1HT6A

Crystal structure at 1.5a resolution of the barley alpha-amylase isozyme 1
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
404
structure length
404
Chain Sequence
HQVLFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVSNEGYMPGRLYDIDASKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDSRGIYCIFEGGTSDGRLDWGPHMICRDDTKYSDGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLDFARGYSPEMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKVGGAASAGMVFDFTTKGILNAAVEGELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDTGSTQAMWPFPSDKVMQGYAYILTHPGIPCIFYDHFFNWGFKDQIAALVAIRKRNGITATSALKILMHEGDAYVAEIDGKVVVKIGSRYDVGAVIPAGFVTSAHGNDYAVWEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ALPHA-AMYLASE ISOZYME 1
publication title The structure of barley alpha-amylase isozyme 1 reveals a novel role of domain C in substrate recognition and binding: a pair of sugar tongs
pubmed doi rcsb
source organism Hordeum vulgare
molecule tags Hydrolase
total genus 140
structure length 404
sequence length 404
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2000-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF07821 Alpha-amyl_C2 Alpha-amylase C-terminal beta-sheet domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1ht6A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1ht6A01
2VOTA 5I3DA 3K46A 4D6HA 1LWJA 1WZMA 4KGJA 2BXZA 4GI8A 2X05A 3J7HA 8A3HA 4PTVA 3WL1A 3GBDA 1EH9A 3BAXA 2X8RA 3RJXA 5GNXA 2VVNA 1VFFA 2F18A 3QHNA 2WMHA 1I75A 5IDIA 4X0VA 2ZUVA 3ARYA 4QP0A 4F9JA 3U5YA 3S6TA 4AMWA 2YLLA 5BXRA 2DH3A 4PMXA 2NT1A 4KRUA 3VDHA 4Z2GA 3S5YA 3WD4A 3G6MA 5BXSA 1ISXA 1CWYA 2Y8KA 2J7FA 4BF7A 3FNDA 3ZJ7A 2XYLA 4BQ5A 3AXHA 3WFZA 2E9BA 3NSNA 2W67A 1KXHA 3WF4A 2F1AA 2W61A 1LLOA 2XG9A 4PMVA 4FNPA 3KEHA 1JD9A 1CLXA 2EPNA 2WMIA 1WDSA 4GZIA 1PAMA 3L4XA 3W6LA 1ZS2A 4E8DA 2PI6A 4GPNA 2VQTA 3AROA 3MU7A 4W7VA 4C7GA 2VC9A 4GIAA 5ABGA 2DSUA 4BQ3A 3PZUA 5A1AA 3RMEA 1OCQA 2WVSA 3LMYA 1B9ZA 4BS0A 1HKMA 2ZX6A 3L4UA 2UY2A 3BUIA 4HMDA 1K9EA 1KCKA 3A24A 3VSVA 5I23A 5DO8A 4LXFA 3WF3A 4JFSA 1JL8A 1GOOA 3B9EA 4FLSA 2ALWA 4D1JA 1PZ2A 3A23A 4PTWA 1E6SM 2WMIB 2XVKA 4P7OA 3N13A 3TOPA 1H41A 2VL4A 5E0CA 1PJ9A 3AIVA 4WJXA 1AVAA 1PBGA 2BVYA 3QHOA 1C8YA 1KGUA 5CQ1A 3BVWA 3VGBA 2VR5A 1V02E 2YDQA 1D3CA 4OIFA 1KR0A 4HPGA 3VMPA 1K9DA 2D24A 2W4XA 4D6GA 1K9FA 5ABHA 3ECQA 4W8BA 3KL5A 1BYCA 3OA5A 2WXDM 1KFWA 1UD5A 3WD1A 2GDVA 3RILA 1JYVA 1PS3A 2D0GA 2GK1B 1GVYA 4DWSB 3B9AA 1DTUA 3F5KA 2QV4A 2VX5A 3UG4A 3U7VA 4HA3A 3VIKA 1UH3A 4DWSD 5I0DA 3WD2A 3GXMA 3PBGA 1ITCA 5M17A 1JNEA 3AS0A 4QLJA 4CKQA 3H55A 1W1YA 1BYAA 1GJUA 4HZ7A 1G01A 2XN0A 3CV5A 2DSWA 3IJ7A 5FKYA 1OT2A 2Z1SA 1G94A 3WEZA 1E5JA 1E6ZA 1UWSA 4HZ8A 4M29A 2VRJA 3BAJA 2GSJA 1C91A 4H41A 5FCZA 3AIEA 2A3CA 1UR4A 3ARRA 2XFFA 3CBWA 5HPCA 1E4IA 3N04A 1CTNA 5TD4A 2V5DA 2FHBA 1D7FA 2A3AA 2UY5A 3UG3A 2CBIA 1K6AA 1QNQA 1PEZA 4DO6A 1EOMA 2PF0A 4BZYA 2J47A 1V6WA 3HG5A 3FHAA 1V6UA 5EBAA 2QLYA 5D8WA 3CZ8A 2OSXA 3AOFA 5CLTA 1W1TA 4AD3A 4AZGA 3VM5A 1J12A 3U7BA 3ZJ8A 1KXQA 4PUEA 4IPLA 3OB8A 2WMKA 2C8NA 3WEMA 3EMQA 5A69A 3D4YA 5AYBA 1B3VA 4UQBA 3NIYA 4FF5A 4XV0A 4CU8A 2DT2A 1CBGA 4HP5A 2WLZA 1TA3A 2VMFA 1QNPA 2Y8VA 2C7FA 3O2LA 1CDGA 2OW6A 4GI9A 4GZJA 5CPQA 4MNLA 2ZX8A 1CGYA 3EDKA 1E4MM 4R5EA 3WD3A 4AC1X 1XD0A 1OWQA 2JIEA 3TTQA 4XB3A 3UEQA 2EACA 1Q6FA 4M80A 3W25A 3UCQA 2NSXA 1F4HA 1OBAA 4IM4A 5AYIA 1GZJA 2WB5A 3NSXA 2X2JA 4L4PA 4CVUA 2Y2WA 3WDRA 2J8GA 2EPOA 2JEQA 3UERA 2WANA 1ISVA 4ACZA 3M07A 1TA3B 1CGVA 2XFRA 1M04A 3CMGA 5DMYA 2QPSA 1CPUA 2J4GA 2VCCA 4N0RA 4NRSA 4OBRA 1JZ5A 4CCEA 1UG6A 2EXOA 2ZWZA 5BRQA 2XVPA 2D20A 3TTOA 3EJQA 1KB3A 3WF1A 5HBFA 2BVDA 4PEEA 1J18A 4UFHA 4HA1A 4EAMA 1DWFM 4KGLA 1GOWA 2WCGA 1H3GA 2Y24A 2XPKA 4W8AA 2WK2A 1VBUA 3A47A 1G0CA 1XH2A 2YBTA 3RO8A 5A2BA 3GNPA 3MUAA 2IXVA 3BC9A 3THCA 2IGTA 3MUIA 3WNOA 1UWRA 1OGSA 2C0HA 4S3JA 4CVWA 4JIEA 5BXTA 1GOQA 5CG0A 1U30A 1BTCA 1QI2A 1C8QA 4U31A 2AMGA 4HU8A 1EDTA 5A2CA 2J7HA 1HJXA 5E1QA 1M53A 1VF8A 2E4TA 1MW0A 1UASA 3WNPA 2WCSA 1XGZA 3RDKA 3CHFA 3N15A 3AHVA 5CPSA 1KR1A 1MXDA 1CENA 4AMXA 4A3YA 4FNUA 5A8PA 1UR0A 2YL6A 2NT0A 1H2JA 7TAAA 1EQPA 5A6BA 1XH0A 1E0WA 3WQ4A 1R34A 2JALA 1UKOA 2DQXA 1I1XA 3O6AA 1GQIA 3WUFA 3MKKA 1WDRA 3MO4A 6A3HA 5D9MA 4GKLA 3WH5A 4Z2IA 3VGEA 4AZ5A 4AWEA 4ZXOA 3SCSA 1WE5A 3OGRA 3GZAA 2YKKA 3WNLA 4MDOA 2YFNA 1BYBA 2D3LA 1GPFA 2F7QA 4F79A 2YA0A 1SMDA 4JFTA 1HVQA 1V3IA 3N1AA 1B3YA 1QVBA 5AC4A 5GNYA 2OSWA 2BHUA 5A8MA 1BYDA 2VCBA 1SYTA 3NDZA 1TMQA 1UWTA 4TTGA 1JFXA 1GNXA 1PX3A 3W0KA 1P6WA 1B1YA 3AHTA 3EJRA 4GO9A 2V3FA 3GBEA 2CITA 4NXSA 3ZT7A 1FH7A 1MQRA 3PZGA 5EFDA 3AICA 1JXKA 2VZUA 2WMGA 3K8LA 5I5RA 1W9UA 3QGVA 4H04A 5A8OA 3RM9A 3DYMA 3FW6A 2A3EA 1EQCA 2GJXA 3W4RA 3AZSA 4RE3A 5GNZA 2WLYA 2WHJA 4QDMA 1OSEA 2HVMA 3VGDA 3AIQA 3A6OA 1LG1A 1R7OA 3DDFA 2QHAA 1CZ1A 4P8WA 3BMWA 3SCRA 1GQJA 1M01A 4TX8A 1XHGA 1QHZA 3SCOA 1V6VA 3D50A 3DYOA 1XRVA 3GXPA 1R75A 2BS9A 1E15A 1W9PA 3IANA 1BG9A 5DFAA 5CPTA 1LJYA 2OLHA 4K68A 1VJSA 1ISZA 4U3CA 2X09A 5CGTA 5I77A 3VMOA 1JDCA 1GQKA 2DT1A 1VEMA 3CPUA 4WKHA 2YBUA 3BCDA 2ZXDA 1R33A 1W3JA 1LL6A 2BV9A 1VIWA 2G3NA 4W93A 3VM7A 1S46A 1ESWA 1J01A 3WELA 1XYFA 1MQPA 4GINA 4LYQA 1LL7A 2DSKA 3K4AA 4AXNA 5I6SA 3QOMA 2G41A 1W3LA 3LPPA 4KWUA 1DWIM 2J74A 4F9DA 2WC3A 1NWTA 4DUWA 7A3HA 2WVUA 4JCMA 2E0PA 5BYWA 1E6RA 3T2QA 5HPOA 4W7WA 1UH4A 2VNCA 1UOKA 2CETA 5DT5A 1CECA 5E6YA 1QW8A 3QHMA 3LXBA 3ZSTA 1NWRA 2J62A 3VVGA 2F2HA 2ZXAA 1F4AA 2XGIA 1BG4A 3WDPP 4AZCA 4XUYA 1N82A 4PMQA 1DWAM 3BAWA 2EEXA 4MNKA 4NZJA 2WZIA 4YN5A 2OWCA 2VTFA 2WNWA 1JIBA 2WAGA 3WBAA 3DECA 2RGMA 1KGXA 3HU7A 2EABA 2BY3A 2O9PA 2XGBA 2BXYA 3CUHA 4UFJA 2EPLX 3ARPA 1BVNP 1WZAA 3AS3A 3ARUA 1JD7A 2CBVA 2VQUA 3CHEA 2CNCA 1CXHA 4TX6A 3ZMRA 2EADA 1IZJA 4Q22A 2WW5A 4U3AA 3AYRA 2J25A 1V3LA 1XSIA 4PUDA 1JDAA 5ABFA 1J0YA 1VRXA 4AZCB 3SEPA 5HDRA 3VD9A 4AIOA 4GQQA 1W2VA 4F66A 1B3WA 4AD1A 1JAKA 1YHTA 3CH9A 2GVYA 4MAZA 3EYPA 3EJPA 2UY3A 4XX6A 5D9OA 1LF1A 3GXTA 4EE9A 1XSKA 1GVIA 2OWXA 1BFNA 3OGVA 2DIEA 1V6YA 1IT0A 1JZ6A 2WBKA 1O7DC 2PWHA 3PTQA 3WDQA 4EANA 3EMCA 5LA0A 2XM1A 4PN2A 5JBDA 2XVLA 3KL0A 4AZ6A 4YPJA 1UZ1A 3K8MA 2ZUMA 3T0AA 2J7DA 1JZ8A 1FOBA 5A2AA 1UYQA 3LRLA 1UD3A 1E5NA 2VJXA 3T09A 3BVTA 3VGGA 3AIRA 2GJPA 2JFEX 1TQWA 3W53A 3A4XA 4OUEA 4AD2A 4BQ4A 1XH1A 3W6MA 1E6NA 1MQQA 1Q4NX 1MYRA 3UR8A 2ZWYA 1FH8A 3SUUA 1C92A 2ZOXA 4J3WA 3VNYA 1GCYA 4P8VA 3UG5A 1QPKA 3WMSA 4UFIA 2QMJA 1HL8A 5A6MA 5CSYA 5E9AA 2WMJA 1E73M 3VGHA 1H09A 4J3TA 3QR3A 1B2YA 1MW2A 2IUZA 3ARTA 1W9XA 3N17A 5CJ5A 1QNOA 1UWUA 3VDCA 1WDQA 4U33A 2FGZA 1GW1A 3MSDA 3N9KA 3TP4A 3AYSA 1KQYA 3LX9A 3AQUA 3VD3A 1XV8A 1ISWA 3TTYA 6CGTA 4NF7A 1B3ZA 4D72A 1GQLA 4RE4A 1AQ0A 1JI1A 4E8CA 1UA7A 4Y7EA 1E6XM 1KWKA 3T2OA 1TVPA 2O92A 2WSKA 3UESA 4BCEA 3TA9A 2OYMA 2G8ZA 4EKJA 4PCSA 3OIHA 2PBGA 4QCFA 2GJRA 2W92A 2WVVA 3VUPA 1KXVA 2ESCA 1TE1A 1HXKA 2F1BA 1G1YA 4UTFA 4YHEA 3BAIA 1KQZA 1W3HA 3EBVA 3SUSA 1E72M 1SR0A 1MFUA 4BA0A 1GJWA 4FNSA 1MVYA 4GQRA 5JIPA 1NWSA 3WQ5A 1JYXA 1CGWA 3CUGA 2QMKA 3BLKA 3BLPX 3GXIA 1A47A 4M24A 2G3MA 3AZTA 4M8UA 1B3XA 3PTMA 1BVZA 5A6SA 1QBAA 2CYGA 1UKPA 1E55A 3DHUA 3ZSSA 2WVVB 1E1EA 2EQDA 5IHRA 1Q6EA 3AXXA 3LPGA 4MB3A 4CD8A 3OZOA 4ZXLA 2WHMA 1BPLB 4CN1A 1UA3A 3WH7A 1B30A 2CPUA 2V3EA 5IXEA 2WHKA 2BVTA 2D3NA 3WUEA 3VIMA 4JL2A 3D51A 1CIUA 3W81A 1CXEA 3AS1A 1J11A 4WKFA 3OZPA 3WY1A 3OLIA 3PHAA 4JHOA 2J7GA 3KZSA 1I1WA 5A8QA 2V5CA 1J10A 4JFUA 4E4PA 4PYSA 3PZIA 2PC8A 3ARWA 1CXFA 1KTCA 1O7AA 3CZKA 3AIBA 3BSGA 5FL0A 3ALGA 1W9DM 4CN6A 3D52A 3W82A 1EHNA 3AMLA 2W63A 1RD6A 1JZ2A 3ARXA 2J79A 2X2HA 3W24A 2OYKA 4DO5A 2AOSA 3T08A 4OGZA 1UZ4A 2CESA 4FNTA 3RIKA 1UD2A 2CERA 1GUVA 1TR1A 1FP9A 4D6JA 4AZIA 5ABEA 1E3ZA 5IFPA 4B15A 1XD1A 2YDRA 4W89A 3ZT5A 3HG2A 5D4YA 5JBEA 4TUFA 3AS2A 3FXYA 3WDIA 4HMCA 4AD5A 3CO4A 3F5LA 2PBOA 1FFQA 1JG9A 4W87A 1VAHA 4D71A 4CU7A 3DX1A 1J0HA 4PSPA 2VZOA 1HT6A 3IJ8A 1H0IA 1W1VA 2DGAA 4H7VA 4WSKA 1DWJM 1WO2A 5I24A 4H8VA 2WPGA 1W9BM 4W85A 4LQ1A 1J9YA 3ZIZA 2YL8A 4FMVA 4L4OA 1ODZA 4UFKA 4ZFMA 3SCWA 3WIJA 3ZOAA 1NP2A 2FDMA 4B9YA 1V0NA 5E09A 3MMUA 2BY1A 1QOXA 2XUCA 3PZQA 1E71M 1HTYA 3PZOA 1WCGA 3CIVA 3HZ3A 1UR9A 4J3VA 4TVCA 4HOZA 1QNRA 3GTNA 2CIPA 2ZXQA 4PMRA 3SCVA 3VD5A 4DM1A 2YA1A 5GPRA 2CHNA 1FHLA 4S3KA 1E70M 2YA2A 4WLCA 1QWUA 1VBRA 3AIWA 3WKZA 2PWGA 1UWIA 4ACZB 4LX4A 1LQ0A 3W29A 5I2UA 1B90A 1XYZA 2VVSA 5A94A 3BUDA 3VX1A 1QI4A 1C90A 1TCMA 4NRRA 3IAPA 3GXFA 1WNOA 4PTMA 1PPIA 3K4DA 1JAEA 2E8YA 2ZX9A 3L4WA 3SCNA 3ZQ9A 5D9NA 1CXKA 4HMEA 1UWQA 4AISA 3SCTA 1R8LA 1UH2A 3DDGA 2ZUTA 1TVNA 1RP9A 3WY2A 3CC1A 1V0MA 2J7BA 2UY4A 4PBGA 2WC4A 3AJ7A 4M1RA 2FE0A 4P7NA 3VINA 5ECUA 3PZVA 3ZJKA 4AZBA 1HKJA 1RPKA 2WVTA 1EGZA 4UCFA 1V0LA 1W2PA 4W84A 5LA2A 4H8HA 4FLRA 1HXJA 1PX4A 4BQ2A 2YJQA 4HTYA 3TV8A 3SUTA 1VEOA 1BHGA 4CD4A 4W86A 1NP0A 3VDBA 5A6LA 4D6FA 4A3HA 4B9ZA 3NYDA 4FLQA 3PZNA 1Y7VA 1D2KA 3AHYA 4TTUA 4CD7A 1X1NA 1JZ3A 4J28A 4DWSC 2CEQA 2VI0A 4AZHA 4AIUA 4P7RA 1OT1A 5JIWA 2TAAA 1E0XA 2JF6A 4MNJA 4E2OA 5BRPA 1TQVA 1M03A 3WY3A 4A4AA 3N18A 4NI3A 5DEZA 1JZ7A 1V0KA 4D6EA 3AHXA 5A6BD 3WD0A 2WBGA 2JIWA 1DWGM 1G9HA 1V6XA 3ZM8A 4X9YA 3HJEA 4M82A 3THDA 3ZT6A 4JFWA 3MUY1 1HJQA 4JAWA 4U5IA 1VFUA 1FH9A 2XSBA 1V3HA 2JE8A 1OM0A 4PRWA 5BCAA 4CN4A 1OD8A 2WZEA 1H11A 1JGIA 2FH8A 1C8XA 4CGTA 4KH2A 4NXKA 2ZXBA 1JNDA 5A6AA 3W28A 4AYSA 4C7FA 3BAYA 2E40A 2D2OA 1HIZA 1VEPA 4H8UA 5EB8A 4MTVA 3FHQA 1KBBA 3L4TA 4MAVA 3UETA 1JZ4A 1E3XA 4B3KA 3EJUA 3EDDA 3VKKA 1OIFA 3PZ9A 2OSYA 2X1IA 2PWFA 2ZX5A 4NZFA 2J78A 1ZBCA 3VO0A 4U2ZA 4J3SA 1AMYA 1US2A 1NM9A 1QWNA 4MB4A 3FAXA 3GH5A 2GJXB 2XVNA 5C71A 1ZBKA 4TVDA 4AIEA 3EDJA 2WHLA 2FGLA 5LYRA 2E8ZA 2AAAA 2XIBA 3SCPA 5F7UA 1C93A 3A4AA 2IXUA 2VR4A 4IPNB 2CXGA 1WAWA 3BGAA 5JUVA 3DX0A 1FFRA 4UFMA 3A5VA 2ZIDA 3MANA 4PCTA 2O9OA 3WN6A 4HA4A 3WEOA 1QX1A 1UD6A 5GQBA 4P8UA 4U2YA 3MMDA 5A8NA 1HWWA 1PIFA 4AMCA 1NH6A 2BNJA 3APGA 2GUYA 3CZGA 2DT0A 4PMYA 4QAWA 1TQTA 4LYRA 5KZ6A 2Y5EA 2F7OA 3OLGA 2VZSA 1ZB5A 1NOWA 3AI0A 3U5UA 3D3AA 3GH4A 2GFTA 3OBAA 1OD0A 3OGSA 3HG3A 4J27A 1CEOA 1UKTA 2FHCA 3M6DA 1BF2A 2W91A 1EDQA 3NSMA 1HN1A 1ODUA 1CGXA 5DF0A 3KLLA 1J0JA 4UFLA 2FH6A 2WMFA 4ATLA 2WWDA 4CUCA 2ZUWA 4MB1A 3LXCA 2WCAA 2X0YA 1X6LA 2XTKA 4V27A 3RM4A 4NX0A 3WH6A 3LPOA 1MW3A 1YQ2A 1KBKA 2Z1KA 1FP8A 3BXWA 1GOIA 2VZVA 3EMZA 3ALFA 3WENA 1KWGA 2D23A 1E1FA 3ZO9A 1HKKA 3IK2A 4QLLA 1RP8A 1H49A 5D8ZA 4MJ2A 3K1DA 5I78A 3CTTA 3NDYA 5A6JA 3VIGA 3CGTA 4MJ4A 4UZUA 3LRKA 2YL9A 3GXDA 5A95A 1R47A 4AZ7A 2HISA 3II1A 3BSHA 2FHFA 3FY1A 1CGTA 1V3KA 5ABFB 1FA2A 4ZE5A 2JF7A 1GHSA 3M46A 1BAGA 5CXPA 3KE0A 3MV11 4WSJA 3EDFA 3WDHA 4XZWA 1JFHA 2CCRA 4U5KA 4WKAA 5AC5A 1DP0A 1JI2A 2BHYA 4AEFA 4M56A 4PMNA 3KWXA 1G5AA 2DDXA 2J77A 1R46A 1ZBVA 1JYNA 9CGTA 5FL1A 2BFGA 2BY2A 1OGGA 3F4VA 3WQWA 1V02A 3F5JA 5E70A 4RL3A 1SZNA 1OB0A 1HNYA 1GHRA 2DH2A 1LL4A 4JKMA 2WSPA 3CZLA 2J7CA 4CD5A 2OW7A 1K9TA 1HP4A 4HPHA 5BXPA 1ISYA 2X2YA 8CGTA 2DPEA 1EO5A 1B31A 4HOWA 3WNKA 4B16A 1CXIA 3GM8A 1QI3A 2WKGA 1E6QM 1J0IA 2GK1A 4AY1A 4DWSA 3DHPA 1FHDA 1GONA 3WH8A 3WL0A 4ML4A 3O9NA 1H1NA 1JXJA 7CGTA 3H53A 2EO7A 1QW9A 4GO8A 2WYSA 1ZBWA 1TUXA 1NOUA 2WC7A 4W5ZA 2YLAA 1HJWA 3L2LA 2D0HA 1IZKA 4ACYA 3FAWA 4J7RA 1SMAA 1EIBA 1US3A 4JL1A 1E9LA 4UQAA 2DSVA 2WWCA 4UOQA 1MFVA 3SUVA 2VRKA 3VX0A 1WP6A 4GXPA 3CMJA 3RM8A 1CXLA 3AZRA 4Z2LA 4JKLA 1XC6A 4W8LA 1UQZA 3OLEA 4QCEA 2J7EA 2J75A 4CCDA 3VGFA 4PMUA 1QBBA 2G4FA 3SUWA 1V08A 2XIIA 4JCLA 1CYGA 4DO4A 4JHZA 2XWEA 2EBNA 2V3DA 3GH7A 3WH9A 1NARA 2JEPA 2X2IA 2VX4A 1H0GA 1PZ3A 4TVUA 1KGWA 2DSZA 2VX7A 3KL3A 5M3WA 4HOXA 3GNOA 2FYVA 1GOKA 2UWFA 1C7TA 3PZTA 3ZR6A 1Q6DA 4CCCA 4H2CA 2CKRA 2E9MA 3WDJA 1ZU8A 1A3HA 2OYLA 2QF8A 3VD4A 5CGMA 2G3JA 4NZCA 2OWWA 1L0PA 1TFVA 1UHVA 3BAKA 5IFTA 2F8QA 3GDBA 1NWUA 2DIJA 1V3MA 1GORA 2DEPA 2XN2A 3NCOA 2V3GA 1IV8A 3AMCA 4PMDA 4PMZA 2BHZA 1JF5A 3IAQA 2EAEA 3CZSA 1HKIA 2E3ZA 3CUFA 2XSAA 1ZL1A 2YDSA 4OJYA 1KCLA 4HZ6A 1J0ZA 2ZUUA 4UQ9A 1WB0A 1TG7A 2BY0A 2D73A 3DX2A 3CUJA 3PZMA 5EFFA 5KEZA 2YOCA 2XHYA 3OLDA 2O9RA 3FN9A 3MMWA 2ZE0A 3I3BA 1MWOA 1U2YA 3LXAA 2ZUNA 2B31A 1QNSA 3CHDA 5CZKA 3MI6A 3AMDA 2EPKX 1JYWA 4ZE4A 2DT3A 4DUXA 5I79A 3LPFA 2A3HA 4FNRA 5EMYA 3BVVA 4Z2KA 3T0BA 2O9TA 4F8XA 5HXMA 2VZTA 1VJZA 4MADA 3ZR5A 1XCXA 1QI0A 2RGLA 1EA9C 3WBEA 3WUGA 1VFMA 2F7RA 3AMGA 1E0VA 4V28A 1ZJAA 1T0OA 3VPLA 3WSUA 5C70A 3D5HA 3A4WA 4UZSA 3VU2A 4UOZA 3VD7A 5M5DA 3T0DA 3AFBA 3W38A 3OG2A 2YL5A 1U33A 2F7PA 2VX6A 2CBJA 2XJ7A 5M03A 4MPKA 4FLOA 1W91A 3L4ZA 4P8XA 3VIOA 4WIWA 3WF2A 1UUQA 1EDGA 4QLKA 3BVXA 1C3FA 3I3DA 3VSUA 3AXIA 4QFUA 1UD8A 3BUQA 1OGBA 3WQVA 3LRMA 1GOMA 4GI6A 2NW0A 3POCA 5FD0A 4UQCA 3AIUA 3L2MA 3S5ZA 4AYGA 2CKSA 3CLWA 1V03A 4DM2A 4HU0A 1DWHM 3WQ6A 2ZICA 2VURA 4UOJA 2VCAA 2EJ1A 3I3EA 3WFLA 4D1IA 1EO7A 3SIMA 4KMQA 4LYPA 1OINA 6TAAA 2W66A 3W26A 4ZENA 3VTRA 3WUBA 5HNNA 3BMVA 1EOKA 3HN3A 2XN1A 3VIIA 3VILA 1H5VA 5CSUA 4CD6A 3IJ9A 3BH4A 4NSBA 2VT0A 3BCFA 1NQ6A 2Q8XA 3H54A 2D0FA 3PN8A 3BUPA 4P7LA 3RCNA 4X0NA 3CZJA 4ZEPA 4W88A 3BLBA 2EPMX 1E4NA 3ARQA 1X6NA 1V3JA 4IUGA 2VRQA 4OBSA 3BVUA 3SCUA 1UKSA 1XSJA 3MS8A 4D6CA 1R85A 2CHOA 5CLWA 2YIHA 1Q6CA 4D6IA 4IISA 4C7DA 2GDUA 4PTXA 3DC0A 3ZJ6A 3KLKA 1WKYA 4JKKA 4AW7A 4UNIA 1ITXA 4PSRA 1PX8A 3VOCA 3MV01 4W7UA 1CNVA 2X0HA 1BGAA 1VFOA 3WNMA 5E6ZA 4Z2HA 3WY4A 3NJ3A 3EJTA 1HX0A 1MW1A 3B9DA 4V2XA 3VNZA 4XZBA 1HF6A 3DX4A 4MNMA 4P7QA 5LA1A 1W3KA 4R27A 1BGGA 3W37A 5D9PA 5BWFA 2W5FA 3VDAA 1QHOA 3CZNA 1LG2A 1UR1A 2E9LA 2F61A 1E40A 1Z32X 3SURA 1EXPA 4AD0A 1BLIA 1UKQA 2Y4SA 3ARSA 1WPCA 1O6IA 3AHZA 1W1PA 2XFYA 4LGXA 3L4YA 1JDDA 3RJYA 3VMNA 1PIGA 1TZ7A 2XVGA 1CLVA 4LPCA 4J3XA 4DUVA 3E1F1 3VIJA 3POHA 3JUGA 5IHSA 3VIHA 2PB1A 2ZX7A 1BSIA 4J3UA 2V38A 2A3BA 1HJSA 1SFSA 1HL9A 2VO5A 3T2PA 2J8FA 5AY7A 1ZJBA 5DT7A 4EK7A 4RE2A 2YFOA 1AQMA 1E56A 4Q7NA 2PWEA 3IGUA 3HMCA 3TONA 1HP5A 1E6PA 2W62A 2VUYA 3L4VA 1OIMA 1MXGA 5HOSA 4OOUA 4JZ5A 1XCWA 2WM0A 2XM2A 2XWDA 5A3HA 5FOOA 3PTKA 4D6DA 1W9VA 4OZOA 3WMCA 3CZEA 1JF6A 4PMOA 3A22A 4W5UA 1UR2A 1LWHA 3EDEA 1DHKA 1TQSA 3NUKA 3WMBA 1R86A 4M81A 1E4LA 4AEEA 2QPUA 3VSTA 2D22A 3VIPA 4UQEA 4YHGA 3MSGA 3BUBA 2ZUSA 4FNQA 4TOQA 5JBFA 3S2CA 1E43A 3ARVA 3N12A 4URIA 4ATDA 3MUZ1 3B8SA 4CU6A 3GXNA 2WKLA 3A21A 1HVXA 1VB9A 1M7XA 1EHAA 2PWDA 3ARZA 1L8NA 1R7AA 1UQYA 3DX3A 1TQUA 1C7SA 3SCQA 2CBUA 1UD4A 3UR7A 1BQCA 1QHPA 5BROA 3TTSA 1HJUA 4Z2JA 1DEDA 1HJVA 1ECEA 1RH9A 3WF0A 4MDPA 2MANA 3QOKA 4N42A 4UR9A 1H4PA 1QI5A 2WZHA 4TXEA 3CHCA 1KTBA 3AMKA 1WZKA 4WF7A 4UQDA 1R87A 4WK9A 3AISA 3VIFA 4OKDA 3GYCA 1VENA 3WQ8A 2D1ZA 1WZLA 4ATWA 4MB5A 2G3IA 3W27A 5C8BB 5FIPA 5A6KA 4GZEA 3HG4A 5E0FA 3GNRA 1KXTA 3CUIA 3D4ZA 1Q6GA 1WDPA 3RPMA 3DYPA 4OOZA 1W32A 3M7SA 3N11A 3EJSA 4AD4A 3A3HA 1J0KA 3G6LA 4B3LA 4JFVA 3WNNA 4KRTA 4FK9A 1B0IA 1AQHA 1CGUA 1NOFA 3U57A 1UR8A 3K8KA
chains in the Genus database with same CATH superfamily
4E3TA 4ZAKC 2FX8L 2QSQA 2QT6A 3OXSB 2X6MA 1G7VA 8A3HA 2GC4C 5FA3A 4GKNB 1OAKH 5H94A 1BDYA 1ZHNB 3LSBA 1VFHA 1ZHBA 4X0VA 3O06A 2GG1A 3I6LE 3MWCA 3LQLA 2GGGA 3IKCA 4WIQA 2WJFA 4W9CC 3NQBA 3WD4A 5ADOL 1T89C 5FF3A 1G6RB 1MJUL 3U1PA 3F7YA 4IBYA 2NY7H 5AVRB 3CK0H 1E9QA 2XG9A 3B40A 1MLBA 3II3A 3MTRA 2AJZA 4YQXH 4NYLB 4AUJA 1MFBH 5C07E 4BFAA 4QOKB 3VXRA 1NIEA 1W5QA 5I19H 4PJGF 3LVTA 4LXFA 5EZIH 1JL8A 1JZFA 1IC5H 1JTPA 3NPVA 4BSWB 1TSHA 3LHYA 2DZUA 1TQBB 5HINA 4PHZA 4PJ7B 2BIIA 2GTZA 3EXLA 2KPWA 1ELSA 4Z0BL 4YTUA 4OFYD 3VMPA 3FEMA 1XMWA 1VD6A 4Q4MA 3PP3H 1KFWA 3BVJA 3F1QA 1MFAL 3B9AA 4GMEA 1K6WA 4R88A 4QDPA 2OR7A 3V95A 5EU7C 3ELFA 3GHBL 3R12A 3SRHA 1RSFA 2CCLA 3WD2A 1JNEA 1NICA 1H5BC 4JTFA 3H55A 3HFYA 2NNFA 5EF1A 1P6FA 5EF2A 3C87A 1NBYA 2PCXA 3G6JB 1WBZB 2JKTM 4DJDA 4FABH 4O11A 5DD5H 3W2KA 1FZJA 3LHPL 2Y7QB 3MLRH 2PF6A 2XFFA 4N2HA 1YY9D 4NEHB 1SDAB 3T42A 3X2QB 4NPJA 1QSFB 1UA6L 3TYGH 1A3RL 5D7IF 1RJYA 1RFDH 4P2QD 2DAVA 4Y1TA 3ZO0A 5C0AD 2BIPA 1N0XH 3D6GA 3GKWL 5EHFA 5EU6B 4FKHA 3IARA 2C8NA 5H37H 3TT3L 5G5DB 4MQ7A 4YIWA 3A4FA 1TPXC 2BSCA 1T0MB 3L68A 4DK3A 1P1ZA 3DESA 5BO1L 4QRPE 1TV8A 4IIHA 3EZJB 5CEXB 5DK2A 4W9KC 4ZX6A 4GCXA 5H35A 2B1OA 1RULL 3OQ8A 4LPWA 2FX9L 2JCCF 5SWQA 2DVXA 3NSXA 4TNGA 4AWSA 3VWJC 3WMPA 3VKAA 4ONHB 1P5UC 3PJUA 2V37A 4N26A 2J8GA 2VR3A 4P57B 5CJQL 3G5YA 4FS0A 3LV6A 3VXPA 3EFFB 5E5LA 4ZUWA 2ON3A 3R10A 3C6LD 1WYJA 4UFHA 1YY8B 2NNAB 4L48A 4RFOL 1NGZA 1LMIA 2NQLA 1RY0A 3SJVB 3BC9A 4G80A 3S34L 2E09A 2BGNE 3R8RA 5GSRB 3RPIA 5EUKB 4DW2L 3TXVA 1S3KH 4KT2A 2VEMA 1J8KA 2QPFA 1UCBL 3Q8CA 1HHIA 2CR6A 1GVSA 3T1GA 4YXHL 1HJXA 2O56A 1A1MA 1MW0A 3ZKMC 5DD1H 5DZLA 3P80A 1XINA 3WKNA 4I1PA 1EEYB 3GDKA 4I3RH 1H2JA 4W68A 4H7ZA 2DP3A 3B4YA 4GQZA 4ENLA 2R7EB 3WUFA 1ETJA 1O75A 3WS3A 1O7DE 1Q85A 2WV3A 3RG6A 4PWEA 3VK5A 3WD5H 4OD1L 1W1ZA 1VADB 3LN9A 1UT1A 4CADA 4RLDA 4KHXL 4U1KA 3FPYA 5MERB 3VZZA 1BZEA 4F79A 1W5MA 1SMDA 3VFMB 3OBKA 3UWEA 3MFFB 4FFWC 3EO9H 2DJXA 3EKGA 2NZLA 3VOGA 2EH7H 4FNLH 1KD0A 3QEQB 1VFTA 3DNKA 3EBAA 4BFKA 2ALAA 2HA1A 1FH7A 1HJCA 5EFDA 4LPYA 1ILSA 5HPMA 2AI0H 3RI5F 2HMIC 2EE6A 3WI9A 1U8QB 4XZNX 3L3DB 2FO4A 1OOWA 3W4RA 3QMRA 4D94A 5FW6A 3IIOA 2GTQA 3GU2A 3NEEA 4ADTA 3HZYA 4KI1A 4KF1A 1RVFH 2BVWA 1GQJA 1M01A 1PCWA 5C6TH 4WI3A 4C83B 4PFHA 4PWHA 4W9GC 3GTTA 5EUOE 3UMNA 2VL5A 2NQDA 2LW3A 4ERSH 3WJYA 4K68A 3ARGC 2FQDA 1GQKA 2N3JA 4AIZB 3MRMB 3KDPB 3UVIA 3IVSA 1W3JA 3D18B 5EEZA 4B5VA 1I3VA 5HGBB 4N8PA 2DSKA 2IOMA 4HAKA 1W3LA 2H9GB 3LPPA 2LOEA 3VXQA 2IBGA 1LE9A 1RUQL 5EIVA 1E6RA 1ET7A 1UOKA 1N6UA 4GA8A 2ALDA 3LXBA 2KKQA 1NWRA 3BURA 5E2JA 3P3BA 5CZTA 1FH2A 3IIZA 2PR9A 3WO4B 1ZHKA 2Z31B 1X98A 1TLKA 3MODL 4RH4A 4TPRL 1MCHA 1CXHA 5SWSA 4NHUA 4S0SD 3W1QA 5F7BA 4JRXA 4L4TA 4XVOA 4BI5A 1IU1A 2DMGA 1RL1A 5LVEA 2KERA 4Q8OA 4AXKA 4FXKA 1OTTD 3FQUA 3C61A 2YXVA 1TIMA 4HJ1A 2PWHA 2H41A 4AMKH 5LA0A 4Z7WA 4GZ7A 3DBXA 2W9MA 4KWVA 2MPAH 3DI1A 4NJAL 2B14A 5A2AA 1G9ML 3GDMA 1L3NA 3NDYE 4FC3E 5C0DB 1W8OA 1E9OB 5D1XE 1F41A 2VERN 3ZWSA 1BYOA 1BEUA 2VLKA 3QDMD 3LQGA 3QZMA 3QWOB 3FTZA 4LCWB 1NGXA 3ABXA 4P8VA 1XBRA 2XI9A 4L29B 4QJ3B 3TJEH 2C4FT 5I06A 1QNOA 1GL4B 3ETBF 4PGBB 1AMKA 1JUFB 4HU3A 4JM2C 3BEWA 1PVHA 4XPAH 4Y5VB 4GI4A 4E8CA 2YLKA 3E3QE 2WSKA 1SDDA 3GZPA 4PCSA 2IADB 4F8OA 3FS2A 4N2IA 4JFYB 4WKZB 2ESCA 3DMMC 1U41A 4YHZH 4M7ZC 3ASNB 1JHTB 4YHML 1PNCA 2Z25A 3H9SB 1AGCB 3BUYB 4GQRA 5JIPA 2YX0A 4OTKA 4GEJA 4M8UA 1AHWA 1UB5A 4I7ZC 4N8CL 1BVZA 3M7OA 1YEGH 1A49A 3HQNA 3RUBL 3Q5TA 1ZSDA 2P8LB 4P9ML 3OZOA 3NIDB 4ZXLA 5C08E 3PFMA 2RCSL 1LQBC 1T40A 3VIMA 5TE7H 3DPDA 1DE5A 1Y0EA 3WY1A 1H6UA 3N4EA 3NOYA 1U2HA 1IAIH 2TRSA 1C16B 4PYSA 4N1EA 3DUUB 3BRGC 2PC8A 1LLAA 1ZVNA 1MZRA 5C0FB 2F53E 3MC5A 1MEXH 5KVGH 5FHAL 3VB9A 5EU6D 2IPUG 3S2AA 3CS2A 3NCMA 1S9WB 5HHNA 2GITB 1IGYB 4PGCB 3NQMA 2FVKA 4PGDB 5HYJA 4NAJA 5MHSE 2QQKL 1CUOA 1WVZA 3L7RA 4MMZA 5LBGA 1KELL 2CLRB 4ZMNA 3LNFA 3GMNB 3BOVA 2CSPA 4PSPA 4LSDA 3ZN6A 4H1LB 2L3BA 1CFTB 4NNPL 4PJXF 4B5ZA 5DUML 5KVFE 1E0TA 2XG5A 4Q4EA 2F0CA 3S4TA 3WUWA 5HDQL 5LBVA 2NR6D 4KRZA 4B5UA 5GPRA 4JLRB 3GC4A 1EJWC 4HEMA 1D2OA 3V4VA 2OTDA 1NPNA 2P47B 1BYPA 1ZSXA 3WLJA 3TW7A 4TUKL 3FU5A 2BOGX 5G5IA 4KJWD 4PJ8A 1KC5L 3W22A 2UZXA 4AW4A 5E03A 1NCGA 1OF2A 5J6SA 2J6VA 1KRCC 1VERA 1TZZA 3UP1A 3GWQA 4K71B 3AT8A 1PZUB 4Y5XC 5HDBE 3BO8B 2UY4A 1V0MA 2B8OT 4YC2B 4P7NA 5CJBA 2F54B 2QV2A 3SECA 4C6JA 5LA2A 4C56E 4NGHH 1HXJA 3SUTA 1YN7B 4NO3B 2HCVA 1IGFH 4B9ZA 4LQFL 3SODB 4NO5B 4FLQA 3H3BC 4HPOL 1X1NA 4IXHA 1CK0L 1G7UA 1WFMA 3BW2A 1PTGA 2NY2D 4GK8A 2QCEA 2Z0IA 4PUBH 1AO7A 4FXGA 1T96A 3H9HA 4I85A 1V0KA 3AHXA 4MJIB 5BMFL 4DK6A 4M82A 3X3GL 2K1MA 3QF0A 1OZUA 3S96A 3D69A 4IJBA 4JIIX 4I9MA 4M6PA 1KLFB 3QEUB 3V8CA 1DJXA 3MHUA 1H11A 1DV7A 3T8LA 3LRHA 1G9NL 3PWAA 1DO6A 1NCAH 2VLJE 5AKRA 1KDJA 2Y72A 5LUMA 2V9RA 1Z9SB 4XXWC 3RZCB 3VXTA 4NKMA 3C09B 4DP8X 2X1IA 1VSCA 4YHIA 3WFEL 2MQ0A 4FQIL 1IGCH 1BTMA 3V55A 3QW9A 1F4WH 2XVNA 2YZ1A 4FPSA 4MWAB 3ARBB 2DVTA 1R5VB 2K3TA 3X1NA 2Z91A 1NU5A 2MNRA 4HFUH 5AUMB 1JCTA 1Q1JH 3OZKA 4FG4A 1MFEH 3U36A 4NU7A 1BD0A 3R8GA 2RD0A 1E9YB 1YYML 5DHXB 1YMYA 3VFNB 5KSVA 4Y90A 1YEEL 4DGYH 4W4OA 4FZEH 2WIMA 4W1TA 3BD4A 2IGFL 4Q6IC 1A1NA 2EYRA 4EI6A 3EB3A 3APGA 5FDWA 3MRRB 1PB0A 1MWAB 1J96A 1IYXA 1NIBA 4UTAL 4BFIB 1OD0A 3IGXA 3NSMA 1RZQA 3ZHKA 2ZUQB 2WWDA 5SWZB 2ZUWA 1QOKA 2V0TA 3QJXA 1NDZA 4HNTA 5CZSA 1YQ2A 2OK0L 1L2UA 5HHMB 3FPXA 4OLVL 3HB3D 4MAYD 1BAFH 3TJ4A 4HEPA 1D7CA 5I1LB 2XGZA 2WUBL 2R2HB 5E4OA 4MJ2A 3VOFA 4F3HA 2PLTA 4MJ4A 1CO1A 4R3SA 1XIWB 4OUUB 3ZKNC 3TMLA 1BGXL 3GI9L 5CCZA 3CWGA 3FY1A 3BH8B 4XG1A 3CFKB 4PTNA 4WSJA 1R3SA 5KWYC 3GE7A 4P5MA 3INUL 5HYSA 1JFHA 4LLDB 3L3JA 4EACA 5H37A 1KV7A 1U6AH 1WGOA 2HT2C 4RISL 1NIAA 2ADGA 2EIZB 2H90A 1RVKA 2FBJH 5JNYB 4GUCA 1ZTXL 4K8RD 1CMOA 3S3GA 2IQAA 1I9EA 4B16A 4JFXA 2OJZH 4FX7A 5J1TC 2ISVA 2BVEA 4F8PA 4GOAA 2YXFA 1FHNA 4MJ5B 2E1DA 1FZKA 1EZVX 1JV2A 4YGVB 3QG7H 3WHE1 4X7SH 1PLBA 5CN2A 3P61A 4M3PA 3UBHA 2W0KA 2LU3A 2PRLA 2ICWA 1IFRA 3QFDB 2EKJA 3K4WA 4Z2LA 5EEUA 4NJKA 1XL9A 4QRRE 4W9TA 1H7XA 4GUOA 5DURD 2WNZA 1LJMA 3F6LA 3TWYA 1NF7A 1QPNA 1A7OH 5CZXC 2YUVA 3HE6A 1AH1A 3FXIC 4H20H 3P93A 5TGBB 1N8IA 3PWIA 3QIWC 1KJ2H 3GC3A 1CDCA 3GIVB 1Z9MA 5C0IA 1XGRB 1JNNL 1XBYA 4KX9A 2AEPH 5EEWA 3WDJA 2FQGA 4ZMLA 4RGNB 4UILH 2BC4B 2WAHA 3PF3A 1XLJA 3ILPA 1BQSA 4G8GE 5IHUL 3VI3A 1M71A 2ED8A 2BNQA 2E3ZA 4N5EC 4MOZA 1FLRL 4ZMVA 3OF6A 1F73A 4YFEA 2EVJA 4Y1AA 4Q8WA 4IW4C 2FTPA 3OOQA 4DUXA 1P2CB 4G1MB 5L2KE 4KV5F 4UUJB 5EEVA 4YR6A 1JHKH 3L54A 1BMZA 1X97A 1V8EA 2HROA 1YPZE 4LARL 4QGYA 2DMBA 2NUTA 1W0VA 3X1FA 1ZJAA 3T0DA 3W38A 2AJ3A 4PREB 3MJ7B 3SZ6A 2XJ7A 3Q2VA 1IC7H 3QQNA 3GKFA 4Y4FB 3RLUA 1LP9B 4WI8A 5I8OL 4D8AA 2F7IA 3P77A 5HI5D 5F7EH 2DIKA 1GOMA 4GI6A 2QULA 2W59A 3WNJA 3CE1A 4HU0A 2Y5JA 4JBSA 4HISA 2VDQL 3I3EA 1FUYA 2CO4A 1OINA 3W26A 4BK5C 2IH9A 5IV2A 1UIPA 1MJJB 1DE6A 3BGJA 5FV1L 4AEOA 2ZFAA 2OTUB 3WFBH 1U0QA 1CICD 4OZFH 2CKNA 1J5IA 1FV1A 2E6PA 3TN6A 1DBMH 3EJYD 1UC5A 2ATMA 4MNGB 4YNYB 3B34A 3QR2A 5D71L 4Y2DC 1OC7A 4DF9A 4CNIB 1ZPLA 5HHOA 5I09A 2H6UA 2Z93B 2IXQA 3NVTA 2QCDB 4P2AA 2D2JA 3F05A 1RUPH 4LNYA 2I9EA 3T9PA 1IGWA 1O7VA 1I9RL 1O4UA 3QXUA 5ISZD 2MOQA 4D0CA 2WXKA 1I3RA 3NG5A 3VDAA 2OB3A 2C0AA 2QPDB 3LQAH 4NWTH 2EE9A 4AE1A 1F58H 4DNHA 1I0DA 2ARJB 3P84A 1JDEA 3CPRA 2ZSWA 5ITBH 2EVGA 2X4QA 4PC8A 3LKNA 1JCXA 3LMZA 1JF1B 3ZZ1A 3PPCA 5I5JA 1FYTE 4N0FA 1WIUA 5IBUB 4Q7NA 3ISYA 5JHDB 4AQAA 4I90A 4BUHA 1U5JA 1Q8JA 3WTVA 4TQHA 4CC1A 3RA7L 5EU7E 5CMAA 3CZEA 3RNQA 1DVXA 2DQTH 1EVTC 5IEHA 3V0AC 3SE4C 3UGUA 4MWAD 2F8XC 3K2GA 4XP9L 3LNEA 2Z35A 3EXTA 4NT0A 4ESKA 1QR1B 4KRPD 1RIUL 2V68A 1BLNA 2AXGA 3MUZ1 2J2ZA 1H8SA 3F8UB 4EMZA 1ZRUA 4ELMB 3QQ1A 4EDXB 1ML1A 1VB9A 4YCPA 2YS4A 2FZMA 3UP8A 4M6ML 1NFPA 4P3WA 3T8XA 2QZQA 3V5KA 4FTVA 2EIBA 1S7UA 3UTSD 2IFGA 1H4PA 1QYGH 2GEQA 1KTBA 4EBQH 4F8QA 4UQDA 4JG1H 4WK4B 4B91A 3MMEB 1W16A 2FB3A 2FD6H 4LSPL 4C6BA 1TTPA 4AYID 5EOCL 5SWZD 1I53A 3WNNA 3KJ4C 1GSKA 3UF9A 3O4OB 2VQ1A 2ZYIA 3DJZA 3ATAA 4PUUA 3VI4B 2WQRA 4O0KA 1NWOA 1D8CA 3J7HA 1RZMA 1OK0A 1SY6L 1T3FB 2MCAA 1VFFA 3UJJL 3VKBA 4XCYA 1Y0LA 1F0LA 4KROB 5LXEA 3X3FH 1H6FA 1DFBH 1U5VA 1ISXA 3P3RA 2OCJA 3T0ED 2CO1A 2ATPB 4TVPH 1KM5A 4RMTA 4PJ9C 1EEZA 4E5TA 2ITEA 4AITA 1BOGA 3WLRA 1OX4A 4E8DA 3RPTA 1H3UA 4C7GA 1JP5A 2VC9A 4BQ3A 5TDOA 2EUWA 2NDFA 2CA3A 3USBA 2EEAA 3BUIA 2YHGA 1K9EA 1U93B 1CFQA 3P60A 3CIXA 4JFSA 3WQOA 1RZIB 4TMCA 1E7VA 3MLZL 5HVHC 1KFEA 3GJFB 4Z78A 5JLZB 2X6UA 3RX7A 1KLUB 3HPAA 1LNUA 4ZQTA 2AEWA 2VXQH 5CQ1A 1IT9H 5C9XA 1K9DA 3NL6A 4D6GA 4W81A 2IAAC 5FEXA 3TZVA 4NQVB 4DWSB 2R2BB 3T4AB 3FX4A 4HIQA 1TQJA 3VIKA 3VNJA 4P5KB 2DKUA 4IJ3C 3RUGF 1TTCA 4MKMA 5U7SA 4P5TA 5EGRA 4ADGA 4JHVA 4BQBA 3T5WA 1NFAA 5DFVC 2VEKA 1T4KB 1GOGA 1UWSA 2WSYA 2OMWB 5DR5H 5BZXA 1T22A 1E0UA 1USZA 3NSCA 1JCJA 3REWA 3T55A 4GO6B 5AHIA 3PDDA 5DJZA 1FDLL 3OKMB 1W8NA 4L1BA 5DJ0B 4L1HA 3BP5A 4MNQB 1XB3A 4PG2A 2KAUC 4ODTH 4G8AC 3D34A 1NQKA 3AOFA 5CLTA 1QNZH 1W1TA 3VTTA 4WXZA 3QEHA 3CNYA 4PR5A 4RZ5A 1GTNA 5GGUA 3PGCB 1UMLA 1Z0NA 3GLCA 4JO2H 2HRHA 3RWHA 4FFYL 3QPXL 3EBIA 3GSVB 4XBPA 2FEDC 4KKLD 2NSMA 4NFCA 3AXLA 5GIRA 3GFUA 1WBHA 3H56A 4HH9B 2WY3B 4XP4L 3NZ1A 3H4HA 4Z08A 1CPUA 3W39A 4OGXH 5D55A 3C86A 3DSFL 4HK3J 1QUMA 1NCCL 1J18A 4HA1A 1DWFM 2EKSB 1K8IB 1ME8A 5FW8A 1XR8A 4JB9L 1KCBA 3H8AA 2WK2A 1DVFC 3HG1B 5A2JH 3LZFL 3HNVH 2QR6A 3ES8A 4F1ZA 5DZVA 2OOFA 3LCYA 1F8IA 4OFPA 2FJGA 1YCSA 3RTQB 4XBMA 3C5SA 1PDZA 5CCKH 4F2BA 1CQKA 1LDCA 1FAIL 5G4WA 4JJ5A 2IAMB 2VDOL 4FI4A 2BLEA 3NDOA 1A2YA 3NNTA 4POZC 3ABLB 4N22A 2VLMD 1XRSA 3CQ0A 2E4TA 1CJYA 1NCBH 3PB0A 1TV2A 3DRQB 5FECB 1AP2B 3CFDB 1NMCC 5KVDH 2YL6A 3V18A 5CBAB 1MAJA 3FSTA 2CZ5A 1E0WA 3T0TA 4KNUA 4GKLA 5J6GA 5I30L 3MJYA 4G6FB 4C47A 3SCSA 1WE5A 1L0YA 3FQNB 4NQEA 2JJTA 2H8ZA 4LT9A 1E9PA 3AU1A 4GIYA 3O6LL 2NXHA 1LRQA 5AC4A 3LD8B 1QOPA 1SBBA 2BHUA 1BYDA 2FVNA 3RGVC 3ULAB 1LUCA 1R9ZA 3V7AG 3XISA 1QLFA 9RUBA 2YCKX 4HJJH 4GYJA 3P0VH 5F7WC 3U6XA 4NQSB 3D2TA 1JCLA 1YAIA 3Q3GA 1NAKL 2Q3ZA 3QCUH 1JS4A 2HJFA 2QJDA 3K8LA 3BSMA 2CUMA 1ITUA 4GUPA 5DQDH 4DPQA 3II2A 1PWMA 3L7EB 4GVHA 4XP6H 4IIEA 4LF2A 4D0BA 4TL5A 1RZGB 4ZBCA 4P2OD 4BZ1L 5CUSH 3MGOB 3CIQA 5FYJL 5SX4H 1K70A 5KOVC 3M0IA 4X7TB 1Y6MR 1JGUL 3QUYC 4NPKA 1E15A 3GTFA 4YNGA 2FYYB 1XB8A 3VXUB 4UBDD 3P4OB 3OKDB 3B2UD 4UM9A 5CGTA 3OP2A 1U91A 1FNFA 1R3QA 3IU3A 3H70A 2H6PA 5LNDA 1VIWA 1OY3B 1FKXA 3WELA 1XLMA 1MQPA 1EXGA 3MLXH 1OFQA 3NIGB 1E6OH 4KNTA 3BZJA 5HMFA 4N25A 3O6KH 2BWGA 5F6IB 4XZIA 4PB0L 4YFLF 4HA0A 5HD8D 5BYWA 3L3KA 2VNCA 2CETA 2OZ3A 5FO9A 1D5BB 4RZKA 3ZSTA 4HWZA 1DWAM 4LLUB 4YO0B 12E8H 4GYPA 3DGRA 3BVDB 2EVHA 4HSOA 4PRIE 4CSTA 3CUHA 4Z7UE 4AQ8C 1JD7A 2EGZA 2HPMA 1C5BL 3PNWB 2E25A 2WLJA 3UL4A 4U3AA 3SYPA 15C8L 1KJ2A 4MX7B 2MFNA 4HUVA 1REIA 4NJ9H 3CH9A 4XX6A 1BFNA 4N0YH 4GRLA 2P4AB 1AYOA 2F5AH 5I15H 2FQEA 4ZS7H 3HPLB 3F4WA 1UZ1A 4LP5A 3QZ6A 4TNWK 4DYEA 2VJXA 1WOBA 3DXIA 1EFZA 2R4SH 4KVCL 1DKWA 4Q4KA 1T80A 3KLAA 4XX1E 2OP4H 1KTRL 3QWQB 4NM4L 3BQ5A 1L9PA 3MCNA 1QWHA 1H3TA 3UDWA 2VDRH 1W9XA 3QORA 1UWUA 2PTVA 1VIZA 2AQQA 1Q9WA 2ZOUA 3KAAA 4RE4A 3HW7A 2EH8L 3IMUA 4JIHA 3H8NA 5AHFA 2PBGA 4QCFA 3CNKA 3URNA 4DEWA 1TUFA 4K2UL 4RQQB 3S3JA 1PVNA 4GUHA 2FDBP 1E3FA 3ML8A 4OZHF 1J7VR 3TV3L 5AWNH 1A47A 4XOAA 2NX5D 1TZIB 4AK2A 3VOHA 4FZ8H 1ICPA 5HY9B 4U1JB 1S7SB 3VXMB 2CNYA 1FRGL 3AXXA 2OZ4H 1NC4A 2EILB 4OZFA 4QTHA 3T3MB 3LZRA 1RSYA 1HINH 4AVJA 2WJEA 3KZSA 1EHXA 5IHZA 1J10A 2Z7UA 4OFDA 5BRZB 5IROA 4J2XA 3PQYD 2NXIA 3SN1A 4G6CA 2VO8A 5HHVH 2P26A 3JTTB 4UU9A 1FPTL 4ZTPL 4OGZA 1NZRA 1LD9B 2BP0A 3LI1A 3SN4A 4X9SA 3SKMA 3OZLA 2YD7A 3IUDA 3DIDA 4YYFA 3MNZA 1XF2A 1ZWIA 2VM8A 3UACA 2NOYA 4AWTA 4ZPVB 2YR1A 3B9OA 1NA8A 1WO2A 2QVMA 3O9WD 1XG3A 2BERA 1OGAE 1W9BM 3C0QA 1T1YB 1PSCA 4D9LL 1YEHH 3MV7E 4LQ1A 1J9YA 1EZ2A 2OPCA 3IVKB 1QWGA 3ZDXF 4ZQRA 3GSNL 3ZOAA 1AGEA 1AHMA 4OCRL 2J66A 3J07A 4JRWA 4H4IA 4HWEL 2DQJH 3OIXA 4KTDL 4EZLA 1PSKH 1ZY9A 4S3KA 1T03L 4DYJA 3AY2A 4NT6A 1RZ8B 5JXEA 3LNIA 1ZP3A 4NQXB 1GYCA 4R53A 4O1DA 4K7VA 3PHQA 4PB5A 3OB0H 3SDYL 1FWGC 2BRRL 4JO8A 3NGJA 4LP4A 1QA9A 1PY0A 3L0KA 5D9NA 4NNXA 3UPRA 2PP0A 2NUPA 1DVUA 5I75B 2EVFA 5GGRY 2PTWA 3AJ7A 2P8PB 3PZVA 3WQCA 3D25A 1OX5A 4YX2H 1EGZA 2VXSH 4DVOA 4Y4KD 5KS9E 3VD2A 2MTAA 5DMGD 1PX4A 1U42A 4S0HA 1KKRA 2B9AA 4P2RA 4JFED 2KUTA 4Z77A 4RAVA 1HKLH 5BU9A 1SO3A 4HIEB 1IC0A 2OVLA 3AU2A 2YBGA 4JRYE 4G6FD 4AIUA 1TJ1A 2QL1A 1WT5C 1MUCA 4A4AA 4O54A 1NJ9B 2Y62A 4Q7IA 4KXDA 3K5RA 4D6EA 2ZZ5A 5D96C 1VYRA 4PL2A 3S1WA 4ZTOL 5JPNA 4J40A 1AKJA 3MLTB 5LDSA 4QRAA 2MOGA 3OQEA 4L3CA 3UCRA 4QIUA 3ECVA 4H5SA 5LGHH 2PPFA 2IG2L 1XLCA 5BCAA 2ADIA 1KBLA 4NXKA 1JNDA 3C5ZB 5TQ2H 2X4RA 1YNKL 4NSKA 4JY6B 3N55A 3OU8A 2CLVA 1IKFH 5HYFA 5E9DA 2VFDA 1UWGH 5AC8A 2GJXB 3P4LA 4KUCF 1PFOA 1IARB 3ECBB 4BHUA 4WSHA 3RX9A 3MJMA 1GVOA 3EDJA 1D5IH 1DZ0A 2E46A 3EAKA 3ETBJ 3STZA 1S7WB 4UTMA 4V1DE 1C93A 3I85A 3BP7A 1HOCB 3KXFE 4RXFA 4BF9A 2BOBB 4PB4A 1OAXL 4I88A 5CD5C 3T07A 5HI4C 4XXDB 4GVGA 4YCOA 1M65A 4PJAF 1FNSH 3WBDA 2VXQA 3MU3A 4W9EC 2GUYA 3BZEB 2UX6A 1E65A 4NAEA 4NC2B 5CS7A 1ZB5A 1QTWA 3D3AA 2QJNA 4LRNL 2VFEA 4MZ3A 1XAKA 5IHBA 2ACRA 2C3VB 4I9WD 1EUTA 3PV7A 2HLFC 1EDQA 3KTSA 3MRKB 1AD0A 2GYIA 4ZTYA 3TVMB 2DWTA 5EF3A 1T2XA 2XTKA 5MEOB 4WHTA 1CLCA 3LPOA 5AZ2H 4J8RB 2FJHA 1E7UA 1AFVH 3RVWD 5GJTH 3TROA 3CMOL 5T9BG 4X2RA 1H49A 1RERA 4BYHA 1VYPX 2VDQB 3HFML 4EPSA 3VIGA 1AG1O 1PL9A 1O94A 2WWMD 1LEKA 4JUSA 3ZKQD 2R14A 2VFFA 3EWXA 2EYTB 2ZZUT 4QTFA 2BJML 4RESB 3HBPA 3MV11 2E5CA 3WDHA 5KYUA 4Y5YA 2DJ4A 3SKOB 3TW9A 3S97C 1AMXA 2NY0D 1DHPA 1KPVB 2UZYB 1ZLEA 5HI3D 1R46A 1G4PA 2FMOA 4WTWA 3MBWA 2NZ9C 2VGLM 2B1AH 4L6HA 4NZ8A 3KWWB 3PF2A 4GQGA 4PIRF 3GKAA 2WTRB 1QK2A 1CG9B 1DVSA 8FABA 2A9NL 4ICCX 1I3GL 4HOWA 4O5LH 3VFLA 3GM8A 3QH3A 3KS5A 2AJVH 4JGUA 5KSBE 1KIRA 4GBXA 3BZDA 2X1SA 4PJIA 1KTKE 2K9UA 2IALB 4PB9H 1SJHA 1YNPA 4LVDA 3UAEA 4P4KA 2P49B 2WWCA 4DN3H 4AGQA 1KYOK 5FYLL 2H8XA 1CFMA 5T1MA 1T6WA 1O6SB 1RQBA 4MJ6B 3X14A 3IUIA 4OUIA 4OI8A 1TYGA 2WIIA 3CFUA 2A7RA 4LUIA 1T6MA 3KBFA 3QO1A 2COQA 5B4MD 4GKZA 1PZ3A 3AXMA 1SHXA 1KSRA 3MCMA 3G0UA 4X4XA 5AOKA 3LAFA 5DI8A 3ZR6A 1UJPA 2BIQA 4D8PB 3EFDL 2PDHA 2OYLA 3BLOA 1TTBA 5ITFA 1WBJA 4GFXA 1TFVA 5IFTA 2IDFA 5BZWA 1NBZA 3UBGA 4X9IA 2XN2A 4R26H 3QIUD 3RX5A 1MAMH 1T20B 3MBFA 3PJSA 1ZA3A 1NFGA 3TKFA 1WB0A 3FYEB 1UB3A 4JZJC 3LS5H 3MMWA 4JY9A 4LPTA 1AGBA 1XF3B 3KNBA 5TBOA 3BHBB 3B03A 3V4PL 4PWFA 1BWKA 5DY3A 4YH6A 4FQCH 5I03A 1VJZA 1HESA 5I1HL 3DX9B 4OKVA 4O19A 3ALWA 4PJ5B 2AS5M 4HHGA 3B5GA 1LCOA 2IKGA 1HHJB 2FECL 2VX6A 3REQB 3QPQD 3FULA 3VIOA 4KK9C 3VG9B 3CVIL 1XUZA 3LKSB 4NS0A 3GIQA 5FD0A 4O28A 5ICUA 1DVYA 4JFFA 1KDIA 3RVVC 4JFOB 3U7WL 2ZOKB 2V9UA 3CLWA 4DM2A 2W65B 4K8EA 1LO4H 4KDTC 4YHNB 4U1SB 4AG4L 2X4NB 3P14A 4JJOA 2E75C 3GKZA 3NO5A 3SPJA 3MZTA 2DQCL 5AHEA 3KPLB 3MRCA 2EPMX 1SDYA 4IUGA 4MLRA 4NZDA 2I60L 1SVZA 4UQ3B 3MOBL 3ZJ6A 3O6FD 5D1QC 4MFHA 4JKKA 4ORZC 2AMXA 3IDYC 3P4NA 5K1VA 5JO5B 4YDZA 4LASH 3X12B 3L3IA 3PDOB 1U92A 3PJWA 1XF5A 2M8XA 1RR2A 3TNNA 1XR2A 4OSUH 3T3PE 2C3GA 4WUIA 4XHJC 4U3HA 4P7QA 4WO4C 4JFPB 3L13A 4S1SH 3ABRA 2JLPA 1CL7H 5IJVB 5AYUL 5JQ6H 4I7WA 4BZ2L 3MRBB 1KGCE 4RAUB 3R4RA 1ZGLM 5D6DC 5FWQA 5K9DA 5FO2A 3RJYA 5F6HI 3VMNA 3W86A 5EUOA 3SDOA 2BMBA 2O6EA 4DUVA 1EFXD 3C5ZD 1SFSA 4NQCB 3ULUL 1ZJBA 4JQVC 1Z3GL 1GS6X 1NOAA 1AQMA 5K33A 4AM0Q 3DOIA 1UUNA 2YD6A 3HMCA 4YK4C 1YDVA 1ES0B 3NJIA 4LL4A 4C6PA 2XWXA 2QSVA 3U4EA 3ULVF 3ENLA 2D03L 4MYPA 2POTA 3UQNA 1S2VA 3APDA 3MDWA 3W83A 3BI9X 1LWHA 3GS0A 4K23L 2E1WA 3L6FB 3W5NA 4DFHA 3GDLA 3WMBA 4X2UA 1DPMA 5EL1A 4QYAA 5HUOA 4APQD 3KOZA 1N8WA 1AZVA 4PD4K 3CQFA 5D2NA 1BFSA 2F15A 3LHTA 4Y4HD 4JFQA 2PYFA 3H85A 2YPIA 3LRSA 1OP3H 1WA3A 2CBUA 2EDDA 5EU5B 5KJ4A 3TTSA 3O3EB 4Q9CA 1TCRA 4TIMA 1W17A 3DEQA 4QT5B 3EXSA 4H0LC 5JMRA 2YAMA 3MVSA 3QWNA 1NGYB 1R0AH 1R87A 3LLXA 1UT2A 4WK9A 3VYLA 3L2NA 4QHPA 5AL8A 1VENA 4R97B 1WZLA 2ESVD 3GRWH 3ME3A 3C60A 2IMMA 4OOZA 4I6KA 1WEJL 1UJ3B 3W1UA 4FK9A 1UR8A 3K8KA 3MHFA 2VOTA 4ZXBD 5GRUH 2KQNA 2PXYC 4ZRGA 2OZ4A 4N7QA 4EXQA 1OE2A 2X05A 5I1IH 1Z69A 3TO2A 4R2GB 3GBDA 4QTIL 5CINL 3RJXA 5GNXA 2VVNA 1UADC 3H2QA 4QIRA 3EYSL 5GGVL 5FGBA 3BH9A 3IMTA 2ZUVA 4GG6F 5DZOA 3BWSA 5J9PB 2VDOB 4XNQA 4KRUA 3FFOA 4U1LB 3S5YA 3E38A 1AGDB 3UYOD 4PBXA 4KPHH 3FRPG 2JVUA 2IQ0A 1F3RB 1KRAC 4ZFOA 3NPZB 3L9YA 1L9QA 3L3HB 4Q8TA 3VXSB 4W7VA 5ABGA 2GY7B 2AJUH 2WVSA 2YUXA 3PG8A 4PTDA 3ZKSD 4LEOB 1GGTA 4WUUB 1NELA 5DO8A 4QOKD 3CBRA 1IQ8A 4MA7H 2W80C 1GOOA 4FJ6A 1NDGB 3KRZA 3WGUB 2CW6A 4KJQC 1WBYA 3U0PA 5GJNA 2OMBA 4D3CL 2REQB 4XZHA 5C3LD 1KGUA 5EA0H 4OIFA 4HPGA 5E7FA 4Q8VA 1IXOA 3UO1L 4ONFH 3SZKC 2FRGP 4C1LA 4ZODA 3DVGB 4AEIH 5AB3A 1VS1A 5D6CA 1TDQA 2K4AA 1TCDA 4L8BA 3TJHC 4BXVA 1L6FA 4LCCB 4LAQL 3VWKC 4QF1B 3K0YA 5ILTH 1OG6A 3HZMA 1FL5A 5T9CE 2XN0A 2YYTA 5DCDA 2F53A 3UZQA 3QCVH 3NJJA 3MB9A 2Q8BH 5B1AB 4BWLA 4WTZG 2AJSL 3CBWA 1NM4A 4HAGA 4JG5A 1QO3A 1SN2A 1ZT7B 3UG3A 4HHWA 3QI9B 3UEZA 4L9LB 4GG8B 4QHUB 3MDUA 1QSFD 4BZYA 2BSRB 3BDYL 1V6UA 2YD5A 5EBAA 3S88L 4PJHF 3E9TA 5CSZA 5D4HA 4AUUA 2XZ7A 2J71A 3OB8A 5A69A 3I4EA 5D04C 3AU6A 4JMXA 2DT2A 1IGJB 5MKGA 1GS7A 5EZLB 1P5VB 3OZYA 4NQUA 3PXLA 3WN5C 3DPBB 4OGQC 4JO1H 4R5EA 4BR1A 3TBYA 1JPFB 1A7QH 3UCQA 4OCYH 4HS3A 4XMWA 2D7PA 2NY6C 3ULSA 4MVBD 2CBQA 1H19A 3NPSB 3QRLA 4MZ2A 3OQ3B 5LQBL 2FZ8A 3W1NA 1M04A 1H8LA 3QP3A 2LU7A 1XBVA 4N4PA 5AOMA 1ZLVH 1BEYH 3ISIX 1B0RA 1KB5L 4AQ1A 3QRBA 4F27A 3UWZA 5BXFB 4XUGA 3AT9A 3MUAA 2AEOA 4ZFFA 5FSEC 4KZEL 1N10A 3KOYA 3RWGA 3SJVD 2LFGA 3ZVVA 1NC2B 2PZNA 4JANA 1T2QL 1U8IA 4XBGB 2IQDA 4ODHL 4PVNA 5LHDA 4WDIA 4RCAA 3GW0A 3ZGHA 4JHWL 5KN5A 3MACH 3AUWB 4AJWA 4NP4H 4A3YA 3GSUB 2I5YL 4L5FL 2D31A 3VDGA 3WEXA 3WQ4A 1TZGL 1R34A 2VHLA 1P4CA 2DB8A 4Y19B 2GJ6B 5BQDA 4U1MB 3NT0A 4Z2IA 1RPQA 1UZHA 1J9TA 3N1MC 4GQ9L 3GZAA 5CBBA 1Q0YL 5C0BB 1BYBA 2EUXA 3ZDYB 4PW9A 4LNVA 1WD8A 4M5ZL 1HVQA 1FWRA 1B3YA 4HHMA 5DMNA 1GC1C 5EO9B 1KXVC 3DURA 5DQJB 1OK8A 3WJZA 3N41F 1B1YA 5K9JH 3ITTA 3QEQD 4N1CA 1EHLH 1SM3L 3T05A 1SMOA 2R1XB 5FYKE 2AGJH 5DFWH 4E9SA 1GYNA 4WW2A 1N8OE 3FW6A 5GZOA 4GXVH 5DLMH 2YMTA 2QVFB 4RGOL 4NO2A 2PW1B 3VGDA 3CL6A 3COTA 4LPVA 3RP1A 4QCIB 4AYEC 2VERA 1XLIA 4WUKH 1OC5A 1XRVA 1XQLA 1OAQL 3OEXA 1ISZA 5FI8A 2ZE3A 1SSGA 1RU9L 4HWUA 2ZVRA 2H2SD 2HKFL 2Z92A 1Q0XL 1KCVH 1R33A 2BW4A 4GT7A 3PBYA 3E2VA 4DN4H 2IBBA 1K7FA 3MNDA 4PJBB 2CU9A 4GINA 4ICWA 5FEBA 3T8MA 1EUUA 3FFDA 1TTAA 2DRUA 4DUWA 1WA0X 5ACZB 3HN8A 4XBEH 3GPEA 3N44B 4HBCL 3NVDA 1L0XA 1ORSA 4NPYB 4FQJL 2VH5H 3L5AA 2C3HA 1QW8A 3RN6A 2QFRA 4AX3A 1BMGA 4UWQB 3DROB 1A5UA 1LRNA 3GSNB 4ADUA 5FUZH 2XQYG 4EI5C 1KN4H 2BX5A 1KGXA 4RFNC 2UZIH 5T33L 3FT3B 3ARPA 1EO8H 1WZAA 3AS3A 3U46A 3DRTB 4YMZA 1OF6A 2Z31D 2L7EA 1U21A 3KDOA 1VACA 4X50A 4CVZB 1MFMA 1P7QA 1WSST 3EJZD 4Q14A 3F7VB 5HDOA 5FUCC 1W2VA 1FWCC 4MASA 2CDGB 4J12A 4OFVA 1YLBB 1GG0A 4EUPB 1JPGB 1GVIA 2PPGA 1G7QA 1S7XA 5JIKA 4MXVF 2ENQA 2JKLA 1QW7A 2GB2A 3IDNB 1IFHL 2Z0UA 1MQ8A 2X12A 4QLWA 3B3BA 3RAOA 4ICMA 1HUVA 5MEPA 1UYQA 4MD5B 2WWKT 3AIRA 1UBPC 1S8DA 5DBTA 2NW3B 3W6MA 5I1DB 5EOQL 1MYRA 4AQEA 3CSGA 1J1XL 5HNRA 4LCWD 2BSSB 2GIXA 2WMJA 1OHZA 5CJ5A 1K4DA 5B38G 3AG2B 4MLJA 2BS71 1GW1A 2HFFA 3R1ZA 1KQYA 3IPEA 4HIJB 2FIKB 1RJCA 2ZCLL 4QRRA 4FYTA 4ACTA 3BFQG 3CCHB 4DBEA 4D72A 4RFEA 1E6XM 3TNMB 5A2IH 1ACYH 4Q2ZA 4DQWA 1B4RA 1HZKA 4J1OA 2HWGA 2Z7KA 4Q9RL 4HD5A 4XP5L 4D9PA 2B77A 3FH7A 3RFRA 3RB7A 1XC4A 1X38A 4XNAA 4X99A 1BKSA 3H9SD 1QBLH 3AZTA 1A9EA 1DQKA 5T3ZL 2C6QA 3QT2A 3VFUA 3J8F7 5FYKU 1PYWA 3ZSSA 1P6BA 4L4VB 5IHRA 1Q6EA 3UY7A 4CVXB 1HSAB 3K71A 1V7MH 3N2MA 4PRDB 3TBSB 5IB3B 1TO5A 2Q7YA 4OZIF 1FN4B 4ODVL 5T1KB 5I0WA 4WKFA 4QUOA 3D87B 3C5XA 4X5XB 3UAJC 5L2KA 3V0VB 3NP3A 4JFUA 5A6IA 4YAQA 1Q9KA 1KTCA 1I1FB 3CZKA 4RIRB 3BSGA 1CFSA 4ORGA 4Z7OF 5CBJA 3D52A 4D7BA 1T7ZA 2HTLC 1KFAL 3BUVA 2RALA 1I7TB 3MV8B 4JFDB 3ITGA 3LNDA 1MN4A 4AZIA 4AOFA 4OV4A 1N2RA 4Q8BA 3PSVA 4AD5A 1YPIA 1DQLH 2NXYB 3GWJA 1BJ1H 4ZMYA 4ZQPA 3DX1A 1J0HA 3CAWA 2DGAA 3WZ0E 1DWJM 1KXQE 2MNJB 3UTTB 3EWDA 2A3LA 4WK2B 2QQLH 3E0VA 2DVUA 4K94L 5FHBH 3ZIZA 4B9GA 5F9JB 4XMUA 3QSKB 2EINB 2FDMA 3CLEL 3MMUA 4JXCA 4QXUH 3CIVA 4F37F 2G4GA 5FCUL 2X1QA 5IBTH 3KH4A 2GCYB 2DLGA 4L7ZA 1FHLA 3MJWA 3WKZA 4X80L 5DRZA 4B9KC 1Z1WA 4EAEA 3DX8A 5IKCA 2D7OA 1OFBA 4N6EA 4O51A 4AF0B 4OJCA 4N20A 1KTLA 1PPIA 5AW1B 5AZEL 2VN3A 4XZUB 1RIVH 4K3ZA 1OW0C 3HC2A 2O4MA 3RL2A 5E00B 2YMXL 1M05B 2F7FA 2YD1A 5EZPA 5HNUA 1H7OA 3K2KA 3VINA 3RAJL 1UZ8B 1EGMA 1WA1X 4OLEA 3A67L 3O0RH 4PLNC 4KQ4H 2R1YA 3GHEL 2CDFA 2F54D 3GU9A 3PHOA 4W86A 3NQEA 4PGEA 4I7VA 4Y19D 4KH9A 1N68A 3P4MB 3ISRA 1AKPA 2C9XA 3TIDB 1EAPA 3M8OH 4K7FB 5AEAA 5IVXF 1E0XA 2JF6A 4LZKA 4G5ZH 2TPSA 4BH8A 3GRWA 4OU1A 1KTDA 4R6UA 4JDVB 5A6BD 3LSOB 4DRSA 1FYTA 3T77A 4JTGA 1CT8B 4GH3A 1UVQB 5JR1L 2K7QA 1TMHA 5B7MA 3E0FA 2DZAA 5FM5M 1QLEH 1U1HA 4MJID 1TZHA 1MH5B 4ZR8A 1Q1PA 4R0LC 2BOCA 3UYPA 3AWOA 5KTEL 3DGGA 4IU3A 5FB8A 4Q32A 2OL3H 1H5BA 1VEPA 3KFTA 1DQWA 7PAZA 2WP3T 2YUWA 1KIQB 3NDZE 4WEBL 3PZ9A 4GACA 2QKIA 3RZCD 1ZOXA 2BNRB 2GK0A 5LGJB 8PAZA 2CK0L 4Z76A 3HOGA 3TFKC 4G8EB 3AITA 3WLMA 3GH5A 4ZYKA 5JXAH 4N87A 1WGVA 4W4NA 4X6CF 1HFUA 2WHLA 4NOFA 3LEXA 1WUNT 3RLVA 3VZXA 3SKUD 2RHEA 2AQOA 3TQVA 3OG3A 2X89D 3ARBD 2A4AA 3QWRD 2DFAA 2LTQC 3RRAA 3L1OL 2EDMA 4FOJA 4UI2A 2YEZA 4KJPC 1P84J 3W1RA 2YB1A 3EZ8A 1RURL 4HX1A 3AG4B 3V4PB 3ARFC 2JLLA 4DOHB 1R5WA 4EN2A 3CZGA 4OIIL 1XLBA 4LYRA 3FFCE 4GEIA 2VZSA 4W9FC 1LOQA 4HCRL 4PV8A 4MXQC 3VZYA 1ZLUH 3VWJA 2P5EB 1CGXA 1IQWH 3CBJB 3QUZA 5D7HA 4MDIB 3QV8A 2DQUL 4N24A 4HUWB 5IB2A 3UPMA 3TA3B 3TEXA 9PCYA 2X70A 1SXNA 2D23A 2MCPH 2JIXA 5AECA 1F6LL 5HHMD 4JN1L 2QGHA 1IM3A 3UC2A 1ZRQA 4JIRA 1TTJA 1YUHA 2W38A 1XIWD 4A7SA 4O1BA 1XCQB 3HUJE 5D7LB 3SOTA 1ZHAA 4XNZB 2XXCB 5AAWC 3HIZA 3EAUA 4G83A 3M5VA 2J8UB 4TNVF 2DJUA 2J77A 4NO0A 1JYNA 2ZG3A 5H6HA 3S3BB 3UGXA 1GHRA 4JY5H 3QRGL 1ZLDA 3GK8L 1OGTB 2DI7A 3JWOC 3QDJA 1C5CH 4YBLC 3FVMA 1CD8A 4NL1A 3SDCA 1JXJA 4YHLH 5C9UA 5EBWA 5IESL 4W5ZA 4M6AA 5D1QE 3KPOA 3TYEA 1SMAA 3BQUC 2Y5SA 3RO6A 3TLLA 1MCCA 3XIMA 4XC3L 4UQAA 4KY2A 4XPHH 2VM3A 2IANE 4XCFH 3TN0C 4RX4D 5DA4A 4A63A 2VRKA 2O5ZH 1CLKA 1F4XH 2XZ9A 3MDJA 5KSAC 2YC1B 1F3WA 1IEXA 4CNTA 3RRQA 4X7CC 2C1PA 3AO0A 3VE7A 3IDGA 5HWMA 4OV5B 3WH9A 2WZPD 3GFZA 3FIGA 3CFBB 3ARDB 5HJBA 3ZBMA 2IWFA 4PJGE 3B7UX 4H2CA 3R0MA 4WJ5A 1ZU8A 4S2BA 4YZFF 1L0PA 2R51A 5DUPH 4B2DD 4YSOA 1CFNA 3ARGA 4RGND 1NWUA 2KLSA 4QD2E 2ZNXA 3EBGA 1MRAA 3CV7A 1EK3A 3AMCA 2EVIA 8RUCA 2YD8A 3S46A 1X7TA 4J3OD 4OJYA 4G71B 2YMOA 2YQ3A 3ZL4H 4R7NA 1FBIL 2MMXA 5EFFA 3FN9A 4JFDD 3I3BA 4U6YB 3IGAB 2XZZA 3JV4B 1B2WH 3UZVB 5I1CH 2Y1YA 2AK4A 4MRBA 2NYKA 3GMOB 3CXHK 3GF8A 3LK6A 3W57A 2NXYD 3R0DA 4MADA 3C8HA 5BNKA 1QI0A 1NCWH 5SV3A 4OLYL 2DWXA 2F6AA 1GZPA 3ORJA 5KVEE 3NQIA 4HLZG 5T1LB 3S5LA 1KJ3L 4BDVB 1S2WA 5EC2B 3DTXA 3WBYA 3KVMA 5LN4A 4QNEA 3S5SA 1CLZL 1YNTF 4DEPC 1YA5A 3UC0L 4J4KA 1UIOA 3RKPA 2EP6A 3FEQA 3KDNA 4Y4FD 1J9RA 2OZNA 4OZ4B 3AIUA 4U6XB 5E7BA 1A5OC 3E0WA 2CKSA 5DDHA 4Z7VF 1TZ9A 1FWHC 2V6HA 3SIMA 4UIOA 1OPGL 2JBMA 3BZ4B 5GGSB 3FUJA 4LEFA 1QSEE 1PLCA 3BH4A 1KIUA 4HJUA 5F1VA 2VT0A 3BCFA 5BS0A 3ET9F 1I1CA 2WTPA 3LNPA 2W3ZA 3ARQA 3PWPA 4OBSA 3C8NA 3IGSA 3H7LA 4XWOC 2VKXA 3P2BA 2EG8A 2CHZA 5F2IA 1JQVA 1NBQA 4WI0A 3GVWA 2B5IB 3NGBB 4ISVB 3FZUD 4XH2A 4YDMA 1HQ4A 5HGAA 4AV5A 4LC8A 2ZVIA 1XZ0B 4K7PY 2APVA 5E2UL 4WJEA 5IJDC 1U8OB 1A4LA 3V1PA 4R27A 5I9QC 1IVTA 1U8LA 2L7JA 5T91A 3CLFH 2XIDA 4OLUH 4OZGB 1RJZB 1BLIA 1Y6KR 1OB1A 1Q72H 3AHZA 1W3IA 3OMAB 1MNSA 4JPKH 1JDDA 3QC0A 3C2VA 2XVGA 1BJMA 5FACA 5J12C 3K13A 4YTRA 4WZHA 3S3CB 5B80A 3H2WA 2PDKA 2VUYA 5KOMC 1MXGA 3STCA 1BQLL 5JHDD 1HXMB 1W9VA 4R34A 5DHVH 4EN3C 4MXWL 3WO8A 3ZRFC 4ERIA 2CGRL 3UXKA 4ZX3A 1CC3A 2QIIA 1ZT1A 3MA7A 1QRNB 5IK3A 4DIXA 1EJ7L 3MW7A 3THML 4E2BA 1G5GA 2O30A 3SBPA 2AQ1A 3CXDH 2YAQA 4ATDA 3B8UA 3UJFA 4JGDA 1UTDA 4PRIA 1GGBL 1DDHA 4WFEE 3ONCA 4Z7UA 1SOSA 2HH0H 2X1OA 3HAEG 5HK4A 5ESVB 1F8TL 2G3FA 3ZE0B 5L9DH 1AJ0A 4WJ8A 5DO2C 4IKIA 2AEIT 2F74A 2DQDH 2G3IA 2P5WE 1OSPH 3AALA 3HG4A 4GSDH 3CVHL 5IRPA 1IMHC 3MREB 1IGML 1J0KA 5DEFA 4OCWH 5ECVA 3PL6B 1KB5B 1WXZA 1X7QA 2HFGH 3P3SA 2ORBL 3PRZA 5C1MB 2V2XB 2E7LC 1WCBA 5IW6A 1HI6B 1PXGA 4G6AC 3BLEA 1AH0A 4GW1B 4BRVA 4KK5C 3BANA 4H26A 3T2NH 5JHLH 5B1CA 3FUNA 3ZDZF 1FVEB 3GRBA 4KROD 4PRNB 2RMNA 3PP4L 3FNDA 3N2CA 3K91A 1LORA 3WL9A 3NSNA 5E2VH 3UZWA 5BOOA 4Y5XA 1U3JA 2INZA 2A79A 2X5PA 4M93C 4IF2A 3CWNA 2YPVH 3G6JF 5DYOA 1T1XA 3MRGA 2NTSP 3IS4A 4I3SL 5CP3H 4E41E 3WF3A 3BWZA 4HIIA 2ALWA 2N01B 2VP8A 1WITA 3H3PH 3MRNB 3SGUA 5DJXB 3KLHC 4YDLB 2UY6A 4WJXA 1R5IA 2XA8L 2V81A 1C8YA 5KJRL 3GTVA 1CB7B 2BVQA 5EMLA 1BYCA 1WS8A 1EWDA 1FFOA 4I48B 2D0GA 1GVYA 1XUUA 2VX5A 2C9PA 4L9ZA 1O5XA 1AR1B 3DXAB 1LK2B 3TIMA 4DWSD 3PBGA 5D2TA 1PZ5B 5CEZL 2WXGA 4CKQA 2GUUA 3T40A 2B0MA 4OV6F 1JRHL 5K39A 4LLVB 4XXWA 2VN4A 4XPGL 4E4UA 4QRQA 3I7SA 1M41A 1XI3A 4C58B 1KFBA 1FFPB 3X13B 4PJFB 1ZLSL 4D0DA 3WIIL 5D03A 2V5DA 1JZJA 1QNQA 3QPKA 4XX5A 1U5HA 1EOMA 1KLGA 2PF0A 4JO4L 4PBEA 1WFIA 3P0YL 1EDHA 3GMRB 4OIBA 1OYBA 4MNQD 4FAMA 2H2PC 4BFFA 4C8XA 3GSOA 3JSSA 3B04A 5FF6A 3NIYA 3AW5A 2NDGA 3SO3C 4ENED 4E5XG 1KCRH 2G5RA 3LCGA 4GS7C 4HP5A 4WO0A 2CR3A 4Q6IA 4KS0A 4N9GB 1RLDA 3V2AR 3B4NA 4Y9NA 3E8UL 2ZCHH 1VC4A 2P1FA 2JJSC 2WB5A 2QCNA 2EDFA 1DJQA 4F2ME 3KJ6H 1M2VA 1UB6B 1C8VA 4O1AA 2OL3A 2ZKXA 3QXAB 5B3SB 4WDWA 4MA3B 3KPMA 1QFWH 4QDGA 5KSUA 4OBRA 1JZ5A 1A4JB 2D20A 3TTOA 3EJQA 2R1PA 1PZBA 1H3GA 4C6CA 2Z6FA 3HV8A 1IGTB 1M57B 3IDIB 3RO8A 5JIDA 1VHNA 4IMLA 2CE6A 3HG1D 3OAZH 1UYWH 1S2UA 4FDWA 1OGSA 1L6PA 2NVDA 3GSXA 5GGTH 2PTXA 4HU8A 3RTQD 5E24E 2QVHA 3C9NA 1SUJA 1NCNA 1KFKA 2R0KH 2YGNA 3B7YA 1M53A 3HEIB 2IAMD 1JZHA 4NWUL 5FUCE 3TOYA 2FSDA 2N0MA 3IFLH 3E2HB 1FCUA 1AD9B 3RL1B 5DEJA 3P9MB 4FNUA 4LSVH 5ANMB 2YXOA 2PYEE 2JJUA 4PJXE 4HKXB 3O6AA 3LBMA 4K37A 2W8CA 1MRCL 3NACH 5IG7B 5IMOB 4R7OA 4UTKA 4IGNA 1TV3A 3IS0X 1EBGA 5KVFH 2AGTA 4U0RC 3P62A 2QJIA 2Q1EA 2ATKA 4KXZH 1ZXQA 3NZ8A 3M17A 1TT6A 5IMMA 4AVKA 1I1YA 1CBVL 5GSVB 4N0UA 4PS4H 2NY1B 3ME0B 1DLFH 2TYSA 3CZFA 1MQRA 1O5DT 4HPYL 1W5NA 1BQHG 2OMVB 4Y16C 4H04A 5D38A 3NQ8A 4QWWC 4TUOB 5GNZA 3A6CL 3PUDA 4V1DA 3O2DH 1PKNA 4NVTA 4PBWD 4LCVA 4ZFZB 2QHAA 4P8WA 3WNIA 4Z5RB 3KXFA 3QIWA 3GGWA 2W9EL 1P4IH 4X8JB 4DHLA 4ZZ9A 1IBYA 4FHBD 3QZWG 5LNEA 5DK3A 1TJHL 4WGVB 2AABL 2ERJC 3BT2L 3BWUC 8TIMA 1GZGA 4ECNA 4Y2OA 3PIQB 3VXUD 5FGCB 2UWEF 2Y7SA 4KVPA 1T7WA 3KRUA 3B0XA 3FH8A 1F5ZA 2FIRT 2FJFB 2YD4A 2PDYA 3G7TA 4YVVA 4TSBH 2QDDA 1OARL 4WWKC 1T5WB 3KS0J 3AREA 4F9DA 4JHAH 3GX9A 4JCMA 4NRZB 4K15A 2EZ0D 1TEYA 3HE7A 3EF7A 3UBXB 2XGIA 4AZCA 1QCWA 5DELA 4HU2A 4IOIA 4JZNA 4YN5A 3D0VB 2MKLC 1H63A 2WAGA 4NRYA 3DECA 3UBFA 2A85A 4UFJA 1BVNP 2P3ZA 3TASA 2UUDH 2XWZA 4A7QA 5HHXH 5FM8A 1IZJA 1P7HL 1MCNA 5F7DA 2B20A 2UVFA 2H0FA 4FFZH 3EYPA 1LF1A 4O2FA 1RZJH <