CXKA 1FA2A 5FIPA 1BTCA 1GOOA 4P8WA 3M07A 1W2PA 3BCFA 1V6YA 3SCOA 3WMSA 2WMGA 3WD2A 4P7NA 3MSGA 3MUAA 1R8LA 3SUVA 3CHDA 5DEZA 5BXTA 3BAXA 1UKPA 2QMJA 3CUIA 1VAHA 1OSEA 4U3AA 3PBGA 4ZEPA 1LL7A 3O6AA 4PBGA 5E70A 1EHNA 2D2OA 2A3CA 3WDHA 2ZXBA 3AXHA 1BGGA 1V3IA 2XVLA 1MW2A 4P7RA 4W8LA 2V3EA 1GCYA 3PN8A 4QLKA 3WD4A 4D6GA 2DH2A 1SYTA 4NI3A 3WNPA 1TZ7A 1ISXA 2JIWA 3VX1A 2GDVA 5I5RA 1J0JA 4AZHA 2F7PA 4AZCA 3BUBA 1EA9C 1BYAA 1MW1A 1M04A 1D2KA 2F8QA 3NIYA 3D50A 2OWXA 4AIOA 1E72M 1JYWA 1W91A 4UZUA 4FNPA 1UR2A 2PB1A 3CZJA 3U5UA 2CKRA 1W3HA 3KWXA 5EBAA 1L0PA 2VC9A 3PZVA 6TAAA 4L4OA 4CD8A 1TQSA 3SCRA 2NW0A 3AHTA 3WFZA 4NF7A 2C8NA 2E0PA 4CCCA 3CZNA 5HBFA 2OYMA 1CGUA 2C7FA 1UH2A 1HJWA 1SZNA 2OYLA 5A69A 1B1YA 3CV5A 2BHZA 2WWCA 2YDRA 1A3HA 1CGVA 1JZ4A 2CITA 4H8UA 4AC1X 2CNCA 5I2UA 3KL3A 1BHGA 3VIOA 1TR1A 2E3ZA 4BZYA 1DHKA 4C7FA 1ZB5A 3A4XA 2EO7A 3CBWA 4N0RA 3BVXA 5A6LA 5BROA 2DGAA 4UQCA 2E9LA 3EJSA 2XFYA 4DWSC 5A8QA 5A6KA 4GO9A 2QPSA 3AIBA 4DO4A 2WC4A 4PMDA 3N04A 3OIHA 1AMYA 4AD3A 1VBUA 1C7SA 1XRVA 1UUQA 2WM0A 2J47A 3WUEA 4GQRA 3CUFA 3AHXA 4LPCA 1BSIA 3O2LA 2ZX8A 2ZUSA 3AS2A 1CDGA 3VMNA 1VEOA 2WC7A 2BS9A 3MV11 4RL3A 3JUGA 3ARUA 1AQHA 4CCEA 2OLHA 2CPUA 3FHQA 4GI6A 3IGUA 3VD7A 3A6OA 1IT0A 1WZAA 2FHFA 4UOQA 3N9KA 1E9LA 2BNJA 4LYPA 1W9DM 5GNZA 2F1AA 2AOSA 5HPCA 4UFIA 1CGYA 1IZJA 5CJ5A 3KEHA 1GQIA 3F5LA 4D6DA 4J3TA 3CHCA 3CC1A 4P8UA 4GI9A 5HDRA 2WCSA 2CXGA 3BSHA 4W8AA 4ZXOA 3A4AA 3WDRA 4JCMA 2NSXA 2J7CA 1WAWA 2ZXQA 1BF2A 3AYRA 2YLAA 1K9TA 1TG7A 2FE0A 1MW0A 1UA7A 1B9ZA 1WPCA 2Q8XA 4F66A 4CU7A 1QNPA 1V3JA 1KXVA 2VZUA 3U7VA 3VD5A 2WHJA 1DP0A 2VCBA 3THDA 3VIJA 1VRXA 4HU8A 3UG5A 4BS0A 3I3EA 2X8RA 1WDSA 1LG2A 1JZ2A 2CYGA 2YBUA 4Z2GA 5A2CA 3GXDA 1QW9A 3A47A 4FF5A 3VIHA 2GJPA 4CD7A 2X2IA 5E0FA 4M29A 4GIAA 3CHFA 4NXKA 2DEPA 4HZ7A 2VX7A 5A1AA 2BXZA 3AMCA 3ZOAA 1V0NA 1PPIA 2X05A 3T0AA 4CVWA 1MXGA 1ZBCA 5A8OA 1K9FA 2J7EA 1PIFA 3GDBA 3I3BA 1DEDA 3LXCA 4BQ3A 4C7GA 3GXPA 3NJ3A 3ARTA 2BY2A 3LXAA 2YA1A 2QF8A 3RIKA 1J9YA 3AISA 1Q6CA 2F1BA 3PTQA 4KMQA 4EE9A 5AYIA 2F7RA 1UZ4A 4W85A 5ABHA 1UR9A 4PEEA 1D7FA 1C7TA 2DT0A 2J7FA 5CPSA 4XB3A 1CXIA 1V08A 3GYCA 1OIFA 2VX4A 1KGUA 4WSKA 3ZT7A 2IXUA 4OGZA 3VGBA 3AI0A 3CZ8A 4CD4A 2W66A 1WKYA 1SMAA 1XH1A 1HL9A 3N12A 2PWFA 3AYSA 1CECA 1FP9A 4AD1A 3OLDA 4PTMA 2A3AA 2FDMA 4DWSD 2J8FA 4J7RA 2JIEA 5FKYA 3APGA 2XGIA 1M01A 3PTMA 5CG0A 2VJXA 1O6IA 5I0DA 2G3NA 5M03A 2XVGA 1UWTA 4AYGA 1AQ0A 4HOXA 1U2YA 3HZ3A 4B3LA 3W82A 4J3SA 3N18A 3BVVA 4PMUA 1GUVA 3NYDA 5FCZA 5EFFA 1UWRA 2BY3A 2XN0A 1OGGA 4U2YA 2XTKA 1KBKA 3WNOA 5F7UA 4AD4A 1KFWA 4GO8A 2J62A 4E4PA 4TVUA 1V6VA 1CYGA 5LYRA 3WELA 1H0GA 3PZUA 1Q6FA 4A3YA 4HOWA 1NWTA 2VCAA 2WMFA 3VIKA 3W4RA 1EOKA 1V02A 3ZJ6A 3VD4A 3J7HA 1JZ3A 1K6AA 1B3VA 5M3WA 8CGTA 3M7SA 1JG9A 1UD8A 3H55A 3D3AA 4U2ZA 3ZJ8A 3ARVA 1GORA 4RE4A 2BVTA 5CPQA 2ZUWA 5A6MA 4PCSA 2V5CA 5C71A 3ZSSA 3WQWA 2F18A 5CGMA 4P8XA 3ARYA 4AY1A 4H41A 1UQZA 5A94A 1Q6GA 4PMOA 1W9BM 3L4TA 2IUZA 3VM5A 3LXBA 1LF1A 1PX8A 3BGAA 3K8MA 1W3JA 2VMFA 4OOUA 1PJ9A 1XYFA 3ZJKA 4NRRA 1UWUA 2ZX6A 4PTXA 4DM2A 2VZVA 3O9NA 3PZGA 3BUDA 1HXJA 4F9JA 7CGTA 3KLLA 2WK2A 1GNXA 2DSUA 2E40A 3OB8A 3PZQA 1C92A 5HNNA 1KXHA 1B3ZA 1E4IA 3WKZA 1EQPA 2EPOA 2VX5A 2O92A 2PF0A 1C8QA 4GQQA 4GXPA 2ZICA 1CLXA 4GI8A 4H8HA 1UD4A 4FLRA 3OGSA 1XHGA 1X6NA 3RM9A 2JE8A 4LX4A 3MUY1 1BYCA 3BUQA 1B30A 3BMVA 1UWQA 4AW7A 2G8ZA 3VDCA 2YL5A 3AJ7A 1WZMA 4OBSA 4UQAA 3NSNA 3L4VA 1GHSA 4LYQA 4X0NA 3VO0A 3UEQA 3SCWA 1XV8A 1GHRA 2TAAA 2XN2A 1CZ1A 5I78A 4PUDA 4MNKA 1UKQA 4KRTA 3VGHA 3MU7A 1Y7VA 4NX0A 3LRKA 2XHYA 5I24A 4XX6A 1H41A 1US3A 1J11A 4OJYA 4B9YA 3DECA 2EPLX 3PTKA 5JIPA 1C8YA 5D9NA 1DWJM 3AS1A 3FW6A 2XYLA 4JKLA 1QNRA 3QOKA 3T09A 4PSPA 1UR8A 1H09A 4BCEA 5DT5A 2CBJA 1PEZA 1HKMA 2WVVB 3EMCA 2DSVA 1NQ6A 1F4HA 3ZT6A 4WIWA 3VTRA 3DDFA 2DT1A 4A4AA 3W26A 2YOCA 4W7VA 5I3DA 4UTFA 3WQ4A 3M46A 3WBEA 2WBKA 3OBAA 1KWKA 5ABGA 4W86A 1V0LA 4EAMA 5GPRA 2YFNA 1UKSA 5A3HA 3I3DA 3WQ8A 3D4ZA 4ACZB 2Y4SA 1PZ2A 3IAPA 2RGMA 2XVKA 3F5JA 4MTVA 4TOQA 4TTGA 4W87A 1BLIA 1PIGA 1HJUA 1UASA 2WPGA 1JD9A 4U31A 1R75A 1ISYA 3RO8A 1M7XA 1H1NA 4JZ5A 4GPNA 3EDKA 2E8YA 3WF1A 1DWIM 1G01A 2WZHA 3KL0A 1E6RA 3HN3A 1E5NA 4PMXA 2E9MA 4ACYA 4W5ZA 3M6DA 3N17A 4M82A 4CN4A 1XCXA 3VNZA 1V02E 1GPFA 5A6BD 2VVNA 4XUYA 1PBGA 4MB1A 5DO8A 3VVGA 2JFEX 1BFNA 1MQPA 1WDRA 2WSKA 4F79A 1UWIA 3CIVA 1GOKA 1OCQA 1NWRA 2WB5A 5DFAA 4DUXA 3D4YA 3SUUA 3ZT5A 2Z1KA 4CU6A 1HNYA 2WVVA 2EADA 2WMJA 3EJQA 1UR4A 3DX3A 1VEMA 2F2HA 1LQ0A 1MFUA 3VPLA 1LLOA 3CZLA 4UOJA 4AEEA 1HXKA 1QW8A 4UR9A 3CH9A 4BQ4A 1EGZA 3ZSTA 1E4MM 3WDPP 3RM4A 2FHCA 1FFQA 2X2HA 1RP8A 1QNOA 3MS8A 1XSIA 1CXLA 1VFUA 4ACZA 4E2OA 1WNOA 3VSVA 4AD0A 3GM8A 4FK9A 4PMNA 1GJWA 2Y8KA 4HU0A 2BY0A 3L2MA 1E43A 1LL6A 3WBAA 1MFVA 1UD5A 2YL6A 3QHMA 1PAMA 4PSRA 3SCVA 4DWSB 2JEPA 1CLVA 1V3LA 4AEFA 4Z2HA 3NSXA 1FH7A 1OD8A 2PBOA 4HMDA 4LYRA 3CZSA 1JAKA 3A24A 2W91A 3AS0A 3WL0A 5E6ZA 3WF3A 4KWUA 1V3HA 4UFMA 1GVYA 2UY4A 2YA2A 4IPLA 1GOWA 4Z2LA 3EJRA 4GZIA 2IXVA 4DM1A 1TQVA 1R85A 2B31A 2W5FA 3VDHA 2PI6A 1IZKA 1RPKA 3HU7A 1FH9A 2J79A 3RDKA 5BXSA 3QR3A 2XSBA 1E0WA 2VO5A 4V2XA 3S6TA 1EDQA 3FN9A 4UFKA 2X2JA 3TTOA 1HJQA 3ZMRA 3UG4A 2YL8A 3DX1A 4JFUA 3OG2A 5I6SA 4FLQA 5A2BA 2CHNA 3OGVA 1ITCA 2J78A 1UD6A 1HVQA 5I77A 2VZOA 1G9HA 4V28A 2OSWA 1J0KA 5AY7A 1ISWA 3WH8A 1JNEA 1G5AA 2ZUUA 1YHTA 4J3WA 1ITXA 2J77A 3WH7A 3PHAA 2WBGA 5A8NA 5BWFA 1QPKA 1EO7A 3NCOA 2VR5A 3VM7A 4RE2A 5JUVA 1J0YA 4P8VA 3IJ8A 2IGTA 4DWSA 1QWNA 2W4XA 2FGLA 1T0OA 5ECUA 5E9AA 1JDCA 4NZFA 2A3HA 4MJ2A 1Z32X 4C7DA 1KQZA 4H7VA 1QHOA 3AS3A 3WQVA 3VDAA 1XH0A 2ZUTA 4JL2A 3CUGA 4Z2IA 4UQDA 1V3KA 2PWDA 2PBGA 4YPJA 5JIWA 4CN1A 3DYPA 3VNYA 2CERA 3BUIA 3AIUA 4JFWA 5CQ1A 5I23A 3DC0A 5BYWA 4JIEA 1TA3B 4AXNA 3BMWA 2Y24A 2J7HA 4B15A 4H8VA 5JBEA 3D52A 3SCQA 4LQ1A 1HJVA 1GOQA 1FH8A 2ZX7A 3WDJA 1AQMA 4W8BA 1WE5A 1W9UA 4HPGA 5D9OA 1GVIA 1UWSA 1JYVA 1W9VA 1BVNP 3W38A 1UD3A 3WN6A 4FLSA 1H4PA 1GW1A 1E6XM 2WYSA 1KTBA 1JNDA 3FY1A 2CBUA 3WH9A 1W9XA 1B3YA 1W1VA 1Q6EA 1XD0A 2PWGA 3DX2A 2YL9A 4KGLA 4U5KA 1EDGA 3D51A 3AIWA 5FD0A 5D9MA 3TP4A 1NH6A 4BQ2A 4NZCA 2YJQA 1QI4A 4M24A 3WNLA 3EYPA 5JBFA 1EXPA 2XPKA 1OINA 4QAWA 3E1F1 4WJXA 4AYSA 4AIUA 2OW7A 3VSTA 1SFSA 3WD1A 1OT1A 1WP6A 5A8PA 2WXDM 3BVWA 1HP4A 3GNOA 1TA3A 3D5HA 4JKKA 4J28A 4AIEA 4QLJA 1E73M 5A6SA 1NWSA 1OT2A 4PMZA 5BXPA 3OLEA 2WMKA 3VKKA 3IJ7A 3AQUA 2WWDA 3SCNA 1NARA 5FL0A 3HG4A 5A6AA 1UG6A 4W5UA 5CSUA 2D24A 4QCEA 2GJXB 4F9DA 4J27A 4M56A 4V27A 4WKFA 1LL4A 2CKSA 1JYNA 2BHYA 2VRKA 1HKKA 2YLLA 4AZIA 5A8MA 4M80A 1JDDA 2XM2A 1XH2A 2XFFA 1W2VA 2BVDA 1ISVA 1QI5A 2OSYA 1W1YA 4E8DA 1PX3A 1B90A 2ZX9A 5BRQA 3QOMA 4ML4A 5IDIA 3RMEA 1OM0A 5HXMA 2MANA 1US2A 2F7QA 4CN6A 2HVMA 2D0GA 3AMKA 5GNXA 4W88A 2BHUA 4AZGA 4NZJA 1E6ZA 2VOTA 1C91A 3MMWA 2ZUMA 2ZXDA 5BXRA 2JF6A 3IANA 4IPNB 3N11A 4J3UA 1TE1A 4QLLA 1DWGM 1GOMA 1HJXA 1NOWA 1BGAA 1RD6A 2WLZA 2EQDA 1GJUA 3BLPX 1W9PA 2ZXAA 5D4YA 1QHPA 3UR7A 3U5YA 4OOZA 3VGGA 2XIIA 4PTWA 3WMBA 4CUCA 1ZL1A 5M17A 3POHA 3A4WA 1ZBVA 1NP2A 1JFHA 2BVYA 1R87A 4A3HA 2UY2A 1MW3A 1J18A 4QP0A 2YKKA 3DYMA 3WD0A 1EH9A 2PC8A 1X1NA 5IFTA 2EJ1A 1BG4A 2GJXA 3VX0A 2VZSA 3TTYA 1UD2A 3BAKA 3GBEA 4HPHA 1VIWA 4UOZA 1NOUA 4X0VA 3VU2A 3VIPA 3ZIZA 2Y5EA 3AIVA 4CD5A 4NXSA 4U3CA 1HT6A 3KL5A 1BYBA 2FH6A 3CMGA 4KRUA 5ABFB 4UQ9A 2VQTA 2VRQA 3GH5A 4MAZA 4M81A 1WZLA 1HIZA 2CEQA 3PZNA 1JI1A 2XUCA 3W24A 4R27A 3EJUA 3F4VA 5C70A 2CCRA 3S5ZA 1JZ7A 5CLTA 1CPUA 4MJ4A 2EAEA 5AYBA 5EMYA 1KXQA 3BAIA 2JALA 5A6BA 2YDSA 2WHLA 4GKLA 4MB4A 2W61A 1O7DC 5CXPA 1B2YA 2YA0A 5KEZA 3RCNA 1CNVA 2X2YA 2YIHA 3SCSA 2O9PA 4PYSA 2WVSA 4D1JA 1UYQA 2UWFA 3IAQA 3A23A 4AMWA 2Y2WA 2J7GA 4CKQA 4OZOA 5A2AA 1D3CA 6A3HA 2GUYA 2UY3A 1MVYA 4HMCA 2XFRA 3LPFA 1KGWA 3K1DA 3SIMA 1TVPA 6CGTA 1QHZA 3CGTA 1KQYA 1E56A 3GNPA 1PZ3A 2DSWA 1VJSA 3DX0A 4PN2A 5AC4A 3L4XA 4AISA 1J01A 1WO2A 4PMQA 2WC3A 2V3FA 2D73A 3AZRA 3W25A 1UHVA 4ATDA 2G3MA 1ZS2A 4UQBA 1GQLA 1TUXA 5DT7A 1K9DA 1XSJA 4AD2A 1DTUA 3AXIA 1CIUA 3CTTA 2VUYA 3N1AA 3NDZA 2BXYA 4PMRA 1XC6A 4EK7A 3T08A 3KE0A 1I75A 4XZWA 4BF7A 2V3GA 5FL1A 2WMIB 2DT3A 4DUWA 3K8LA 4XV0A 3LPGA 5ABFA 1JXJA 3DX4A 1VF8A 1UA3A 3VD9A 4MB5A 1QNQA 1XGZA 5E1QA 1J12A 3GXTA 1DWFM 5IXEA 1TVNA 4MNLA 1A47A 1W1PA 1XD1A 2VCCA 4HA3A 1I1WA 2DDXA 2A3BA 2CBVA 3ALGA 3GXNA 4H2CA 3LPPA 3IJ9A 1OB0A 1H3GA 2CIPA 1HVXA 3VIMA 3VINA 2O9OA 3EDJA 3WY2A 1EO5A 1QWUA 2ZUNA 1OWQA 2EEXA 3K46A 1ECEA 1B3XA 4ZENA 1TQTA 2X1IA 3TONA 4D6EA 3FAWA 4URIA 3LX9A 3W53A 1BAGA 4JFVA 1IV8A 2G3JA 5LA0A 2E4TA 1UH4A 3LRLA 2OWWA 4RE3A 2E8ZA 2JEQA 3WF0A 3K8KA 4HZ8A 5CZKA 1XYZA 3T2QA 4IM4A 4GINA 2FH8A 1JFXA 4DO5A 4PUEA 3EDFA 1HKIA 3VMOA 3UERA 4EANA 2E9BA 2WMIA
chains in the Genus database with same CATH superfamily
4IH3A 5FK9A 2EEAA 1TYGA 4FF7A 3R7QA 4JTKA 3SZKC 3QQ3B 3RU8X 3CUJA 2QADD 3EJYC 1UVQA 3GKWH 4NSBA 1PEWA 1J8SA 4LF3B 4PL2A 1KWGA 4UMAA 4NENA 5I15L 2FHBA 1TX0A 2GBUA 4XVTH 1MG3C 3ALFA 4TTUA 3UXIA 2J55A 1NUDA 4QTIL 3BEVA 2X1XR 1HI6A 1FWIC 1KRMA 3RDTC 4G8GD 4YK4B 1SN0A 1LDPH 4DP2X 2R0KL 3MRLA 4GRWE 3ANUA 2HLAB 4AJVA 3C86A 1OAQH 4B9KC 4HNVA 4O4WA 4I7VA 3MMEB 5F9DC 4FNTA 2BW5A 3ZR6A 3AB0C 4Y90A 2J12B 3EH5B 4PJGA 5CMAA 4Z5RB 4RQQB 3X3FH 4BCZA 2N7AA 1X5ZA 3VK5A 1YEEH 2IMMA 3FUIA 3LMJH 4QCFA 4DSYA 1Z7JA 3V6ZB 4XMTA 2NT1A 3R0DA 4Z2KA 4UQ3A 3E2VA 4YGVB 4KI5D 3O6MH 2I9TB 5FYKE 4JLRA 2XNAB 4JHUA 4MNMA 1J2WA 3CV1A 4F7PB 3GSOB 3IF1B 2NQ5A 3CWHA 2PO6A 2WSQA 5T33L 2DJXA 4FXKC 3B6SA 4M61B 2BVOA 2I9LA 4HJSA 2X4RA 2YXGA 4MQ7A 1FTXA 3V0JA 2CZEA 3G1XA 3TOPA 4NNXB 3IGAB 3V36A 4GLRI 1VCVA 2ENSA 1J9CT 3WFLA 4ZTXA 1A2YB 1U58A 1RQEA 2GZXA 1IKOP 4NRZB 3PZIA 3U1PA 1FO0H 4CVZA 1I2QA 4OIIL 5HK4A 1L4IA 4F2ME 3PXLA 2W3ZA 1A4KA 4B3KA 2DVXA 4KERA 2IOOA 4IQHA 5D7JD 3G6MA 1NMCC 2R1MA 4UFLA 3QQ1A 1M7IB 4YTSA 2NUXA 3RJYA 5GZOC 1I8KB 4PJBB 4ADTA 3I6KB 2HVKA 5C7HA 2GTWA 4OKVA 4BKLA 1Y1UA 4ZFZA 4HU3A 2X09A 3AIEA 3VIFA 4GG6F 1DE6A 1KYAA 4QE5A 1F3DJ 3AUJA 4M7JL 5AHLA 3FA5A 3BVDB 3UCCA 4LCYB 4IMEA 4PB0L 3JWNE 2VUNA 4HP5A 1X5MA 4ZQKA 4NLAA 3BLEA 1S3HA 2XKNB 4QHUB 4NP9A 1ZK9A 2GGEA 1Q0YL 1IEQA 5DLCA 1TVLA 4FQIL 2IAMA 1D5RA 1TTPA 2GY7B 4BSWB 1ISZA 4NFCA 4MAVA 4XAPA 4OQTA 3CIAA 5C0RH 1XLFA 4XP9H 5EU6B 3SEPA 4PR4A 3LZNA 4E3VA 4DYJA 1TUFA 4X5XB 4S1SH 3RX9A 2X4QB 3AHZA 5BS0A 3FU8A 3ME0B 1TPXC 4NLHA 4X8GA 4TV6A 5INCB 3WSQH 4J3XA 3G77A 8A3HA 3CPRA 1XF0A 1N12A 4HUKB 1IAII 4YOKA 3B9AA 4ERIA 1EJSC 4PRNA 1A3QA 2NVAA 3T2OA 3WSUA 3UESA 3ARFA 2QPDB 1EGJA 3KWTA 4IOTA 2QFPA 5AW5B 3MKKA 2Z91B 4ZZKA 2R1PA 1EAPA 1WWCA 5DC9B 3TO4A 3E3QE 4HX1A 4LFHD 4WSGA 1TWWA 2BWIA 1JPFA 2X89D 4XCCH 2FZ8A 3BIBX 2XFWA 4OFYA 3HS8A 3V18A 1UKTA 2OSLB 2YAOA 5L88H 2APBA 3ZDZB 5CZJA 2X9YA 3V5DA 2CGZA 1ENUA 4LLQB 3HZYA 2HH0H 1RQBA 2ZJSH 2TMDA 5GGVY 2J6EL 4BRJA 3L0KA 4JFDE 1AZBA 2VITB 1W32A 5FO8B 3LEVH 3ABKB 2QMKA 3VU1A 4WKAA 3VXSE 1LWIA 1J0HA 5DANA 3WEMA 4TLUA 4LSUH 4AKQA 5BS0D 4HH8A 4X7CC 1DYSA 3ZKXC 4XO4A 5IMOB 1SR9A 2Y0SA 1XWYA 7PCYA 5L6YH 1V7MH 1OGBA 2LQRA 2HVNA 5TBOA 2X1PA 2W95A 1XLDA 2X0WA 3QDGB 3PUUA 4XPFH 1M6JA 1A21A 3NGBB 3C0SA 3K2KA 1XF2B 3B4NA 2WLMA 5FECA 5I8CA 1JHTA 3U4KA 3GC2A 3E1ZA 4D9QD 2FZ3B 3JWDL 4XNQB 4IMLB 4OB5H 1L9TA 3TO4D 3SCPA 1VLXA 4HIEB 4X5PA 1QI2A 4NVTA 4LAMA 5C3TA 2YC1B 3CC5A 4V1YA 3BZJA 2GGGA 1U8HB 5CJOL 1QWHA 4Y4FC 1JWUB 5D2NA 5F2LA 2GQHA 4W9GC 4JO3L 4OFYD 1UACH 5JNYA 1K70A 4P04A 2NUTA 2VURA 1TIUA 2VEPA 3QCVL 3N06B 5D7IE 1CF8L 4C1NB 1KGXA 2NLJB 4P59L 1LK3H 2CW6A 1QFUH 4DFIA 5DQ9A 3FKRA 5IG7B 3SURA 2I26N 5JU6A 4QCIB 3LQGA 2HPMA 4DCQB 2QQLL 4Q9RL 1MCHA 3WUFA 1KCZA 4PV1C 4WFGE 1T8XA 3HR6A 3INUH 4D6FA 1KCXA 1L6SA 1A3ZA 3KVPA 1NDWA 1YNQA 4MSSA 1ZALA 2GK0A 4NZ1A 2C1OA 3HJ0A 4XO7A 1MI5B 4ADSA 5EZOL 1UKPA 3U9PL 4RGOL 2A6NA 3H22A 1F3JB 1OL0A 5CSGA 1PG7W 3G08A 2IG2L 3H6AA 2R2BA 3V4PA 1TV4A 1HUVA 4AZCA 3T8VA 1SJCA 1MW1A 4DWDA 1YUHB 1LL1A 3DBXA 3P5ZA 3R10A 4RDBA 3ZLQC 3LTVA 5AOLA 2OMAA 2GQAA 5CN3A 3H9SB 3PL6B 4RDVA 4KK6D 2E0PA 4P2RB 3NEHA 1G84A 1JMXA 1E6JL 4L2LA 5DY3A 4LVDA 1KB9K 2BINA 1F3RB 4PGDA 2QPSA 3QQ4A 3KLHD 3SR7A 2JK5B 3OIHA 4ZNCD 4LSVL 5HGHB 3L8QA 2J47A 4JPKL 1BZ9B 2ZX8A 5E2VL 2G4EA 3VFPA 4D0DA 4AB4A 3VMNA 3P4OB 3LV3B 3MJ9L 4BFEA 4LUYA 2P5NA 1QNIA 1T7LA 3O1NA 3O0RL 2CHZA 1HAUA 3IGUA 3O2WH 2ZRVA 3D1MC 3C61A 4LEXH 3OTTA 2X6CA 3MNVA 3HW7A 4HSOA 4EWND 2NXZC 1HG3A 3H9YA 1DHPA 5I1EL 4FAAB 2HNHA 4OQTH 1JCTA 3WJMB 3EX2A 3QC3A 3BP6A 2YS4A 2PCQA 2G60L 1T1YB 4W9TA 2FK9A 1NGWA 4BFNA 2OX1A 4XPBH 4Z1YA 1JZ2A 3VSQA 1W72L 5D4QA 2AV7A 3GS7A 5EOQH 1DQJB 4NN6C 9RUBA 1GY2A 5I71B 2YYTA 1K7FA 3UPBA 4L0YA 4GIAA 2BXZA 4LOCA 4CVWA 4DKEL 4Y1AB 1EGJH 1TZIA 4RV3A 4BV1A 3QAZC 3V9EA 1CL7L 1H50A 4F8LA 3ULSA 2YCEA 4PEEA 4BD4A 3WLBB 1OIFA 1NGZB 1WC7A 3W7MA 3W11C 5JYLA 2PWFA 3AYSA 4FL4B 2PTTB 3GSXA 3H2OA 3KRBA 3PPCA 5FO7B 4J35A 4H83A 3LHPH 3V79C 3UJJH 1KLUA 1BIIB 4MUPA 5BW6A 1U8QA 4NQDE 2ITEA 1I8LC 3FQYA 1BFSA 3SW6A 5K39B 5EU5A 4YXHH 1B0WA 1PXGA 4JYEA 1ZV2A 3QIBA 1A7PL 4XR8C 1Q4WA 4XBMA 5GGQH 2RH9A 4GMEA 4OT1L 3KLAB 1S7TA 3KD4A 3C12A 3ARBA 3MNWB 3SHSA 1ZV9A 3GC3A 1V02A 3T2NH 1K6AA 1MN4A 5HHXL 5GS0D 3ONBA 5FIEA 4MD0B 1RUQH 1ETB1 1BQUA 3GKWL 3FYOA 4A21A 3QYQA 5CPQA 3UWYA 1YPFA 2VWEE 1FIGH 4X80H 4P8XA 3N41B 2RALA 2GYSA 5BZAA 2Z6JA 4M5ZL 2YEVB 1Q3NA 4JZNA 1QEWB 1WFUA 4KU1A 1PLCA 5J6GA 1XGDA 3MP4A 3DBNA 3P3SA 4ZFQA 5I0ZA 1MFAH 2CR6A 5T1DH 2WQAA 1KJVA 1LDPL 1E4IA 3FQTA 1U42A 3GG8A 4MCZA 4H8HA 1OAQL 2WNXA 1EFZA 2J57A 1A0EA 4GD0A 3WAJA 1B30A 2W0KA 1RPXA 5JH2A 3VDCA 2ZZ6A 4JN6A 2DWSA 4Z7UE 2F53A 2BSCA 3UEQA 1SLUA 3US0A 4RMTA 2CGYA 4Z7VE 3V4UL 3WEXB 1H6FA 3LMJL 4L9LC 2Y2YA 3T3PB 4PJ9D 4HS6A 1QW7A 4Z7QE 1H41A 1JRCA 3QIBD 3O6ML 4JQVC 4NWTH 3VXTA 3LTSA 3RF9A 2ZYIA 3ARBD 2BWDA 1ECQA 1UR8A 2CBJA 1G4PA 4ZOAA 4BUGA 3ZT6A 1TPVA 1YEWA 3AM8A 2GBVA 4W7VA 3IVUA 2PR4L 3ZO0A 4W86A 1KULA 2CBMA 4PUNA 2C9AA 4URTB 3DUSB 4ZODA 2VLME 4YSPA 1K8DB 5AVTB 2FL5A 4YE0A 2RH0A 1B4LA 2GJZB 1CC3A 3G6JB 1OK4A 4N0FA 3TROA 2EO1A 5B39B 3EUUA 1PY9A 3V4PH 2DPKA 2GBAA 3FF8A 2VW7A 3SN0A 4C83B 4Z0JA 3MRQB 1N26A 2ZCKL 4QLWA 1HNYA 3D05A 2L7EA 3WXVL 4YHIB 5IJVB 4R96B 3RX5A 1QK2A 3QC0A 1MCLA 1HXKA 1LQBC 2WCPA 4NI8A 2F53D 1ZIAA 1U3NA 2WQ8A 4U1KB 5ABAA 1AGEB 3KCPA 1OM9A 5J12B 5IOPB 3IV3A 3STEA 6TIMA 3FN0H 1EJRC 2UVFA 3D0AA 1QYGH 4B5UA 2Y8KA 4XH2A 5FF6B 4RZKA 3MRGA 3DHFA 4Z1DA 4YFDB 3WBAA 3KYMA 4GRSA 1VYSX 5C6TH 2QVMA 2EUXA 2NUPB 1TJ0A 4S1SL 1NOAA 5DK0B 4J6RL 4UFMA 3M0YA 2WXMA 4YUEL 4R4BB 3RMJA 1ZHNA 2CQVA 5ICZB 1DBBH 4DJFA 4IJTA 4WDXA 5CCHE 4TU1A 3BHBB 3HB3D 4FQQA 2FB3A 1J5CA 3ETTA 4UFKA 1MQKL 4JFUA 5CJMA 5AOMA 1PNDA 3VFMB 1HVQA 3HI5H 4V28A 1E28B 2MCPH 1J0KA 1F7BA 4MQTB 1S7QB 5K9OB 4X4KA 1SFTA 3CHVA 4PAZA 3ZDZF 2G75B 4UTTA 1YECL 4G9FE 5ECUA 2E59A 2XCMC 2K8QA 4KK8D 1WIPA 1OG6A 1Q8MA 5GS0H 1G9EA 3EOEA 4XCCL 2CJTA 2DORA 4ETYA 5MHSE 3F4NA 1GKPA 4R84A 3UTTA 1E7VA 3IU4L 5EU3B 1DVYA 5L88L 4ADIA 2PE4A 4AXNA 3ZHKA 1JV5B 1XIDA 4Q4MA 2ZJSL 2BJMH 2C91A 3LHTA 2FUQA 4BZ1L 1YJDC 3QPKA 4W8BA 5CBAB 2NZ1A 3WLTA 4OFKA 3U6WA 2LLNA 2WJEA 3SDCB 3IDMA 4Y5VB 1S5VA 4LEQA 2DZUA 2SEBA 3QWOB 3U3HA 3VRLF 2B39A 4KJQD 3MOQA 4PJXB 4NUQA 1MUMA 1DE4B 5L6YL 4JTRA 3WNLA 4P61A 3EYPA 4E0CA 5FA3A 4X7FC 3OQ3B 5C07B 4XPFL 1WKFA 5I6PA 1XR2A 2WLIB 1SPQA 3BG3A 3S1UA 1QSEE 2VDNH 1O6TA 1PUDA 5HDBF 3AY4C 1KM3A 1Q0EA 1NARA 4OB5L 3S2AA 5DFVC 2GJXB 2GJ6E 3J27A 1GGUA 5AVQB 2VJ0A 3USBA 2XFFA 2CCWA 1Q1JH 1X9UA 2PDWA 2QHLA 2Q86A 2NSQA 2WXFA 1FHNA 1EJ7L 5HHOE 5K59F 1R30A 4HKBA 3NJKA 3UTTD 4CN6A 3QSTA 2PC4A 4GSDL 1X7SA 1LK3L 1C91A 3MI3A 3O6DA 3HRZA 1M3UA 1JPTH 5IHWA 1XYMA 5A7EA 5IW3A 3WMBA 4RZ5A 5F4WA 3EFOB 2GL5A 1R87A 4AY8A 2WMPB 3G5ZA 1X1NA 4Y4HB 3MLVL 1EBPA 4L9DA 1A5AA 3PG9A 4UQ9A 3QDJA 4D8LA 3PZNA 1U1JA 3LS5L 3EJUA 1W72B 4P2QE 4CKVX 2EAEA 1LP9B 1FWRA 1ZJHA 3HBPA 1OP3K 3ZN6A 3OC5A 1GY1A 3O81A 1DUZB 2QVKA 3LKRA 3RCNA 4HA0A 4H01A 1KC5H 3UIYA 2DQUH 5C0JA 1A02N 2VDMH 4AMWA 4QHRA 4WFFD 1NDYA 3UTQB 3AACA 1CVRA 3LPFA 4WO0A 2EE0A 1HGWA 1P48A 5C0NC 5PCYA 4AISA 5LWYH 3LN4B 3DROB 5JOFB 5FUZH 3MROA 4MMZB 4RMSA 1RHFA 4RAUB 1DTUA 4Z23A 2VUYA 2WWNA 3NFNA 3GK8H 2DQCH 4GRMA 3W1MA 2C9VA 1UA3A 1ZGLP 4MB5A 5E1QA 3M17B 4GSQA 4QTHA 3LZPA 1BZOA 4X0KB 4MMXA 1OB0A 4KPLA 3MSRA 3HE7A 2O9OA 2BZDA 4EI5D 3OODA 5BOFA 4C6LA 5G4EA 2BNQD 1TQTA 4N9DA 3LX9A 3W53A 3RRQA 3PWJA 5GSVA 1QUNA 2YAPA 4LCVA 4F9PC 8RUCA 2FR4A 3EX4A 3T2QA 4O52A 3ATAA 3PNRB 3G5YB 3QDJD 3DX9A 4NUGH 1QATA 3B9NA 1PBYA 2V2WA 3MQIA 3F83A 3O2WL 2GQ9A 3WJZA 2XIDA 3Q1SH 1K6QL 4Q22A 1EF3A 4OBRA 1RJQA 4NYUA 4L5FH 5PTDA 4LVEA 4RISH 3M6YA 1H9DA 1WYJA 4LCQA 4EQ2A 3IMBA 1T1WA 3W7OA 2MPVA 4QQ3A 2DSZA 3FU5A 1BXVA 2BVQB 5KG9A 4UQEA 3I6EA 4N0UE 5K1JA 5C6MA 4XPBL 2TSAA 3FSOA 2H6PB 1W0YT 1NOLA 1AJ0A 4MXQD 3D85A 3GBDA 1M03A 2MQCA 3DHUA 3GYRA 3QJOA 3OG3A 4IRZH 3L7FB 3CAVA 4P3DB 1U8MB 5L4MA 3WNMA 3B2UC 4EBQH 3R2GA 5I18L 4XPTL 3FU7B 2B1OA 3HE7D 2XA3A 1G7QB 3DSNB 4EPKA 3RNQA 4RXFA 3LKNA 4E0RB 1KLFB 3AABA 3NM1A 3MJYA 4N2KA 2WO4A 1FP8A 4CU8A 3BC9A 3V4VA 1E65A 3W37A 4FXJA 2IANE 1ROWA 1NWPA 1MIEL 1JDAA 3BLKA 5D1XE 4G70B 3EMQA 3HG2A 1BVZA 3I9GH 1PE1A 4ZW7A 1P7BA 2I57A 3OGCA 2MKLC 1TLMA 2FNWA 4YVXA 5E0CA 3LHPL 3UJJL 1MQRA 5GQBA 2PRLA 2Z6FA 2XTLA 3KWWA 1JWMA 2VFIA 4K7PX 4ZW8A 4JY6B 3RFZA 4PI0A 3LN5A 5IB5A 4IOIB 4LHUB 3EJPA 4YXHL 1P2CB 3I6GB 1S3TC 2P42B 4X9GA 5GGQL 3PAZA 1MUJB 2H47C 5GIRA 4Q8BA 2VEIA 1S7VA 2VWEC 1FWAC 3DVNA 4AX3A 1Y6NR 1RZKH 1M3JA 3VQ1C 1XINA 3SN6N 1NJJA 5A6JA 2AP2A 3F5WA 3D85D 2DWXA 1WZKA 1JNHB 3RUGF 1VP5A 3M88A 5FUOH 3LUTA 2CRMA 1FIGL 5DA4A 3TDFA 1JPKA 3PFQA 4F7EA 1UH3A 4TKWA 4NKQB 4PBWD 2DLFL 2X7WA 3WK3A 3EHBC 3LKOA 1EEZB 3ZUCA 2D2HA 3QJAA 3V7AG 5FV2A 5K4XA 2XZZA 3OXSA 3TCLA 4Y9NA 1MFAL 1E4LA 4D9RD 3CLEH 3QGVA 3W0KA 3GSNL 1BBDH 4MD5B 3T3PF 4POYA 4M7LL 1SFLA 2Q7YB 4GNVA 2FJFB 3TIDA 1J5IA 4YSEA 5D9PA 2Z1VA 1V79A 2XFGB 3M0MA 1UP0A 3QS2A 2CLFA 1SYSA 4UQ2A 3QUXC 3REVB 2HNEA 2HJKB 3S98A 3RX3A 4XN9A 5D1QA 7ENLA 3HAEB 3QJTB 4EF3A 5I00A 1YKWA 3R06A 4JMXA 3V5HA 2BP5M 4RDQG 1N4XL 2WLNA 3N2OA 1U91A 5LIYX 3CV7A 3O3BB 1GC1H 3ZMEA 3BKCH 3W2JA 3VQMA 4EUPG 1L2UA 4N2EA 3O6FC 3BLBA 2XBDA 4ZXBA 5HHMB 4LMQE 3RWDA 1NEYA 2QJDA 5LNDA 3OBEA 5J8OA 3RX7A 4F2TA 3RY6C 1K8IB 1H5YA 3GUWA 4EKJA 4AVJA 1ZE3C 3BH4A 3WCYA 1S78D 3CV6A 1QFPA 1YDYA 4PUBH 5AG9A 4JHAL 2EXWD 3KPPB 5DDHB 2CDFA 4UTLA 4QR6A 2WHMA 2INZA 3TCXA 2K78A 4PJCF 3RZCD 4GIPD 2LR4A 3V0WH 3WMPA 4FXSA 2ICES 1JZGA 1FV1B 1Q4NX 2ZZ3A 5DJDB 1JRHL 4J6IA 3X12B 1X98A 4U4MA 4O28A 3AXKA 4O19A 3RHWF 4ERSH 4NKDA 2Z8WC 1KTJA 3QSKB 2CO7A 1GYNA 1G9MC 3NK3A 4U33A 3FN0L 4GKSB 1QYGL 4ZZ9A 5EU9A 3POCA 3U46B 4GG6B 3HV8A 1DXEA 3NJXA 2ISVA 5F3FA 1XLGA 5C6TL 2J75A 1DLFL 3HG5A 4FALA 2VR7A 4PUMA 4C4BA 2FWSA 4FMKA 1BG9A 2BOBA 1XIWC 2ED9A 5DGQA 3CSGA 5DN1A 1LORA 3CH8A 1HX0A 1Q0XL 1CFNB 2YW4A 1YEGH 3C8KA 5KVEH 2X0HA 4CCDA 1DUYA 5ESQB 2A4CA 4KFMA 5I16A 2I5YH 1IFGA 3RK8A 3DO3A 4CADA 1UOKA 5IEHB 4MX7B 2VC7A 4BFOA 2C3XA 2GDQA 2PDPA 3NO5A 3Q2DA 2PP8A 2MCPL 1FWEC 2Q3AA 3DRQA 3TNMB 3TXVA 1KGCD 1X6LA 4UTUA 2C9QA 4Y7MA 4KX9A 4W9IC 2NY0D 4E5XG 1MZYA 3F65A 3F2LA 2EXYC 1X6UA 4WUUA 1T2JA 4ZMQA 1C5BL 4JZJA 3UG3A 1E6QM 2DB8A 5GS0L 1SW3A 4BWLA 3GDMA 5DYOB 5AZ2L 2BY1A 3NQFA 4G6CA 4LVNB 1EHLH 3EZ8A 2XWDA 1RQ5A 1QRKA 1UB6A 5DA0B 4IOSD 4PJXF 1G7LB 3B37A 2BJML 2F54E 3MO1B 2YAEA 2ED8A 3GTTA 3SCOA 3QG6B 4LUTB 1OB1B 1G1OA 5A6TC 2QMJA 1NQBA 4B95C 4DEWA 3V4VH 3MB9A 1BGGA 5I5MA 5JHBA 3A3WA 1SNRA 5EO9A 1UT2A 2R6OA 3WNIA 4DJEC 4CQCA 3FFCA 1NCDL 5JXED 5F1KC 5CBIA 2RUSA 4ZOCA 4KRPC 3S3JA 1D2KA 2F8QA 4TTDC 4MNHA 4PV9B 3SSJA 1JYWA 4BK5A 1PCXA 2VDNL 3VFUB 3GW3A 3RTQA 5FWQA 4L61A 1FNGB 1ZK5A 2FQDA 1D5ZB 3TZVC 3SODB 2KPWA 2A1WH 2FECL 2O61B 3LGDA 4S1FA 4UR8A 1P4BH 3FQXB 3J8F7 1Q1JL 3U4EA 2GT9B 3PAVA 3C75A 1FFOA 3WKPA 4N0RA 5IEKB 3MOBH 1HYSC 1MJ7H 3M0XA 1Z2KA 1E4KC 4JRYB 4HJEA 5T3XD 5JIKA 1K4HA 3RXZA 2VN3A 1FLRL 2AKRB 3TYUA 5EBGA 2GVEA 3L3GB 4PRHD 3FJ6A 3BPLC 3AHXA 3B04A 3NEOA 3GAYA 3JUGA 4KXZI 2VLJE 1G4MA 4J1UB 3O4LD 3S2NA 1WG3A 3HPLB 1U3ZA 4LCIH 1TZOA 4IG2A 5GNZA 4WXZA 3TWBA 4UBPC 5AVSB 3ARGB 2WQDA 1UGKA 4ZMAT 2DQ6A 4J3TA 2DUZA 2GSEA 4KETA 4H9UA 3FFCD 4AQ1A 4KKAD 1F8IA 1JDEA 4F0HA 1WAWA 1BF2A 3WXWH 3TO2B 5B38G 2MFNA 4NRXB 1IEBA 4FOKA 4O16A 5DRNB 3UTZA 1QNPA 4U1SA 2MTAA 2VXQA 2R0LH 3HIZA 2KHAA 3U7YH 2XWCA 3TH6A 2OJEB 5D7LB 3O6YX 1NDTA 3TWYA 1GIGH 2HRGA 2E25A 5E94A 4I2XA 1YNYA 4NQUA 1Q7ZA 4HZ7A 5A1AA 2VX7A 5AYXA 1KJ3L 4OLYL 2E7HA 5AN7A 3VFRB 3ITYA 1VKXA 3ARTA 4Q8PA 2QF8A 2VN7A 3AGVA 2YXOA 4OFIA 2DQCL 5ABHA 32C2A 1BQRA 2IGFL 5B3SB 1ME7A 1B0RA 4HKXA 1EXBA 4J3OF 2QYGA 2J2ZB 4BXSV 3F4CA 5FA4B 1CECA 3KYKH 4MCMA 3WIHH 4JAMA 1FJ1B 3CFCH 4ZPTB 5FFLA 3APGA 2FQIA 4KZEL 3KZ8A 1DDHB 3G5WA 2AK4E 5HI3D 4Y2DA 1I1AB 3UACA 4B3LA 3GTVA 1Q38A 4ZS7L 1XKYA 3BVVA 1H8SA 5FCZA 1RUPH 1UJ3C 2EHHA 1I1RA 5GGRB 4HGWA 3TR9A 3UAAA 3HE6C 2G96A 2NQLA 1FG2A 4MWAB 4CBPA 1OM3L 5JPMB 3KM2A 3F3HA 5DJCA 2INFA 4LB4A 4JO2L 3IJYA 2OCFD 4RISL 4PY8J 4DJDA 1GZHA 3D3AA 3ZJ8A 1ZLPA 4OZGB 2R69A 4G7VH 3EBAA 4PCSA 3GGWA 4JG1L 1VESA 3CSPA 4XWOD 1ZT1A 3HPAA 3CTLA 2P76A 2OMTA 5CGYD 3IETB 3L4TA 1C5DA 4FFVC 2PKDA 1IKFH 5IVZA 3GSNB 3LM3A 4PCYA 1BTMA 2BOEX 4ZMXA 5L2JA 2ZX6A 3GMLB 1V10A 1T99A 4FQJH 3U2SA 4PJAA 3L3DB 3QJUB 3P0XA 3TFKD 3UGVA 1KXHA 5C1MB 2PDBA 3KCLA 3WKZA 4IRZL 2ITDB 4DZ8A 5K3VA 2ZYFA 1CLXA 5E93A 1UD4A 3AWOA 4EBQL 1FX6A 4JTUA 3ZTEA 5KYWA 3SOTA 2VLRA 4KX7A 3SPHA 1K3ZA 4EKXA 5EUOB 5D1XC 3C0QA 4DHLA 3EYOB 2JJSA 4XD4A 1XV8A 3MLTB 1ML1A 1Y8BA 2DQJH 4PUDA 3CNKA 4PD4K 3LZLA 3E49A 4LCRA 5I24A 3DECA 2J5WA 2X1SA 1CFSB 4NAFB 1MAJA 4OZHA 1TO4A 4U05A 3VG0L 4BCEA 5T3XH 2CU9A 1NQ6A 4KZDH 1BLNB 4A4AA 5T5NF 3FVDA 3GSQA 4DJDD 4PJFF 5D02A 3VRJA 1EUAA 4JQ1A 3MRPB 1CZ8H 1QSFE 1MCEA 4U6VH 3GRWA 1W5OA 5I76A 1SO6A 4PWJA 2YD7A 1VADB 3QZWG 1YDPB 3RO8A 4PGLA 3LCGA 4X8CA 5TQLA 1KGJA 1P53A 1DJNA 4ZUVA 3SM0A 2XG5A 2XZAH 3DOSB 4ECNA 3GLAA 3E2HC 4JTHA 1MQPA 5ITFB 3N4AA 5FUOL 1TU2B 1ZSDA 4N8VG 4PCKA 3ITLA 2YGYA 3PFUA 1QA9B 4PGBB 2ZKXA 3CZLA 3QPQC 4NO5A 3KP1A 4JQAA 5IV2B 4LBRA 3C2EA 3CLEL 3VYPA 3MS8A 5I3JA 1I3RA 5DJXA 1BBDL 1TCRB 3BUYB 2B3IA 4Z0BL 4W1TA 3GQFA 1ZIBA 2QQKL 4PB9H 4LRIA 4H9TA 3KBPA 3IYLW 2FYYB 2JV6A 4GBXC 4IS6A 4Q8VA 1GCFA 3BZ5A 4M1CD 4DT2A 2W91A 2BVWA 3ABOA 3ILPB 4I5RA 1D9KA 2IXVA 2KI6A 3SYAA 1FVCA 1R85A 3BGGA 3TA3A 1BAWA 1MHPH 3CVIH 3SDXE 1R3TA 3ESUF 3VDHA 4MZ2A 1IZKA 1MIML 1LBFA 2H8PB 1GC1L 2FPYA 3BKCL 5F1NA 4HUXB 2OMXA 2OTUB 3L9YA 1HJQA 2XFXA 4C5YA 3DX1A 1SJBA 4MNQE 5B8CB 5I77A 2VZOA 1IGSA 2FX8H 1NC2A 5C09E 2AJXH 1KEGH 1YLBB 2OU4A 1C9SA 3H2WA 4OECA 3VFTB 5LGJA 4HC1A 2FGLA 2CKBL 5DCEA 2A3HA 3EOOA 2HKFH 5EBLB 4S2BA 3Q6GH 4PUBL 3WQVA 1XH0A 2Z35B 5K4ZA 4PRAA 1OK0A 4PRIA 2PBGA 4K07A 3B06A 4X5LA 1TPB1 4RDYA 4TV3A 5DVPA 4NO0A 1D8CA 4HDIA 5D6DA 3QEGH 4C56E 4H0GA 4PUKA 1OHQA 3V0WL 5LDSA 2NW2A 3QUHA 1FYHB 1MJUL 1WXJA 2ZRYA 3PP3H 3S2MA 1DR9A 2NY3C 4KI5F 3UWQA 2OMYA 3QR2A 1FZMB 3T7VA 4RESB 4XAWH 1CVSC 4U5KA 4PV8B 1K8ZA 2VDNB 4PJ9B 5GGVH 5J3HD 4RUBA 2GJJA 1XIIA 2XWJB 3DV6A 4EJ1C 4WJXA 1M65A 4N1EA 2V82A 3E0IA 1RZMA 4RAVA 3O0FA 4Q9QH 3K4WA 3AREA 2PO6D 5FW6A 1NBYB 5A6SA 4O2FB 1OT2A 4PN6A 1NC2D 1BZ7B 4ISVB 5CSUA 4F9DA 3L9EA 5DI8A 5KVEL 5C7XL 4LJ3A 1HKKA 4O1FA 3BXNB 2I5YL 2F58H 4XVJH 2BVDA 1LQ2A 5CBJA 4E8DA 3HQ1A 4PRID 4J4PC 5E8DH 4ML4A 3TNNA 4G42B 1H1ZA 3NZ8B 2CLPA 3M16A 3AG3B 3D3VB 4PJGF 1IT9H 4NO0D 2R1WB 1ICTA 4X22A 1WCQA 3MZ2A 3VC5A 4ZNEE 1YMHA 3CK0L 3GFUA 3NA9H 4WHTB 2JKJA 3FJ4A 5HANA 1GSKA 4ANWA 4MXVF 5AKSA 5T1MA 1CI5A 2BSRA 5HDWA 5IFTA 3LMZA 4CQDA 4HV8B 3L13A 2KZHA 4ALDA 3TTYA 4L6DA 4GXMA 1I53A 3DURB 4QXUH 4GT0A 4BFFA 1X1OA 1TX2A 2IAMD 3L5WA 3O7UA 3W24A 2FGWL 3F4VA 4NPYB 1POJA 5F2MA 3M45A 3V4VL 4L37A 4Z77B 4Z3EA 2WV3A 1KXTB 1KT2B 2J8TA 4PYSA 2WVSA 1V51A 5ISZE 1A8ZA 2Y2WA 2NNAA 1XW8A 2NXGA 3GIVA 2P5PA 1VACB 2XFRA 2BOFX 3W76A 3W72A 3LNPA 3CO8A 4PVNA 3NJNA 1I7UA 4X8XA 5FEPA 1L9WA 3DSFH 4X42A 5FL1A 2NY7H 3GRWH 3MACH 3RKDD 3OXRA 3BN9D 3RU8H 1B4JH 3TPUA 3ARFD 4Y2WA 2A1WL 1J12A 2OMWA 4C6MA 4FZ8H 1P4BL 3TN5A 2DDXA 3HFYA 1Q9KA 4ZQNA 4IX0A 3NIDE 4EZLA 3MOBL 2HFTA 1LEIA 1QTPA 5HYSB 3WLNA 1MJ7L 4B90A 1JGEA 5MKGA 2EUWA 1H15A 4ELKB 4ZUTB 1DKWA 4URIA 2YBVA 5IHLB 1YADA 5HDBB 3L6FA 3LRLA 3O8AA 1ZS8A 5C8JB 2Z31A 2H26A 1BXNA 1H7NA 2YX0A 2X1UA 5DD6A 4WI0B 2ETWA 1IEVA 4Q2ZB 4DO5A 3E0FA 2OR8A 4PJEA 1THAA 4YHGA 3RWHB 2G30A 3QARA 3DX8A 3RWCA 3V6OA 1N5YH 3OKLA 3FDWA 4Z8FH 4YDJA 2K9UA 1OXYA 3QRGH 3WXWL 1A6VL 3I7RA 4QRRA 4TNEA 5KVFE 5FKPB 1E40A 2XU2A 3PNWA 1BIHA 1EQWA 1BRLA 1Z6JT 3CHEA 2I16A 3DG3A 3S0PA 1FFNA 4NGHH 3NP3A 4ZAKC 1IIHA 4QBXA 4YVPA 4LSPH 4OCXH 3RWEB 3UJRA 1CI1A 3MV01 1CI3M 2FIKA 4A7GF 3ML8A 3NCFB 4TXEA 4HJTA 3UTSE 3NCEB 1BEXA 1OEPA 1PZSA 4LL9A 1FY6A 1L9QA 2GK1B 1SJDA 2J7LA 4G7EB 4I9XA 3JTSA 2NX3A 3CAWA 4IBQA 3MYJB 3UCRA 3FO2B 2WZEA 3AZSA 4IIFA 3NZHH 3K71B 4Y89A 4Z76A 4HC1H 3W2DH 2Z31D 4PRDB 3U7AA 4G71B 2FTWA 4WDWA 4N02A 1X5XA 1PDKB 2J8UE 2AVFA 3KYKL 2F74A 1C08B 3WIHL 1CFTB 1U8JA 3IE4A 2AMXA 5HY9A 3I6SA 1EC9A 1KLZA 2IKHA 4BDVA 3CUPB 1UJPA 1UUOA 4OZGF 1HXMA 2CESA 4QRRD 1HDMB 1X7QB 4PGEA 3D33A 4IISA 1HZHH 2J4GA 3OKEB 1Q6DA 1K1DA 4PR5B 1DBKL 3MUIA 3QJZA 4K94L 4I48A 2G2PA 2QV2A 5A40E 2EDWA 3ZGHA 5CN1A 4Y4KA 2ZXGA 2HTKC 3ROLB 5EOTA 1DEEB 4G7VL 3L2NA 5TDNA 3W2UA 3VXQA 3TLRA 1C29A 4NT6A 3APMA 5HBBA 4FB7A 5F0MB 1TTUA 3DENA 2OWCA 1IKFL 1P1ZB 4RZCB 2O9TA 5I02A 3VB8A 5MEPB 2IAAC 4U1JB 4GAJL 1BQLL 5EUOF 4FQJL 4JICA 3IUHA 4YSSA 3W2KA 3MRRA 4WCYL 3QMRA 3CX5J 2E56A 1SN2A 3WO4B 4WTZG 4M9OA 1FNFA 5IR1A 3T0BA 4YHPA 3OKDA 3MMTA 1IYXA 4FXRA 4Y5XB 5E0KA 3D6NA 3T2PA 3QFDB 4YDVA 1CICA 4IIEA 4O13A 1LOSA 2Q6WA 4EI5B 5JXQA 5BW7A 2BNQB 2A6JA 2ZXWB 3FT0A 2X6VA 3SUSA 4WUKH 4IM8A 3ARDA 1L9SA 2NYYC 1DBAH 3MJGX 3HNVH 1EUNA 2TRHA 5TDOB 4HIXH 4J12A 3UR8A 2RDXA 2IQTA 3SFKA 4CEXC 4MKVA 1Q8JA 3WTWA 4RPQA 2J5LB 4KZDL 3BZEA 1NM9A 5KBLA 5CFHA 4Y4KD 4M5PA 4MJ5A 1G7HB 2G97A 4WI7A 3QHOA 2FRGP 4RMVA 2CKBB 2YDQA 1WAAA 5IBUG 3SGEH 4ZMGA 3QNYB 2DRUA 1CZ8L 3PS7A 2ZQ0A 5HHPA 2NY5C 1ZRUA 5CUSH 4AG4H 3IFNH 1HGYA 4IIQC 3FNDA 4U0RC 3RJXA 2UZXB 4AZ5A 1O7AA 2IC2A 1EQCA 2XZAL 2UY5A 4O15A 5KSAA 4L4PA 3BDBA 3ECQA 2VFEA 2JKTM 3H4GA 2CE6A 2C9SA 5G55A 1ODUA 1QI0A 2VISA 3NZ1A 4FR6A 5AHMA 4AWEA 4JK0D 2BNRB 5BMFH 3KPRA 3KLQA 5C9XA 3LNDA 4M4RB 1UENA 4XVTL 2AXGA 1HESA 2WYZA 4MCNA 1PFOA 4IOFC 3P3RA 2ICWA 1GZJA 3RUGB 1MQQA 1THCA 4M19A 5CEYA 4N90E 3NJMA 4PB9L 3WENA 1OX5A 2B4CH 4H04A 5KYUB 1HILB 2D31A 3TIEA 2ZDRA 4N6RA 3CT7A 3N3TA 3S3BB 1MJJB 3MCOA 1KFAH 4WHBA 4DELA 1S8DA 4HA1A 4IRSC 5TD4A 4AK1A 4CRPA 4L8DB 1U5JA 2D23A 3X3FL 5DJ6A 3W23A 3C8FA 3HS0B 3VA2C 3FN3A 1K8YA 5IFPA 4XOBA 1YEEL 1JPST 3TJXA 5FF7A 4F7MA 4I18B 4ZQPA 4NKOB 1MHPL 5ANMB 2Y22A 3U2CA 5EPDA 4OIFA 2WTRB 4TX8A 4PE8A 5EMJA 7TAAA 2ESVE 2Z64C 1DO6A 4NC0B 3B3IA 2Z7ZA 3ETBJ 3LMYA 1ONXA 2HS8A 2FX8L 1GOIA 4DNLA 5F7FA 1TVBB 1NEUA 4A3RA 2YOAA 3ZM8A 2DYRB 2FUTA 3JV5A 4O2CA 3H9HA 4ZA0A 4FG2A 4ZVJA 1FO0L 3Q6GL 4D3CH 3KPRD 1JOIA 4N8PA 4TUOB 4UAHA 2C26A 2WO5A 4APXB 3AG2B 4UBDC 5LNRA 1SRDA 3Q65A 3W86A 3R8GA 3SE3C 4ZS6D 1LO0H 5EC1A 3A3HA 1CD0A 5I19H 1LE5B 3UJFA 5IB1B 3HC0A 3SBQA 3FQUB 3G8EA 1DV7A 4IU3B 3CHDA 4YBHA 1EANA 2RQ8A 4XD6A 4GW4A 4DK6A 4U3AA 1PAZA 3QJFA 2YD2A 3LSOB 4NSKA 5E70A 1OWRM 4XAWL 4LOFA 1J93A 1T8QA 4WWKB 3RBSA 4RRPM 4D9LH 4PJCB 3CDYA 3STGA 3TH4T 3PWPE 1RALA 5I1IH 4Q9QL 1LILA 5JTWA 3N1MC 1U8IB 1UR2A 4N25A 4Z95H 5C0RL 4XP9L 1ZP4A 2EDLA 4E38A 4IK6A 2VAAA 4Y5YC 1R9FA 2PCFB 2MQGA 3L21A 4RJEA 5BV7C 5M2FX 4LF1A 1SXCA 2F58L 3D47A 4XVJL 3QA3B 3WSQL 5I6OA 2EO7A 2QPFA 4HXBH 3HFFA 5E8DL 2QDEA 3OJDB 1CBJA 4K2UH 3RVTC 3NJVA 2XRAH 4L8SC 3VRIB 3N04A 2JIXA 1IT9L 4AD3A 3D87B 2ZG1A 3ZJAA 1F11B 4YNGA 1AAJA 3AS2A 5MENA 3NA9L 3RVXD 1EHXA 1NIDA 4CCEA 3VI4A 4QXGH 1RZ8A 2KLTA 4F48A 5GSRA 3A6OA 3FQWB 3PFRA 4M02A 3GY1A 2I69A 4LYPA 1OSPH 5D2XA 4X8JB 5CJ5A 1PDZA 3KEHA 2O5NA 1OGPA 1KPUA 3CC1A 3CDGB 3SQLA 3OAZH 2CLVA 4W4QA 5HDRA 1XGPA 2H5UA 4MKSA 3WDRA 4QXUL 4JGMA 1XGTB 2HH0L 3H23A 4N85A 3MV9E 3W6YA 5MEQB 2GVLA 4TNGA 2XVBA 1ZXQA 2HUHA 5C0CB 3LEVL 1KPVA 3NCCB 2VCBA 4LC8A 2YGVA 1YY8A 3WO8A 3ULUD 4HJ0C 4LSUL 1T4KB 5HYJA 1NFIB 4XTRC 1UWYA 4R2GD 1IT8A 3KW3A 5F1SA 1KTDA 1V7ML 1V54B 1YNTA 1FVEB 5G5DA 4DJFD 5FKAB 3DA0A 2X87A 3QEUB 1ZTXH 1W3IA 3DSFL 1HZKA 3FDKA 2NY7L 4EE9A 1C7TA 1E3FA 2DT0A 1B4JL 2VX4A 1WBJA 4OGZA 3VGBA 3AI0A 3S6DA 5LGZA 4U6YA 5DMJB 5EEXA 5MEND 3T0EA 2G0LA 3G7TA 5EIQA 5IQ7H 4DP0X 3C8NA 3AU1A 1OG0A 3PP4H 3Q2WA 4RA3A 3D25A 2QUVA 2M1KA 5SWSE 5I0DA 5DJAA 5CPMA 2G5BA 1AGDA 3VXRE 4JFFE 1URZA 1UACL 4JANB 4MQXC 3BUVA 5AB3A 3F85A 3IDNB 1SW7A 4C5ZA 3X3GH 3W7JA 2QCEA 2PLKA 4OZFB 3LB6C 2H0PA 1MFCH 1QFUL 4TVUA 5IHZB 1CYGA 2H0FA 5IP4A 4B9IA 5G5IA 3RVUD 3W4RA 3EOBB 1H7RA 1L6WA 3MFGB 2VLLB 1N5YL 3Q4DA 4ESKA 5DJ8A 1CG9B 3H55A 3QFJA 4CQBA 2DQEH 2ATAA 4Z8FL 3F6IA 5E8EB 3VJ6A 3QRGL 2ATSA 3L66A 3F7VB 3GR4A 5C71A 3INUL 1WFTA 1DO5A 2HWZH 4AKPA 3CFQA 4X7DC 1EDHA 3LXBA 1UOLA 1E67A 1BBJA 3ZJKA 1E9PB 1BYPA 1J1XH 2LU3A 3PZGA 1HXJA 2IV9A 3KLLA 4LSPL 2W0FA 4OCXL 4U0QB 4NZ4A 1QTYT 5TK2A 2VX5A 1E2ZA 1AJZA 2YD5A 2IPKB 4D0CA 5J1AA 1J8RA 1X6NA 3C60A 4DN4H 1JXGA 5HJBA 5D9SB 3CFDB 2KX9A 3P1VA 4LP8A 3C6LA 1Z48A 3RRAA 3FCSA 4P2VA 2OMNA 4HC1L 2Z3FA 4UANA 5I78A 4BYHA 5I2IA 2OMZA 3MKCA 2VDKH 4BFRA 3M0IA 4G6FD 2G0WA 1OE3A 4M7ZB 1G0XA 4M0XA 1FAIH 3O4LB 5HGAB 4NUJB 1S39A 3EMCA 4P46A 3UL4A 1S2TA 5LN8A 4M7TA 3S2JA 2IQAB 5FJRA 5BRBA 2YRZA 2R23B 1B3OA 3GS4A 3GSUA 5A3HA 4LB8A 2CR0A 3JTTB 1HZHL 2RGMA 1KBGH 3V7MA 4TNFA 4UMSA 2WBWB 1E6RA 1NWOA 5ESVB 3GVQA 2KAUC 3M6DA 5HVWA 4M82A 1L9MA 1DIDA 2VM4A 2JFEX 4LEXL 1WDRA 4MWFA 4MXWH 3TYEA 4LDEB 1RVGA 3W75A 5FAGA 2P24B 4OQTL 1EJTC 2F2HA 4YJZL 4RNRB 2A77H 2FB2A 2JKXA 4HCHA 3ULUH 3JZEA 1QW8A 4G6AD 2BIHA 3TEXA 1ZEAH 3OPUA 2EYSA 3DERA 4TSBH 4JPQA 1ZA3B 4O0KA 4K71B 5EOQL 1V27A 2DWDB 2YXFA 2Q3RA 5EMMA 3LM7A 4DZBB 2BY0A 1GVOA 4PYGA 5HMDA 2HN7B 5JQ9A 3LPWA 3ECUA 1EF2A 3ILDA 1VBJA 5D2LE 1RD5A 1GPWA 4HPYH 1EGJL 3BV7A 1PY0A 4YZFF 4YQXH 1JAKA 1EWDA 3B3BA 3C2AH 1DBAL 3HNVL 2BSSB 3QEQE 5IOKA 3L5LA 5GJTH 1HJCA 1CE1H 3DI2B 4YR6B 5M1TA 3FRPG 2YPLE 2AL2B 1OY3B 4PRTA 2GSGA 2Z7WA 1NFKA 1B2WH 4AX6A 4ROPA 5EN2B 1L0XA 1FO0B 3MGTA 4MAYA 3E0GA 3EBHA 3MA8A 3WEAA 1XT5A 4UTAA 3PGFH 5CUSL 4AG4L 4P8VA 4DWSA 1B6UA 4RK8A 3RX2A 2OL3A 1RZPA 1QHOA 3K0WA 2B77A 3AWNA 4QAMB 4WNJA 5BRZB 2HE5A 2F8IA 3T2NL 2ZYRA 3AIUA 4JFWA 5BYWA 2LFEA 3QNXB 4PJFB 4YHYB 2CUIA 1RUQL 5GRWA 3ZKMD 4UIOA 2ZX7A 3ES6A 3RTLA 3MUGA 4X80L 2R8WA 3CQHA 1PKQE 1WE5A 4E9RA 1U21A 5T1KB 5C0AB 5D5MA 3LZ5A 4A55A 3RDJA 1KGIA 4GW5B 3BP5B 3IGFA 3QDMB 3ROOA 4QPEA 4GIOA 4KGLA 2FT8A 3D51A 3AU6A 4BQ2A 2H8XA 5T1DL 4FFTA 1MFDH 1VRDA 3TLLA 1NJ9A 1BVKB 2DWEA 1LO3H 3LOTA 2B4CL 3VWJB 3ORWA 3H0TA 4LNRA 1OQOA 4F15C 1Y0LB 2H3NA 1T5WB 4QAWA 1W3TA 4UT6A 5A8PA 1J05B 1R5VA 1KFAL 2RDUA 2H3BA 1MLCB 4DAGH 5FHBH 2DV0A 4ZK8A 4BR1A 4OIBA 3I10A 4JFYB 3AQUA 1RERA 4OJDH 4V27A 4WKFA 3MBDA 3C3UA 3HLKA 4CVXA 4E9YA 1CBVH 5DMMA 4ODUB 2VFFA 4E4FA 4IQDA 1AQDB 5DJYB 4NWTL 4DVBA 2E1DA 1WA2X 5FDYA 5BRQA 3QOMA 1M2VB 4AQLA 4GAAA 3LD8C 1RJLB 3LH9A 4N3UA 1T0PB 4HETA 3P80A 2Y6SC 4BH7A 3N11A 4J3UA 3MGOB 3CHPA 3O3EB 2QADB 2GITA 4D3CL 2KLRA 1UWXK 2A9NH 5D2YA 4M4PA 4A3HA 3T0XA 2PYEA 3T8MA 2PC8A 3CDZB 1RJYA 5HVHB 3LI0A 3APNA 1Z0NA 3V4PL 3QIUA 1KIQA 4QHLB 3AIVA 4NXSA 2DQDH 2FIRT 5ABFB 2NTFA 1DJYA 1EB3A 4G8GB 1Q9OB 5FLVA 1YNKH 5HDOA 3S5ZA 3RL2A 1HHJA 3L95B 3N0PB 1JZHA 3FT3A 5LKNA 2W61A 4B5XA 3D0LB 1C9DA 3DGBA 5IWLA 3T65A 4UTWA 1IUZA 2VL5B 2CR3A 4OZOA 5D1QD 3JV6B 4D9LL 3C5ZC 2VO8A 1R24B 2LE9A 4HNLA 1KNOA 2PCEA 4PN2A 4BE6A 3L4XA 4P9HC 4L2YA 3W25A 1TUXA 1H7WA 3K5SA 4AHPA 1NBZB 5I74B 5FK9B 1Y5VA 3LPGA 4ZXBD 1TE6A 1TTIA 3S1GA 3TC3A 4LSSH 4HPJA 1DBBL 1LBLA 3LCIA 4LLUA 3O4OC 1UVQB 3Q2LA 1AOZA 1M4KA 2N0KA 3NZUA 4HISA 1FH2A 4FIQA 4J2MA 2R14A 2IOIA 4AWJC 1EYEA 4NENB 4ERAA 4KKCC 5L2KE 2HUEA 5E00A 2G3JA 5LA0A 3HI5L 3QIUD 2QJIA 5D7JB 3BEVB 3W7GA 3EYSH 4P2AA 1HI6B 1DVZA 1W1B1 1HCFX 4GINA 4EI6A 3LZRA 1R2RA 4QXGL 2DTMH 3MRLB 3NSCA 3RG6A 3ES8A 2OO0A 4N0CD 1XBVA 3C2SA 3SE4C 2ZWSA 3ESPA 1KTRL 1OSPL 4XX1E 2ZT9C 1SMDA 4FXGA 1TJ2A 1GMIA 4FI4A 2FGZA 1BEYH 1AD4A 4S3JA 4PJGB 1CGWA 2QPUA 5CMAB 1NUNB 4NAEA 1GPOH 5A2JH 3TR2A 2LLGA 3DO7A 3PJNA 2H2SC 2Y8UA 1CK0H 1XX1A 3L3HA 1E4NA 1WS7A 1WUNT 2XUWA 3CWGA 3WUGA 4UQ3B 2BM3A 5IVXA 3BZGA 4JLRB 1LWJA 1T4WA 3NFPA 2PO6B 4CSZA 3Q1EA 1P9MA 4TMPA 3B6SB 4NUMA 3NDYA 2BVOB 2I9LB 2X4RB 4MQ7B 4A2MA 2EEFA 5AALA 3NQAA 3GSVA 3HGOA 2PEVA 1NEZA 2EVIA 4JDYA 1U58B 4CVZB 4UT7H 3GMRA 2MNJB 2ZUVA 4ELME 1A4KB 1N6VA 5E23A 1VCAA 1TZ9A 2OL3H 3KLSA 2Y63A 4ZUSA 5IQ7L 1LMKA 4WUUD 2HVKB 3WIIH 4QRBA 2VXVH 2GTWB 4OKVB 3CO4A 4BKLB 4ZFZB 1Y6MR 3IRSA 4KXAA 1G0CA 3IE9A 4KTEH 2DY3A 4C55A 2R1LA 4IBZA 3UP6A 4F8QA 4HULB 4KWSA 2J21A 3X3GL 2IBZX 4ZQKB 5C0FA 5E9XA 3SY0A 1JXKA 3II2A 3SDDA 3ZE1E 1UKOA 1JPTL 2IAMB 1DJWA 3PWAA 3CZFA 5BWAA 1H3XA 4AG0A 2VGLM 4M62H 4D6JA 4D8ZA 1G7PB 4LCWA 3URQA 1TCMA 2HE8A 2VW4A 3SO5A 3GINA 2Z92A 2VUOA 4OI8A 4K7PY 4UT6H 5BS0B 1AR1C 3TJHD 4JHOA 2W62A 4Z3GA 5C08A 3NA4A 3AROA 2J27A 4O50A 5JYMA 1KO0A 1NICA 5E7FA 5I3KA 2VTFA 4QGTA 5SX5H 5IJKA 1SOQA 3L4WA 3NESA 3RTQD 1JZ6A 1KC5L 1WISA 3CLMA 2DQUL 2GKIA 4A35A 1ZT7A 2XTJC 4GEJA 4PRNB 2VDML 5GS2D 3ARFB 2WM1A 2OMVA 2D7QA 4DN3H 3VKJA 4IW4C 4DN4L 4WU5A 2X9WA 5KJRH 2PDHA 1EAPB 4B3EA 5LWYL 3TO4B 3WDQA 3OQEA 4CD6A 5FUZL 4HX1B 1UATA 2XIOA 1TPC1 4XOEA 5E2JA 1JPFB 4PS8A 4XPAH 2BIMA 3GK8L 1G1YA 4XKMA 1ILUA 3FYPA 3RO6A 2VDKL 3OA5A 4PCTA 2J1ZA 5KS9A 3FSTA 2ZOUA 5F1UA 1BJ1H 1Q6RA 1CWYA 5FWRA 4GUFA 3NQ6A 3V5DB 3H2QA 1FAIL 5LUMA 1FPTH 3HZYB 3GZPA 5FM4A 3F64A 2FTAA 1VERA 3ILEA 2IKGA 2V5JA 3QN3A 1U3HA 1XRSA 3ARZA 4LCWD 4H7CA 3WEOA 3PS6A 2H1LM 1N64H 5F8RC 3UYIA 3WGUB 1U8OA 2D20A 4ADGA 2OR2A 4GUIA 1KBGL 3JYCA 4Y2NA 4MD4A 1WT5C 3NQ8A 4S2CA 4NUGL 5C08D 2ZNXA 4JFZH 5J9PA 3C2FA 1MAMH 2R0WH 3UZXA 1HQ4A 1WBXA 3BW4A 1RH9A 1KYDA 3Q1SL 2CU0A 1D3GA 3MSDA 4L5FL 1QBBA 4Q52A 4Z7OE 3CFNA 3D34A 3QUZA 4MJMA 2OTDA 5FECB 5I8CB 1AYRA 1JHTB 3GU9A 1DWHM 2UV3A 3VGFA 4CMHB 4JFXA 1GTFA 3SSZA 2GIXA 2WKOA 1TPDA 3E96A 3CC5B 1ZEAL 4X5QA 1AZCA 2C3GA 1V6XA 3ZQ9A 1GQKA 1KD0A 3EKLA 5SWUA 2P5WA 2FNBA 1W31A 3UYRH 2PGWA 3F2CA 3KWSA 1BVOA 4K3EH 3QSRA 4NBZB 3M41A 5JNYB 1OGAE 1GYMA 3EGDA 3LNMA 2NUTB 5TIMA 1M71A 1EOMA 3W29A 1M6UA 3OHXC 2ZX5A 4DUVA 3CLWA 4L65A 3RPMA 4JHMA 5DQ9B 1U3HD 2EG8A 3AXMA 3WKNA 5AKRA 3P77A 2JJWA 3C2AL 3JXAA 2APXA 4RFNB 4Y2DD 2JKEA 2NR6C 2ARJQ 5FYJD 3GMNA 2QLYA 3FV9A 2AMUA 3KH3A 5C9UA 1A7RH 2EVGA 3I9GL 1CE1L 2GK0B 2O6EA 2C1OB 4MVBC 1ZVYA 4M6NH 1GJPA 2A21A 5FLUA 2VXUH 3V4LA 3N15A 1TWIA 4JPVH 1ONRA 2WAGA 2WQPA 1WVZA 3WFHA 4LL1A 1FCBA 3DK0A 1DQKA 1S5WA 3FT9A 3PGFL 4GY4A 3QUZD 2QSQA 4DUOA 3G08B 4YBLB 5I1CH 4N9GA 3QLLA 1N18A 1OCBA 2R2BB 1RZQA 3V4PB 4G7QB 3L3OC 3HMXA 4AZCB 1H2JA 4OGYH 4RRPG 4UIKH 3DBXB 4QKXB 2FFCA 2P5WD 5IHBA 1RZKL 1H3TA 5ABDE 4AUBA 3EMZA 4HQQH 4JL1A 4H9XA 3R19A 1FA2A 1J96A 3MHUA 5IOBA 3GRBA 4KKBD 4YDZA 1R8LA 3PQYE 5I17A 3W01A 5BXTA 4PUUA 4GJIA 2AJZA 3AQDA 2VEKA 1BPVA 2VLRD 1Q9WA 3SI9A 4A7UA 2ENPA 5AW8B 5GS2H 3QGAC 3WD4A 1FCGA 4PGDB 1YIXA 1TZ7A 3G3DA 1MFDL 4GG8A 1BMGA 3VX1A 1SUXA 3QQ4B 4HAFA 3LNHA 2ENYA 3HQPA 3FFSA 1QBMH 1M04A 1XRFA 3MX0A 3VFPB 4D0DB 1A6ZA 3GZ3A 4PODA 3BLIA 3BD3A 5HJDA 1YDOA 1VF5C 4FHJA 2VC9A 2B5IB 4DAGL 5D70H 5FHBL 1NBQA 3B2VH 5G4WA 3NT0A 4QE4A 2V17H 3PDDA 3CZNA 2HLFC 3OD3A 5HWJA 4KJWD 1HJWA 4PJAF 4IUOA 2OYLA 4YIQB 1CBVL 3KJ4C 3MNVB 4X6DA 1XBXA 1ZKAA 5EBMA 3BGFC 3X14A 3WLRA 1YSOA 4UQCA 2C19A 1J88A 1A9BA 4IXXA 3BP6B 4GMSH 2ZNWA 5C2GA 1C7SA 1NGWB 1RPUA 1FE8H 2PWVA 2IIJA 1XRVA 3WUEA 3OBKA 3PIQA 2PDFA 3MCNA 3FOLA 3AO0A 2AV7B 3DXAA 3WBWA 2O4MA 3NZGA 1ETZA 2VXQH 4I3SH 2P5EA 4OZHF 1IT0A 5DZJA 2FHFA 4UMCA 1RLCL 4FC3E 4I6VA 3VKDA 3SSGA 1TZIB 2CLZA