1HTAA

Crystal structure of the histone hmfa from methanothermus fervidus
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
68
structure length
68
Chain Sequence
MGELPIAPIGRIIKNAGAERVSDDARIALAKVLEEMGEEIASEAVKLAKHAGRKTIKAEDIELARKMF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HISTONE HMFA
publication title Crystal structures of recombinant histones HMfA and HMfB from the hyperthermophilic archaeon Methanothermus fervidus.
pubmed doi rcsb
source organism Methanothermus fervidus
molecule tags Histone
total genus 25
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 1998-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00808 CBFD_NFYB_HMF Histone-like transcription factor (CBF/NF-Y) and archaeal histone
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1htaA00
5JRGD 3AZHB 4XUJB 3AZIC 3X1UA 2NZDB 3AZJD 4KHAB 5CPID 4H9OB 1P3GB 1JFIA 5GSUC 1KX3A 4H9QB 3AYWA 4G92B 1ID3B 5FUGB 3RELB 3AZNA 2AROA 5KDMA 4J8UA 3UTBD 4J8WB 2HIOC 2PYOB 1M1AB 4CAYB 3W96C 5B24C 5BNXB 3LZ0B 3TU4D 4JJND 1U35C 3MVDB 5AVBB 1BH8A 3REKB 5GT0C 1P3PC 5CHLB 3AZKA 3KXBB 3B6FA 1BH9B 5AV6D 4WZSB 4YM6C 2F8NB 5BO0A 5AY8C 3WA9B 3MNNC 3AZEA 5DNMC 5BS7A 5B31C 5B2ID 3AV1C 3WKJD 3AZFA 4AWLB 2CV5B 3A6NA 4J8XC 4UUZA 5GXQB 1P3FD 3AZMD 4XUJA 2BYMB 4QLCB 1AOIA 3AZLD 3LELB 4KHAA 3UTAC 2FJ7C 5F99D 1KU5A 4E44A 1U35B 4H9OA 4H9NB 1P3GA 4H9QA 3W98C 5FUGA 3RELA 2F8NG 4H9SA 4Z66C 4XZQD 4ZUXB 5GSUB 1TZYA 1A7WA 3W99D 5B33D 1P34C 2PYOA 3REIA 1M1AA 5B0YD 5CP6C 4LD9D 4CAYA 5JA4B 5BNXA 5AV8C 3LZ0A 3MGPC 1F66B 2HIOB 4WU8C 3LZ1A 3AN2A 5B24B 3REJA 1KX5C 5DNNC 3KXBA 5AV5A 5CPJA 4X23C 1EQZD 3WTPA 2F8NA 3VH6W 5B0ZC 5GT0B 3X1SD 1P3BB 3WA9A 3X1VD 2NZDC 5B1MB 3MGQD 2YFWB 4YM6B 3B6GB 5G49B 2CV5A 5JRGC 5AY8B 3MNNB 5GXQA 3AFAD 4J8VD 1ID3C 3AZGD 2BYMA 3LELA 1B6WA 5C3IC 3AV1B 1Q9CA 3B0DC 3KSYA 5B40D 1U35A 4J8XB 1P3KC 4EO5C 4CSRA 3AZIA 4J8WC 2FJ7B 3UTAB 4WU9B 3X1UD 3O62B 5GSUA 3MVDC 5AVBC 5BNVB 3REKC 3W98B 1P3OB 5JA4A 1KX3D 3X1TB 4JJNC 1P34B 2HIOA 5CP6B 3W96A 5B24A 1P3LB 3MGSB 3REHD 3MGPB 2NQBD 5AV6C 3C1CC 1N1JB 4WU8B 5GT0A 1P3PA 3B0BA 3AV2D 3NQJA 4QLCC 4X23B 1HTAA 4YM6A 3WKJC 3WAAB 5G49A 3AZKD 1HQ3B 5AY8A 3MNNA 5DNMA 1P3FC 3AZLC 5B31A 3AZFB 3AV1A 5F99C 3B0CW 4ZUXC 5JRGB 4J8XA 5AV9D 3AZJB 5C3IB 2FJ7A 3UTAA 3A6ND 4DRAA 3B0DB 4DRBA 4XUJD 1P3KB 4EO5B 1AOID 3KWQD 3W99C 1F66C 3W98A 4Z66A 1P3AD 1P3ID 3UTBB 4NFTA 3VH6T 1P34A 3W97A 5B2JD 5CP6A 1P3BC 5AV8A 4Z5TD 1TZYD 3KUYD 3TU4B 5B1MC 5B32D 3MGPA 4JJNB 3REID 3MGRD 2YFVB 3B6GC 4WU8A 5B1LD 1KX5A 5GT3C 4H9PB 3X1VC 5DNNA 1P3MD 5E5AD 5AV6B 3LZ1D 4X23A 3AN2D 3C1CB 3REJD 5B0ZA 3AZHA 3AFAC 5AV5D 5CPJD 2F8NK 2NZDA 3AZGC 3WTPD 2L5AA 2F8ND 5B2IB 3UT9D 3WKJB 4WU9C 1ULYA 5BT1D 5JRGA 3O62C 1P3FB 3AZMB 3LJAC 1ID3A 3VH6A 3AZLB 1P3OC 2CV5D 5F99B 3X1TC 1P3KA 2RVQD 2IO5B 5CPKD 4J8WA 4NE5A 1P3LC 4XZQB 3MGSC 3AZID 4R8PD 1M18D 3W99B 3MVDA 5AVBA 3REKA 1TAFB 5B33B 4ZBJC 4LD9B 3REHC 2HUEC 1BH9A 4JJNA 2NQBC 4YS3D 3WAAC 1HQ3C 4KUDD 1WWIA 4H9PA 3AV2C 2HIOD 5AV6A 3B0CT 1EQZB 3C1CA 3W96D 1M19D 3C1BD 3X1SB 5AVCD 1ZLAD 5GT3B 3X1VB 3AZJC 4QLCA 3MGQB 1P3PD 5CPIC 3WKJA 4H9NA 3AFAB 5AV9C 4KGCD 1P3FA 1KX4D 1S32D 4J8VB 3AZGB 1WWSA 3AZLA 5B40B 5F99A 3MNND 5DNMD 4ZUXA 3UTBC 3LJAB 5B31D 3KWQC 3TU4C 3AYWD 1P3AC 3X1UB 1P3IC 3AZND 2AROD 3W99A 1F66A 1TAFA 5B2JC 4J8UD 3KUYC 4Z5TC 1KX3B 4HGAC 5B32C 3MGRC 4Z66D 4ZBJB 5B1LC 1P3BA 3REHB 2HUEB 5B1MA 1P3MC 5E5AC 2YFWA 5B2IC 3W97D 2NQBB 5CP6D 3B6GA 5AV8D 4H9RB 3B6FD 5GT3A 3AZMC 3AV2B 3X1VA 3UT9C 1KX5D 3AZED 3AZKB 5DNND 3AFAA 2IO5C 3AZGA 3AZFD 5B0ZD 4XZQC 3AZHD 5CPIB 4WU9A 5AV9B 4NE6A 3O62A 2RVQC 2NZDD 3LJAA 5BNVA 5B33C 5CPKC 1P3OA 5B0YC 4LD9C 4UUZB 1P3GD 3X1TA 4R8PC 1ID3D 1AOIB 3RELD 1M18C 3KWQB 2BYKB 1P3KD 1P3LA 3MGSA 1P3AB 4J8WD 1P3IB 2PYOD 4YS3C 1M1AD 1EQZC 1N1JA 3LZ0D 5B2JB 4WV4B 3X1SC 4KUDC 3KUYB 4Z5TB 1TZYB 4HGAB 3MVDD 3VH5W 5AVBD 3REHA 3REKD 5B32B 3MGQC 2NQBA 3REIB 3MGRB 1B67A 3WAAA 4G91B 5B1LB 1M19C 3C1BC 1HQ3A 5AVCC 1F1EA 4H9RA 3KXBD 1ZLAC 3AV2A 4E45A 4J8VC 1P3MB 5E5AB 3LZ1B 3AN2B 3REJB 5B40C 3WA9D 4WNNB 5AV5B 5CPJB 4KGCC 1KX4C 1S32C 4NE3A 3C1CD 3WTPB 3AZJA 3UT9B 5GXQD 5CPIA 3V9RB 3X1UC 5AV9A 4QLCD 3R45B 3LELD 5B32G 2JSSA 1U35D 4M6BA 1KX3C 3AYWC 1R4VA 3AZNC 3UTBA 1BFMA 3KWQA 2AROC 5CPKB 5B0YB 4ZUXD 4J8UC 2BYKA 5GSUD 3TU4A 4CSRB 3AZIB 4R8PB 1P3AA 1P3IA 1M18B 3WTPE 2YFVA 4Z2MH 5B2JA 3KUYA 4Z5TA 1F66D 5B32A 4YS3B 3W97C 3MGRA 5B24D 3AZKC 5B1LA 4KUDB 3B6FC 1P3MA 5E5AA 5B2IA 5GT0D 3W96B 3AZEC 1P3BD 1M19B 3C1BB 5AVCB 4WNNA 1ZLAB 5B1MD 5BS7C 3AZMA 4YM6D 3AZFC 3B6GD 3A6NC 1P3PB 3UT9A 5AY8D 3AZHC 5GT3D 4XUJC 3NQJB 3V9RA 4KGCB 3NQUB 1AOIC 1KX4B 3R45A 1S32B 3AV1D 1H3OB 4J8XD 4XZQA 1P3GC 5DNMB 4G92C 3RELC 2FJ7D 5B31B 4H9SC 3UTAD 5B33A 5CPKA 4WU9D 5B0YA 4LD9A 1JFIB 3VH5T 3O62D 1TZYC 3AYWB 3LJAD 4R8PA 3W98D 3AZNB 1M18A 2PYOC 3REIC 1P3OD 2AROB 5KDMB 1M1AC 3LZ0C 4G91C 4J8UB 3X1TD 1P34D 2CWEA 3LZ1C 3AN2C 4YS3A 1EQZA 3REJC 4Z66B 2LY8A 1P3LD 3X1SA 3MGSD 4KUDA 3KXBC 5AV5C 3MGPD 5CPJC 1BH8B 3WTPC 5B31G 3MGQA 4WU8D 3W97B 3WA9C 5AV8B 1M19A 3C1BA 5BT1C 5AVCA 3B6FB 1ZLAA 4Z2MG 4X23D 4J8VA 2CV5C 4AWLC 3WAAD 1HQ3D 5BO0B 5B40A 3AZEB 5GXQC 1KX5B 3VH5A 5DNNB 2F8NH 4KGCA 3NQUA 3LELC 1KX4A 1S32A 1H3OA 3A6NB 5B0ZB
chains in the Genus database with same CATH superfamily
5JRGD 3AZHB 4XUJB 1W2EA 3AZIC 3X1UA 2NZDB 3AZJD 4KHAB 4DQYB 5CPID 4H9OB 1P3GB 1JFIA 5GSUC 1KX3A 4H9QB 3AYWA 4G92B 1ID3B 5FUGB 3RELB 3AZNA 2AROA 5KDMA 4J8UA 3UTBD 4J8WB 2HIOC 2PYOB 1M1AB 4CAYB 3W96C 5B24C 5BNXB 3LZ0B 3TU4D 4JJND 2Y2NA 3IP4C 1U35C 3MVDB 5AVBB 1BH8A 3REKB 2ZY4A 5GT0C 1P3PC 5CHLB 3AZKA 3KXBB 3B6FA 1BH9B 5AV6D 4WZSB 4YM6C 2F8NB 5BO0A 5AY8C 3WA9B 3MNNC 3AZEA 5DNMC 5BS7A 5B31C 5B2ID 3AV1C 3WKJD 3AZFA 4AWLB 2CV5B 3A6NA 4J8XC 4UUZA 5GXQB 1P3FD 3AZMD 4XUJA 2BYMB 4QLCB 1AOIA 3AZLD 3LELB 4KHAA 3UTAC 2FJ7C 5F99D 1KU5A 4E44A 1U35B 4H9OA 4H9NB 1P3GA 4H9QA 3W98C 5FUGA 3RELA 2F8NG 4H9SA 4Z66C 4XZQD 4ZUXB 5GSUB 1TZYA 1A7WA 3W99D 5B33D 1P34C 2ZM5A 2PYOA 3REIA 1M1AA 5B0YD 5CP6C 4LD9D 4CAYA 5JA4B 5BNXA 5AV8C 3LZ0A 3MGPC 1F66B 2HIOB 4WU8C 3LZ1A 3AN2A 2DQNC 5B24B 3REJA 1KX5C 5DNNC 3KXBA 5AV5A 5CPJA 4X23C 1EQZD 3WTPA 2F8NA 2Y2PA 3VH6W 5GT0B 5B0ZC 3X1SD 1P3BB 3WA9A 3X1VD 2NZDC 5B1MB 3MGQD 2YFWB 2Y2GA 4YM6B 3B6GB 5G49B 2CV5A 5JRGC 5AY8B 3MNNB 5GXQA 3AFAD 4J8VD 1ID3C 3AZGD 2BYMA 3LELA 1B6WA 5C3IC 2DF4C 3AV1B 5B40D 1Q9CA 3B0DC 3KSYA 2ZY3A 4J8XB 1U35A 1P3KC 4EO5C 4CSRA 3AZIA 4J8WC 2FJ7B 3UTAB 2Y2HA 4WU9B 3X1UD 3O62B 5GSUA 3MVDC 5AVBC 5BNVB 3REKC 3W98B 1P3OB 5JA4A 1KX3D 2G5IC 3X1TB 4JJNC 1P34B 2HIOA 5CP6B 3W96A 5B24A 1P3LB 2ZY5A 3MGSB 3REHD 3MGPB 2NQBD 5AV6C 3C1CC 1N1JB 4WU8B 5GT0A 1P3PA 3B0BA 3AV2D 3NQJA 4QLCC 4X23B 1HTAA 4YM6A 3WKJC 3WAAB 5G49A 3EPJA 3AZKD 1HQ3B 2W8SA 5AY8A 3MNNA 5DNMA 1P3FC 3AZLC 5B31A 3AZFB 3AV1A 5F99C 3B0CW 4ZUXC 5JRGB 4J8XA 5AV9D 3AZJB 5C3IB 2FJ7A 3UTAA 3A6ND 4DRAA 3B0DB 4DRBA 4XUJD 1P3KB 4EO5B 3F6TA 1AOID 1PZRA 3KWQD 3W99C 1F66C 3W98A 4Z66A 3H0RC 3EPKA 2JCHA 1P3AD 1P3ID 3UTBB 4NFTA 3VH6T 1P34A 3W97A 5B2JD 5CP6A 1P3BC 5AV8A 4Z5TD 1TZYD 3KUYD 3TU4B 5B1MC 5B32D 3MGPA 4JJNB 3REID 3MGRD 2YFVB 3B6GC 4WU8A 2Y2LA 5B1LD 2Y2QA 1KX5A 5GT3C 4H9PB 3X1VC 5DNNA 1P3MD 5E5AD 5AV6B 3LZ1D 4X23A 3AN2D 3C1CB 3REJD 2RIQA 5B0ZA 3AZHA 3AFAC 5AV5D 5CPJD 2F8NK 2NZDA 3AZGC 3WTPD 2L5AA 2F8ND 2Y2MA 5B2IB 3UT9D 3WKJB 4WU9C 1ULYA 5BT1D 5JRGA 3O62C 2JE5A 1P3FB 3AZMB 3LJAC 1ID3A 3VH6A 3AZLB 1P3OC 2CV5D 5F99B 3X1TC 1P3KA 2RVQD 2IO5B 5CPKD 4J8WA 4NE5A 1P3LC 4XZQB 3MGSC 4UPKA 4R8PD 3AZID 1M18D 3W99B 3MVDA 5AVBA 3REKA 1TAFB 5B33B 4ZBJC 4LD9B 3REHC 2HUEC 1BH9A 4JJNA 2NQBC 4YS3D 3A1KA 3WAAC 1HQ3C 3A1IA 4KUDD 1WWIA 4H9PA 3AV2C 2HIOD 5AV6A 3B0CT 1EQZB 3C1CA 3W96D 1M19D 3C1BD 3X1SB 5AVCD 1ZLAD 5GT3B 3X1VB 3AZJC 4QLCA 3MGQB 1P3PD 5CPIC 3WKJA 4H9NA 3AFAB 5AV9C 4KGCD 1P3FA 1KX4D 1S32D 4J8VB 3AZGB 1WWSA 3AZLA 5B40B 5F99A 3MNND 5DNMD 4ZUXA 3UTBC 3LJAB 5B31D 3KWQC 3TU4C 3AYWD 1P3AC 3X1UB 1P3IC 3AZND 2AROD 3W99A 1F66A 1TAFA 5B2JC 4J8UD 3KUYC 4Z5TC 1KX3B 4HGAC 5B32C 3MGRC 2VQRA 4ZBJB 4Z66D 5B1LC 1P3BA 3REHB 2HUEB 3H0LC 5B1MA 1P3MC 5E5AC 2YFWA 5B2IC 3W97D 2NQBB 5CP6D 3B6GA 5AV8D 4H9RB 3B6FD 5GT3A 3AZMC 3AV2B 3X1VA 2Y2JA 3UT9C 1KX5D 3AZED 3AZKB 3FDDA 5DNND 3AFAA 2IO5C 2ZY2A 3AZGA 3AZFD 5B0ZD 2UWXA 4XZQC 3AZHD 5CPIB 3EG5B 4WU9A 5AV9B 4NE6A 3O62A 2RVQC 2NZDD 3LJAA 5BNVA 5B33C 5CPKC 1P3OA 5B0YC 3KFUG 4LD9C 4UUZB 1P3GD 3X1TA 4R8PC 1ID3D 1AOIB 3RELD 1M18C 3KWQB 2BYKB 1P3KD 1P3LA 2FFFB 3MGSA 2Y2IA 1P3AB 4J8WD 1P3IB 2PYOD 4YS3C 1M1AD 1EQZC 1N1JA 3LZ0D 5B2JB 4WV4B 3X1SC 4KUDC 3KUYB 4Z5TB 1TZYB 3H0MC 1T3UA 4HGAB 3MVDD 3VH5W 5AVBD 3REHA 3REKD 5B32B 3MGQC 2NQBA 3REIB 3MGRB 1B67A 3WAAA 4G91B 5B1LB 1M19C 3C1BC 1HQ3A 5AVCC 1F1EA 4H9RA 3KXBD 1ZLAC 3AV2A 4E45A 4J8VC 1P3MB 5E5AB 3LZ1B 3AN2B 3REJB 5B40C 3WA9D 4WNNB 5AV5B 5CPJB 4KGCC 1KX4C 1S32C 4NE3A 3C1CD 3WTPB 3AZJA 3UT9B 5GXQD 5CPIA 3V9RB 3X1UC 5AV9A 4QLCD 3R45B 3LELD 5B32G 2JSSA 1U35D 4WJ3C 4M6BA 3EPLA 1KX3C 3AYWC 1R4VA 3AZNC 3UTBA 1BFMA 2BG1A 2AROC 3KWQA 5CPKB 5B0YB 4ZUXD 4J8UC 2BYKA 5GSUD 3TU4A 4CSRB 3AZIB 4R8PB 1P3AA 1P3IA 1M18B 3WTPE 2YFVA 4Z2MH 5B2JA 3KUYA 4Z5TA 1F66D 5B32A 4YS3B 3W97C 3MGRA 5B24D 3AZKC 5B1LA 4KUDB 3B6FC 3P5JB 1P3MA 5E5AA 5B2IA 5GT0D 3W96B 2F2AC 3AZEC 2J8PA 2Y2KA 1P3BD 3C1BB 1M19B 5AVCB 3EPHA 4WNNA 1ZLAB 5B1MD 5BS7C 3AZMA 4YM6D 3AZFC 3B6GD 3A6NC 1P3PB 3UT9A 5AY8D 3AZHC 5GT3D 4XUJC 3NQJB 3V9RA 4KGCB 3NQUB 1AOIC 1KX4B 3R45A 1S32B 3AV1D 1H3OB 4J8XD 4XZQA 1P3GC 5DNMB 3AL0C 4G92C 3RELC 2FJ7D 5B31B 4H9SC 3UTAD 5B33A 5CPKA 4WU9D 5B0YA 4LD9A 1JFIB 3VH5T 3O62D 1TZYC 2XD1A 3AYWB 3LJAD 4R8PA 3W98D 3AZNB 1M18A 2PYOC 3REIC 1P3OD 2AROB 5KDMB 1M1AC 3LZ0C 4G91C 4J8UB 3X1TD 2Y2OA 1P34D 2CWEA 3LZ1C 3AN2C 4YS3A 1EQZA 3REJC 4Z66B 2LY8A 1P3LD 3X1SA 3MGSD 4KUDA 3KXBC 5AV5C 3MGPD 5CPJC 1BH8B 3WTPC 5B31G 3MGQA 4WU8D 3W97B 3WA9C 5AV8B 1M19A 3C1BA 5BT1C 5AVCA 3B6FB 1ZLAA 1Z2CB 4Z2MG 4X23D 4J8VA 2XD5A 2CV5C 4AWLC 3WAAD 1HQ3D 5BO0B 5B40A 3AZEB 5GXQC 1KX5B 3VH5A 5DNNB 2F8NH 4KGCA 3NQUA 3LELC 1KX4A 1S32A 2G5HC 1H3OA 3A6NB 5B0ZB
chains in the Genus database with same CATH topology
5JRGD 3AZHB 4XUJB 1W2EA 3AZIC 3X1UA 2NZDB 3AZJD 4KHAB 4DQYB 5CPID 4H9OB 1P3GB 1JFIA 5GSUC 1KX3A 4H9QB 3AYWA 4G92B 1ID3B 5FUGB 3RELB 3AZNA 2AROA 5KDMA 4J8UA 3UTBD 4J8WB 2HIOC 2PYOB 1M1AB 4CAYB 3W96C 5B24C 5BNXB 3LZ0B 3TU4D 4JJND 2Y2NA 3IP4C 1U35C 3MVDB 5AVBB 1BH8A 3REKB 2ZY4A 5GT0C 1P3PC 5CHLB 3AZKA 3KXBB 3B6FA 1BH9B 5AV6D 4WZSB 4YM6C 2F8NB 5BO0A 5AY8C 3WA9B 3MNNC 3AZEA 5DNMC 5BS7A 5B31C 5B2ID 3AV1C 3WKJD 3AZFA 4AWLB 2CV5B 3A6NA 4J8XC 4UUZA 5GXQB 1P3FD 3AZMD 4XUJA 2BYMB 4QLCB 1AOIA 3AZLD 3LELB 4KHAA 3UTAC 2FJ7C 5F99D 1KU5A 4E44A 1U35B 4H9OA 4H9NB 1P3GA 4H9QA 3W98C 5FUGA 3RELA 2F8NG 4H9SA 4Z66C 4XZQD 4ZUXB 5GSUB 1TZYA 1A7WA 3W99D 5B33D 1P34C 2ZM5A 2PYOA 3REIA 1M1AA 5B0YD 5CP6C 4LD9D 4CAYA 5JA4B 5BNXA 5AV8C 3LZ0A 3MGPC 1F66B 2HIOB 4WU8C 3LZ1A 3AN2A 2DQNC 5B24B 3REJA 1KX5C 5DNNC 3KXBA 5AV5A 5CPJA 4X23C 1EQZD 3WTPA 2F8NA 2Y2PA 3VH6W 5GT0B 5B0ZC 3X1SD 1P3BB 3WA9A 3X1VD 2NZDC 5B1MB 3MGQD 2YFWB 2Y2GA 4YM6B 3B6GB 5G49B 2CV5A 5JRGC 5AY8B 3MNNB 5GXQA 3AFAD 4J8VD 1ID3C 3AZGD 2BYMA 3LELA 1B6WA 5C3IC 2DF4C 3AV1B 5B40D 1Q9CA 3B0DC 3KSYA 2ZY3A 4J8XB 1U35A 1P3KC 4EO5C 4CSRA 3AZIA 4J8WC 2FJ7B 3UTAB 2Y2HA 4WU9B 3X1UD 3O62B 5GSUA 3MVDC 5AVBC 5BNVB 3REKC 3W98B 1P3OB 5JA4A 1KX3D 2G5IC 3X1TB 4JJNC 1P34B 2HIOA 5CP6B 3W96A 5B24A 1P3LB 2ZY5A 3MGSB 3REHD 3MGPB 2NQBD 5AV6C 3C1CC 1N1JB 4WU8B 5GT0A 1P3PA 3B0BA 3AV2D 3NQJA 4QLCC 4X23B 1HTAA 4YM6A 3WKJC 3WAAB 5G49A 3EPJA 3AZKD 1HQ3B 2W8SA 5AY8A 3MNNA 5DNMA 1P3FC 3AZLC 5B31A 3AZFB 3AV1A 5F99C 3B0CW 4ZUXC 5JRGB 4J8XA 5AV9D 3AZJB 5C3IB 2FJ7A 3UTAA 3A6ND 4DRAA 3B0DB 4DRBA 4XUJD 1P3KB 4EO5B 3F6TA 1AOID 1PZRA 3KWQD 3W99C 1F66C 3W98A 4Z66A 3H0RC 3EPKA 2JCHA 1P3AD 1P3ID 3UTBB 4NFTA 3VH6T 1P34A 3W97A 5B2JD 5CP6A 1P3BC 5AV8A 4Z5TD 1TZYD 3KUYD 3TU4B 5B1MC 5B32D 3MGPA 4JJNB 3REID 3MGRD 2YFVB 3B6GC 4WU8A 2Y2LA 5B1LD 2Y2QA 1KX5A 5GT3C 4H9PB 3X1VC 5DNNA 1P3MD 5E5AD 5AV6B 3LZ1D 4X23A 3AN2D 3C1CB 3REJD 2RIQA 5B0ZA 3AZHA 3AFAC 5AV5D 5CPJD 2F8NK 2NZDA 3AZGC 3WTPD 2L5AA 2F8ND 2Y2MA 5B2IB 3UT9D 3WKJB 4WU9C 1ULYA 5BT1D 5JRGA 3O62C 2JE5A 1P3FB 3AZMB 3LJAC 1ID3A 3VH6A 3AZLB 1P3OC 2CV5D 5F99B 3X1TC 1P3KA 2RVQD 2IO5B 5CPKD 4J8WA 4NE5A 1P3LC 4XZQB 3MGSC 4UPKA 4R8PD 3AZID 1M18D 3W99B 3MVDA 5AVBA 3REKA 1TAFB 5B33B 4ZBJC 4LD9B 3REHC 2HUEC 1BH9A 4JJNA 2NQBC 4YS3D 3A1KA 3WAAC 1HQ3C 3A1IA 4KUDD 1WWIA 4H9PA 3AV2C 2HIOD 5AV6A 3B0CT 1EQZB 3C1CA 3W96D 1M19D 3C1BD 3X1SB 5AVCD 1ZLAD 5GT3B 3X1VB 3AZJC 4QLCA 3MGQB 1P3PD 5CPIC 3WKJA 4H9NA 3AFAB 5AV9C 4KGCD 1P3FA 1KX4D 1S32D 4J8VB 3AZGB 1WWSA 3AZLA 5B40B 5F99A 3MNND 5DNMD 4ZUXA 3UTBC 3LJAB 5B31D 3KWQC 3TU4C 3AYWD 1P3AC 3X1UB 1P3IC 3AZND 2AROD 3W99A 1F66A 1TAFA 5B2JC 4J8UD 3KUYC 4Z5TC 1KX3B 4HGAC 5B32C 3MGRC 2VQRA 4ZBJB 4Z66D 5B1LC 1P3BA 3REHB 2HUEB 3H0LC 5B1MA 1P3MC 5E5AC 2YFWA 5B2IC 3W97D 2NQBB 5CP6D 3B6GA 5AV8D 4H9RB 3B6FD 5GT3A 3AZMC 3AV2B 3X1VA 2Y2JA 3UT9C 1KX5D 3AZED 3AZKB 3FDDA 5DNND 3AFAA 2IO5C 2ZY2A 3AZGA 3AZFD 5B0ZD 2UWXA 4XZQC 3AZHD 5CPIB 3EG5B 4WU9A 5AV9B 4NE6A 3O62A 2RVQC 2NZDD 3LJAA 5BNVA 5B33C 5CPKC 1P3OA 5B0YC 3KFUG 4LD9C 4UUZB 1P3GD 3X1TA 4R8PC 1ID3D 1AOIB 3RELD 1M18C 3KWQB 2BYKB 1P3KD 1P3LA 2FFFB 3MGSA 2Y2IA 1P3AB 4J8WD 1P3IB 2PYOD 4YS3C 1M1AD 1EQZC 1N1JA 3LZ0D 5B2JB 4WV4B 3X1SC 4KUDC 3KUYB 4Z5TB 1TZYB 3H0MC 1T3UA 4HGAB 3MVDD 3VH5W 5AVBD 3REHA 3REKD 5B32B 3MGQC 2NQBA 3REIB 3MGRB 1B67A 3WAAA 4G91B 5B1LB 1M19C 3C1BC 1HQ3A 5AVCC 1F1EA 4H9RA 3KXBD 1ZLAC 3AV2A 4E45A 4J8VC 1P3MB 5E5AB 3LZ1B 3AN2B 3REJB 5B40C 3WA9D 4WNNB 5AV5B 5CPJB 4KGCC 1KX4C 1S32C 4NE3A 3C1CD 3WTPB 3AZJA 3UT9B 5GXQD 5CPIA 3V9RB 3X1UC 5AV9A 4QLCD 3R45B 3LELD 5B32G 2JSSA 1U35D 4WJ3C 4M6BA 3EPLA 1KX3C 3AYWC 1R4VA 3AZNC 3UTBA 1BFMA 2BG1A 2AROC 3KWQA 5CPKB 5B0YB 4ZUXD 4J8UC 2BYKA 5GSUD 3TU4A 4CSRB 3AZIB 4R8PB 1P3AA 1P3IA 1M18B 3WTPE 2YFVA 4Z2MH 5B2JA 3KUYA 4Z5TA 1F66D 5B32A 4YS3B 3W97C 3MGRA 5B24D 3AZKC 5B1LA 4KUDB 3B6FC 3P5JB 1P3MA 5E5AA 5B2IA 5GT0D 3W96B 2F2AC 3AZEC 2J8PA 2Y2KA 1P3BD 3C1BB 1M19B 5AVCB 3EPHA 4WNNA 1ZLAB 5B1MD 5BS7C 3AZMA 4YM6D 3AZFC 3B6GD 3A6NC 1P3PB 3UT9A 5AY8D 3AZHC 5GT3D 4XUJC 3NQJB 3V9RA 4KGCB 3NQUB 1AOIC 1KX4B 3R45A 1S32B 3AV1D 1H3OB 4J8XD 4XZQA 1P3GC 5DNMB 3AL0C 4G92C 3RELC 2FJ7D 5B31B 4H9SC 3UTAD 5B33A 5CPKA 4WU9D 5B0YA 4LD9A 1JFIB 3VH5T 3O62D 1TZYC 2XD1A 3AYWB 3LJAD 4R8PA 3W98D 3AZNB 1M18A 2PYOC 3REIC 1P3OD 2AROB 5KDMB 1M1AC 3LZ0C 4G91C 4J8UB 3X1TD 2Y2OA 1P34D 2CWEA 3LZ1C 3AN2C 4YS3A 1EQZA 3REJC 4Z66B 2LY8A 1P3LD 3X1SA 3MGSD 4KUDA 3KXBC 5AV5C 3MGPD 5CPJC 1BH8B 3WTPC 5B31G 3MGQA 4WU8D 3W97B 3WA9C 5AV8B 1M19A 3C1BA 5BT1C 5AVCA 3B6FB 1ZLAA 1Z2CB 4Z2MG 4X23D 4J8VA 2XD5A 2CV5C 4AWLC 3WAAD 1HQ3D 5BO0B 5B40A 3AZEB 5GXQC 1KX5B 3VH5A 5DNNB 2F8NH 4KGCA 3NQUA 3LELC 1KX4A 1S32A 2G5HC 1H3OA 3A6NB 5B0ZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JRG D;  3AZH B;  4XUJ B;  3AZI C;  3X1U A;  2NZD B;  3AZJ D;  4KHA B;  5CPI D;  4H9O B;  1P3G B;  1JFI A;  5GSU C;  1KX3 A;  4H9Q B;  3AYW A;  4G92 B;  1ID3 B;  5FUG B;  3REL B;  3AZN A;  2ARO A;  5KDM A;  4J8U A;  3UTB D;  4J8W B;  2HIO C;  2PYO B;  1M1A B;  4CAY B;  3W96 C;  5B24 C;  5BNX B;  3LZ0 B;  3TU4 D;  4JJN D;  1U35 C;  3MVD B;  5AVB B;  1BH8 A;  3REK B;  5GT0 C;  1P3P C;  5CHL B;  3AZK A;  3KXB B;  3B6F A;  1BH9 B;  5AV6 D;  4WZS B;  4YM6 C;  2F8N B;  5BO0 A;  5AY8 C;  3WA9 B;  3MNN C;  3AZE A;  5DNM C;  5BS7 A;  5B31 C;  5B2I D;  3AV1 C;  3WKJ D;  3AZF A;  4AWL B;  2CV5 B;  3A6N A;  4J8X C;  4UUZ A;  5GXQ B;  1P3F D;  3AZM D;  4XUJ A;  2BYM B;  4QLC B;  1AOI A;  3AZL D;  3LEL B;  4KHA A;  3UTA C;  2FJ7 C;  5F99 D;  1KU5 A;  4E44 A;  1U35 B;  4H9O A;  4H9N B;  1P3G A;  4H9Q A;  3W98 C;  5FUG A;  3REL A;  2F8N G;  4H9S A;  4Z66 C;  4XZQ D;  4ZUX B;  5GSU B;  1TZY A;  1A7W A;  3W99 D;  5B33 D;  1P34 C;  2PYO A;  3REI A;  1M1A A;  5B0Y D;  5CP6 C;  4LD9 D;  4CAY A;  5JA4 B;  5BNX A;  5AV8 C;  3LZ0 A;  3MGP C;  1F66 B;  2HIO B;  4WU8 C;  3LZ1 A;  3AN2 A;  5B24 B;  3REJ A;  1KX5 C;  5DNN C;  3KXB A;  5AV5 A;  5CPJ A;  4X23 C;  1EQZ D;  3WTP A;  2F8N A;  3VH6 W;  5B0Z C;  5GT0 B;  3X1S D;  1P3B B;  3WA9 A;  3X1V D;  2NZD C;  5B1M B;  3MGQ D;  2YFW B;  4YM6 B;  3B6G B;  5G49 B;  2CV5 A;  5JRG C;  5AY8 B;  3MNN B;  5GXQ A;  3AFA D;  4J8V D;  1ID3 C;  3AZG D;  2BYM A;  3LEL A;  1B6W A;  5C3I C;  3AV1 B;  1Q9C A;  3B0D C;  3KSY A;  5B40 D;  1U35 A;  4J8X B;  1P3K C;  4EO5 C;  4CSR A;  3AZI A;  4J8W C;  2FJ7 B;  3UTA B;  4WU9 B;  3X1U D;  3O62 B;  5GSU A;  3MVD C;  5AVB C;  5BNV B;  3REK C;  3W98 B;  1P3O B;  5JA4 A;  1KX3 D;  3X1T B;  4JJN C;  1P34 B;  2HIO A;  5CP6 B;  3W96 A;  5B24 A;  1P3L B;  3MGS B;  3REH D;  3MGP B;  2NQB D;  5AV6 C;  3C1C C;  1N1J B;  4WU8 B;  5GT0 A;  1P3P A;  3B0B A;  3AV2 D;  3NQJ A;  4QLC C;  4X23 B;  1HTA A;  4YM6 A;  3WKJ C;  3WAA B;  5G49 A;  3AZK D;  1HQ3 B;  5AY8 A;  3MNN A;  5DNM A;  1P3F C;  3AZL C;  5B31 A;  3AZF B;  3AV1 A;  5F99 C;  3B0C W;  4ZUX C;  5JRG B;  4J8X A;  5AV9 D;  3AZJ B;  5C3I B;  2FJ7 A;  3UTA A;  3A6N D;  4DRA A;  3B0D B;  4DRB A;  4XUJ D;  1P3K B;  4EO5 B;  1AOI D;  3KWQ D;  3W99 C;  1F66 C;  3W98 A;  4Z66 A;  1P3A D;  1P3I D;  3UTB B;  4NFT A;  3VH6 T;  1P34 A;  3W97 A;  5B2J D;  5CP6 A;  1P3B C;  5AV8 A;  4Z5T D;  1TZY D;  3KUY D;  3TU4 B;  5B1M C;  5B32 D;  3MGP A;  4JJN B;  3REI D;  3MGR D;  2YFV B;  3B6G C;  4WU8 A;  5B1L D;  1KX5 A;  5GT3 C;  4H9P B;  3X1V C;  5DNN A;  1P3M D;  5E5A D;  5AV6 B;  3LZ1 D;  4X23 A;  3AN2 D;  3C1C B;  3REJ D;  5B0Z A;  3AZH A;  3AFA C;  5AV5 D;  5CPJ D;  2F8N K;  2NZD A;  3AZG C;  3WTP D;  2L5A A;  2F8N D;  5B2I B;  3UT9 D;  3WKJ B;  4WU9 C;  1ULY A;  5BT1 D;  5JRG A;  3O62 C;  1P3F B;  3AZM B;  3LJA C;  1ID3 A;  3VH6 A;  3AZL B;  1P3O C;  2CV5 D;  5F99 B;  3X1T C;  1P3K A;  2RVQ D;  2IO5 B;  5CPK D;  4J8W A;  4NE5 A;  1P3L C;  4XZQ B;  3MGS C;  3AZI D;  4R8P D;  1M18 D;  3W99 B;  3MVD A;  5AVB A;  3REK A;  1TAF B;  5B33 B;  4ZBJ C;  4LD9 B;  3REH C;  2HUE C;  1BH9 A;  4JJN A;  2NQB C;  4YS3 D;  3WAA C;  1HQ3 C;  4KUD D;  1WWI A;  4H9P A;  3AV2 C;  2HIO D;  5AV6 A;  3B0C T;  1EQZ B;  3C1C A;  3W96 D;  1M19 D;  3C1B D;  3X1S B;  5AVC D;  1ZLA D;  5GT3 B;  3X1V B;  3AZJ C;  4QLC A;  3MGQ B;  1P3P D;  5CPI C;  3WKJ A;  4H9N A;  3AFA B;  5AV9 C;  4KGC D;  1P3F A;  1KX4 D;  1S32 D;  4J8V B;  3AZG B;  1WWS A;  3AZL A;  5B40 B;  5F99 A;  3MNN D;  5DNM D;  4ZUX A;  3UTB C;  3LJA B;  5B31 D;  3KWQ C;  3TU4 C;  3AYW D;  1P3A C;  3X1U B;  1P3I C;  3AZN D;  2ARO D;  3W99 A;  1F66 A;  1TAF A;  5B2J C;  4J8U D;  3KUY C;  4Z5T C;  1KX3 B;  4HGA C;  5B32 C;  3MGR C;  4Z66 D;  4ZBJ B;  5B1L C;  1P3B A;  3REH B;  2HUE B;  5B1M A;  1P3M C;  5E5A C;  2YFW A;  5B2I C;  3W97 D;  2NQB B;  5CP6 D;  3B6G A;  5AV8 D;  4H9R B;  3B6F D;  5GT3 A;  3AZM C;  3AV2 B;  3X1V A;  3UT9 C;  1KX5 D;  3AZE D;  3AZK B;  5DNN D;  3AFA A;  2IO5 C;  3AZG A;  3AZF D;  5B0Z D;  4XZQ C;  3AZH D;  5CPI B;  4WU9 A;  5AV9 B;  4NE6 A;  3O62 A;  2RVQ C;  2NZD D;  3LJA A;  5BNV A;  5B33 C;  5CPK C;  1P3O A;  5B0Y C;  4LD9 C;  4UUZ B;  1P3G D;  3X1T A;  4R8P C;  1ID3 D;  1AOI B;  3REL D;  1M18 C;  3KWQ B;  2BYK B;  1P3K D;  1P3L A;  3MGS A;  1P3A B;  4J8W D;  1P3I B;  2PYO D;  4YS3 C;  1M1A D;  1EQZ C;  1N1J A;  3LZ0 D;  5B2J B;  4WV4 B;  3X1S C;  4KUD C;  3KUY B;  4Z5T B;  1TZY B;  4HGA B;  3MVD D;  3VH5 W;  5AVB D;  3REH A;  3REK D;  5B32 B;  3MGQ C;  2NQB A;  3REI B;  3MGR B;  1B67 A;  3WAA A;  4G91 B;  5B1L B;  1M19 C;  3C1B C;  1HQ3 A;  5AVC C;  1F1E A;  4H9R A;  3KXB D;  1ZLA C;  3AV2 A;  4E45 A;  4J8V C;  1P3M B;  5E5A B;  3LZ1 B;  3AN2 B;  3REJ B;  5B40 C;  3WA9 D;  4WNN B;  5AV5 B;  5CPJ B;  4KGC C;  1KX4 C;  1S32 C;  4NE3 A;  3C1C D;  3WTP B;  3AZJ A;  3UT9 B;  5GXQ D;  5CPI A;  3V9R B;  3X1U C;  5AV9 A;  4QLC D;  3R45 B;  3LEL D;  5B32 G;  2JSS A;  1U35 D;  4M6B A;  1KX3 C;  3AYW C;  1R4V A;  3AZN C;  3UTB A;  1BFM A;  3KWQ A;  2ARO C;  5CPK B;  5B0Y B;  4ZUX D;  4J8U C;  2BYK A;  5GSU D;  3TU4 A;  4CSR B;  3AZI B;  4R8P B;  1P3A A;  1P3I A;  1M18 B;  3WTP E;  2YFV A;  4Z2M H;  5B2J A;  3KUY A;  4Z5T A;  1F66 D;  5B32 A;  4YS3 B;  3W97 C;  3MGR A;  5B24 D;  3AZK C;  5B1L A;  4KUD B;  3B6F C;  1P3M A;  5E5A A;  5B2I A;  5GT0 D;  3W96 B;  3AZE C;  1P3B D;  1M19 B;  3C1B B;  5AVC B;  4WNN A;  1ZLA B;  5B1M D;  5BS7 C;  3AZM A;  4YM6 D;  3AZF C;  3B6G D;  3A6N C;  1P3P B;  3UT9 A;  5AY8 D;  3AZH C;  5GT3 D;  4XUJ C;  3NQJ B;  3V9R A;  4KGC B;  3NQU B;  1AOI C;  1KX4 B;  3R45 A;  1S32 B;  3AV1 D;  1H3O B;  4J8X D;  4XZQ A;  1P3G C;  5DNM B;  4G92 C;  3REL C;  2FJ7 D;  5B31 B;  4H9S C;  3UTA D;  5B33 A;  5CPK A;  4WU9 D;  5B0Y A;  4LD9 A;  1JFI B;  3VH5 T;  3O62 D;  1TZY C;  3AYW B;  3LJA D;  4R8P A;  3W98 D;  3AZN B;  1M18 A;  2PYO C;  3REI C;  1P3O D;  2ARO B;  5KDM B;  1M1A C;  3LZ0 C;  4G91 C;  4J8U B;  3X1T D;  1P34 D;  2CWE A;  3LZ1 C;  3AN2 C;  4YS3 A;  1EQZ A;  3REJ C;  4Z66 B;  2LY8 A;  1P3L D;  3X1S A;  3MGS D;  4KUD A;  3KXB C;  5AV5 C;  3MGP D;  5CPJ C;  1BH8 B;  3WTP C;  5B31 G;  3MGQ A;  4WU8 D;  3W97 B;  3WA9 C;  5AV8 B;  1M19 A;  3C1B A;  5BT1 C;  5AVC A;  3B6F B;  1ZLA A;  4Z2M G;  4X23 D;  4J8V A;  2CV5 C;  4AWL C;  3WAA D;  1HQ3 D;  5BO0 B;  5B40 A;  3AZE B;  5GXQ C;  1KX5 B;  3VH5 A;  5DNN B;  2F8N H;  4KGC A;  3NQU A;  3LEL C;  1KX4 A;  1S32 A;  1H3O A;  3A6N B;  5B0Z B; 
#chains in the Genus database with same CATH topology
 5JRG D;  3AZH B;  4XUJ B;  1W2E A;  3AZI C;  3X1U A;  2NZD B;  3AZJ D;  4KHA B;  4DQY B;  5CPI D;  4H9O B;  1P3G B;  1JFI A;  5GSU C;  1KX3 A;  4H9Q B;  3AYW A;  4G92 B;  1ID3 B;  5FUG B;  3REL B;  3AZN A;  2ARO A;  5KDM A;  4J8U A;  3UTB D;  4J8W B;  2HIO C;  2PYO B;  1M1A B;  4CAY B;  3W96 C;  5B24 C;  5BNX B;  3LZ0 B;  3TU4 D;  4JJN D;  2Y2N A;  3IP4 C;  1U35 C;  3MVD B;  5AVB B;  1BH8 A;  3REK B;  2ZY4 A;  5GT0 C;  1P3P C;  5CHL B;  3AZK A;  3KXB B;  3B6F A;  1BH9 B;  5AV6 D;  4WZS B;  4YM6 C;  2F8N B;  5BO0 A;  5AY8 C;  3WA9 B;  3MNN C;  3AZE A;  5DNM C;  5BS7 A;  5B31 C;  5B2I D;  3AV1 C;  3WKJ D;  3AZF A;  4AWL B;  2CV5 B;  3A6N A;  4J8X C;  4UUZ A;  5GXQ B;  1P3F D;  3AZM D;  4XUJ A;  2BYM B;  4QLC B;  1AOI A;  3AZL D;  3LEL B;  4KHA A;  3UTA C;  2FJ7 C;  5F99 D;  1KU5 A;  4E44 A;  1U35 B;  4H9O A;  4H9N B;  1P3G A;  4H9Q A;  3W98 C;  5FUG A;  3REL A;  2F8N G;  4H9S A;  4Z66 C;  4XZQ D;  4ZUX B;  5GSU B;  1TZY A;  1A7W A;  3W99 D;  5B33 D;  1P34 C;  2ZM5 A;  2PYO A;  3REI A;  1M1A A;  5B0Y D;  5CP6 C;  4LD9 D;  4CAY A;  5JA4 B;  5BNX A;  5AV8 C;  3LZ0 A;  3MGP C;  1F66 B;  2HIO B;  4WU8 C;  3LZ1 A;  3AN2 A;  2DQN C;  5B24 B;  3REJ A;  1KX5 C;  5DNN C;  3KXB A;  5AV5 A;  5CPJ A;  4X23 C;  1EQZ D;  3WTP A;  2F8N A;  2Y2P A;  3VH6 W;  5GT0 B;  5B0Z C;  3X1S D;  1P3B B;  3WA9 A;  3X1V D;  2NZD C;  5B1M B;  3MGQ D;  2YFW B;  2Y2G A;  4YM6 B;  3B6G B;  5G49 B;  2CV5 A;  5JRG C;  5AY8 B;  3MNN B;  5GXQ A;  3AFA D;  4J8V D;  1ID3 C;  3AZG D;  2BYM A;  3LEL A;  1B6W A;  5C3I C;  2DF4 C;  3AV1 B;  5B40 D;  1Q9C A;  3B0D C;  3KSY A;  2ZY3 A;  4J8X B;  1U35 A;  1P3K C;  4EO5 C;  4CSR A;  3AZI A;  4J8W C;  2FJ7 B;  3UTA B;  2Y2H A;  4WU9 B;  3X1U D;  3O62 B;  5GSU A;  3MVD C;  5AVB C;  5BNV B;  3REK C;  3W98 B;  1P3O B;  5JA4 A;  1KX3 D;  2G5I C;  3X1T B;  4JJN C;  1P34 B;  2HIO A;  5CP6 B;  3W96 A;  5B24 A;  1P3L B;  2ZY5 A;  3MGS B;  3REH D;  3MGP B;  2NQB D;  5AV6 C;  3C1C C;  1N1J B;  4WU8 B;  5GT0 A;  1P3P A;  3B0B A;  3AV2 D;  3NQJ A;  4QLC C;  4X23 B;  1HTA A;  4YM6 A;  3WKJ C;  3WAA B;  5G49 A;  3EPJ A;  3AZK D;  1HQ3 B;  2W8S A;  5AY8 A;  3MNN A;  5DNM A;  1P3F C;  3AZL C;  5B31 A;  3AZF B;  3AV1 A;  5F99 C;  3B0C W;  4ZUX C;  5JRG B;  4J8X A;  5AV9 D;  3AZJ B;  5C3I B;  2FJ7 A;  3UTA A;  3A6N D;  4DRA A;  3B0D B;  4DRB A;  4XUJ D;  1P3K B;  4EO5 B;  3F6T A;  1AOI D;  1PZR A;  3KWQ D;  3W99 C;  1F66 C;  3W98 A;  4Z66 A;  3H0R C;  3EPK A;  2JCH A;  1P3A D;  1P3I D;  3UTB B;  4NFT A;  3VH6 T;  1P34 A;  3W97 A;  5B2J D;  5CP6 A;  1P3B C;  5AV8 A;  4Z5T D;  1TZY D;  3KUY D;  3TU4 B;  5B1M C;  5B32 D;  3MGP A;  4JJN B;  3REI D;  3MGR D;  2YFV B;  3B6G C;  4WU8 A;  2Y2L A;  5B1L D;  2Y2Q A;  1KX5 A;  5GT3 C;  4H9P B;  3X1V C;  5DNN A;  1P3M D;  5E5A D;  5AV6 B;  3LZ1 D;  4X23 A;  3AN2 D;  3C1C B;  3REJ D;  2RIQ A;  5B0Z A;  3AZH A;  3AFA C;  5AV5 D;  5CPJ D;  2F8N K;  2NZD A;  3AZG C;  3WTP D;  2L5A A;  2F8N D;  2Y2M A;  5B2I B;  3UT9 D;  3WKJ B;  4WU9 C;  1ULY A;  5BT1 D;  5JRG A;  3O62 C;  2JE5 A;  1P3F B;  3AZM B;  3LJA C;  1ID3 A;  3VH6 A;  3AZL B;  1P3O C;  2CV5 D;  5F99 B;  3X1T C;  1P3K A;  2RVQ D;  2IO5 B;  5CPK D;  4J8W A;  4NE5 A;  1P3L C;  4XZQ B;  3MGS C;  4UPK A;  4R8P D;  3AZI D;  1M18 D;  3W99 B;  3MVD A;  5AVB A;  3REK A;  1TAF B;  5B33 B;  4ZBJ C;  4LD9 B;  3REH C;  2HUE C;  1BH9 A;  4JJN A;  2NQB C;  4YS3 D;  3A1K A;  3WAA C;  1HQ3 C;  3A1I A;  4KUD D;  1WWI A;  4H9P A;  3AV2 C;  2HIO D;  5AV6 A;  3B0C T;  1EQZ B;  3C1C A;  3W96 D;  1M19 D;  3C1B D;  3X1S B;  5AVC D;  1ZLA D;  5GT3 B;  3X1V B;  3AZJ C;  4QLC A;  3MGQ B;  1P3P D;  5CPI C;  3WKJ A;  4H9N A;  3AFA B;  5AV9 C;  4KGC D;  1P3F A;  1KX4 D;  1S32 D;  4J8V B;  3AZG B;  1WWS A;  3AZL A;  5B40 B;  5F99 A;  3MNN D;  5DNM D;  4ZUX A;  3UTB C;  3LJA B;  5B31 D;  3KWQ C;  3TU4 C;  3AYW D;  1P3A C;  3X1U B;  1P3I C;  3AZN D;  2ARO D;  3W99 A;  1F66 A;  1TAF A;  5B2J C;  4J8U D;  3KUY C;  4Z5T C;  1KX3 B;  4HGA C;  5B32 C;  3MGR C;  2VQR A;  4ZBJ B;  4Z66 D;  5B1L C;  1P3B A;  3REH B;  2HUE B;  3H0L C;  5B1M A;  1P3M C;  5E5A C;  2YFW A;  5B2I C;  3W97 D;  2NQB B;  5CP6 D;  3B6G A;  5AV8 D;  4H9R B;  3B6F D;  5GT3 A;  3AZM C;  3AV2 B;  3X1V A;  2Y2J A;  3UT9 C;  1KX5 D;  3AZE D;  3AZK B;  3FDD A;  5DNN D;  3AFA A;  2IO5 C;  2ZY2 A;  3AZG A;  3AZF D;  5B0Z D;  2UWX A;  4XZQ C;  3AZH D;  5CPI B;  3EG5 B;  4WU9 A;  5AV9 B;  4NE6 A;  3O62 A;  2RVQ C;  2NZD D;  3LJA A;  5BNV A;  5B33 C;  5CPK C;  1P3O A;  5B0Y C;  3KFU G;  4LD9 C;  4UUZ B;  1P3G D;  3X1T A;  4R8P C;  1ID3 D;  1AOI B;  3REL D;  1M18 C;  3KWQ B;  2BYK B;  1P3K D;  1P3L A;  2FFF B;  3MGS A;  2Y2I A;  1P3A B;  4J8W D;  1P3I B;  2PYO D;  4YS3 C;  1M1A D;  1EQZ C;  1N1J A;  3LZ0 D;  5B2J B;  4WV4 B;  3X1S C;  4KUD C;  3KUY B;  4Z5T B;  1TZY B;  3H0M C;  1T3U A;  4HGA B;  3MVD D;  3VH5 W;  5AVB D;  3REH A;  3REK D;  5B32 B;  3MGQ C;  2NQB A;  3REI B;  3MGR B;  1B67 A;  3WAA A;  4G91 B;  5B1L B;  1M19 C;  3C1B C;  1HQ3 A;  5AVC C;  1F1E A;  4H9R A;  3KXB D;  1ZLA C;  3AV2 A;  4E45 A;  4J8V C;  1P3M B;  5E5A B;  3LZ1 B;  3AN2 B;  3REJ B;  5B40 C;  3WA9 D;  4WNN B;  5AV5 B;  5CPJ B;  4KGC C;  1KX4 C;  1S32 C;  4NE3 A;  3C1C D;  3WTP B;  3AZJ A;  3UT9 B;  5GXQ D;  5CPI A;  3V9R B;  3X1U C;  5AV9 A;  4QLC D;  3R45 B;  3LEL D;  5B32 G;  2JSS A;  1U35 D;  4WJ3 C;  4M6B A;  3EPL A;  1KX3 C;  3AYW C;  1R4V A;  3AZN C;  3UTB A;  1BFM A;  2BG1 A;  2ARO C;  3KWQ A;  5CPK B;  5B0Y B;  4ZUX D;  4J8U C;  2BYK A;  5GSU D;  3TU4 A;  4CSR B;  3AZI B;  4R8P B;  1P3A A;  1P3I A;  1M18 B;  3WTP E;  2YFV A;  4Z2M H;  5B2J A;  3KUY A;  4Z5T A;  1F66 D;  5B32 A;  4YS3 B;  3W97 C;  3MGR A;  5B24 D;  3AZK C;  5B1L A;  4KUD B;  3B6F C;  3P5J B;  1P3M A;  5E5A A;  5B2I A;  5GT0 D;  3W96 B;  2F2A C;  3AZE C;  2J8P A;  2Y2K A;  1P3B D;  3C1B B;  1M19 B;  5AVC B;  3EPH A;  4WNN A;  1ZLA B;  5B1M D;  5BS7 C;  3AZM A;  4YM6 D;  3AZF C;  3B6G D;  3A6N C;  1P3P B;  3UT9 A;  5AY8 D;  3AZH C;  5GT3 D;  4XUJ C;  3NQJ B;  3V9R A;  4KGC B;  3NQU B;  1AOI C;  1KX4 B;  3R45 A;  1S32 B;  3AV1 D;  1H3O B;  4J8X D;  4XZQ A;  1P3G C;  5DNM B;  3AL0 C;  4G92 C;  3REL C;  2FJ7 D;  5B31 B;  4H9S C;  3UTA D;  5B33 A;  5CPK A;  4WU9 D;  5B0Y A;  4LD9 A;  1JFI B;  3VH5 T;  3O62 D;  1TZY C;  2XD1 A;  3AYW B;  3LJA D;  4R8P A;  3W98 D;  3AZN B;  1M18 A;  2PYO C;  3REI C;  1P3O D;  2ARO B;  5KDM B;  1M1A C;  3LZ0 C;  4G91 C;  4J8U B;  3X1T D;  2Y2O A;  1P34 D;  2CWE A;  3LZ1 C;  3AN2 C;  4YS3 A;  1EQZ A;  3REJ C;  4Z66 B;  2LY8 A;  1P3L D;  3X1S A;  3MGS D;  4KUD A;  3KXB C;  5AV5 C;  3MGP D;  5CPJ C;  1BH8 B;  3WTP C;  5B31 G;  3MGQ A;  4WU8 D;  3W97 B;  3WA9 C;  5AV8 B;  1M19 A;  3C1B A;  5BT1 C;  5AVC A;  3B6F B;  1ZLA A;  1Z2C B;  4Z2M G;  4X23 D;  4J8V A;  2XD5 A;  2CV5 C;  4AWL C;  3WAA D;  1HQ3 D;  5BO0 B;  5B40 A;  3AZE B;  5GXQ C;  1KX5 B;  3VH5 A;  5DNN B;  2F8N H;  4KGC A;  3NQU A;  3LEL C;  1KX4 A;  1S32 A;  2G5H C;  1H3O A;  3A6N B;  5B0Z B; 
#chains in the Genus database with same CATH homology
 5JRG D;  3AZH B;  4XUJ B;  1W2E A;  3AZI C;  3X1U A;  2NZD B;  3AZJ D;  4KHA B;  4DQY B;  5CPI D;  4H9O B;  1P3G B;  1JFI A;  5GSU C;  1KX3 A;  4H9Q B;  3AYW A;  4G92 B;  1ID3 B;  5FUG B;  3REL B;  3AZN A;  2ARO A;  5KDM A;  4J8U A;  3UTB D;  4J8W B;  2HIO C;  2PYO B;  1M1A B;  4CAY B;  3W96 C;  5B24 C;  5BNX B;  3LZ0 B;  3TU4 D;  4JJN D;  2Y2N A;  3IP4 C;  1U35 C;  3MVD B;  5AVB B;  1BH8 A;  3REK B;  2ZY4 A;  5GT0 C;  1P3P C;  5CHL B;  3AZK A;  3KXB B;  3B6F A;  1BH9 B;  5AV6 D;  4WZS B;  4YM6 C;  2F8N B;  5BO0 A;  5AY8 C;  3WA9 B;  3MNN C;  3AZE A;  5DNM C;  5BS7 A;  5B31 C;  5B2I D;  3AV1 C;  3WKJ D;  3AZF A;  4AWL B;  2CV5 B;  3A6N A;  4J8X C;  4UUZ A;  5GXQ B;  1P3F D;  3AZM D;  4XUJ A;  2BYM B;  4QLC B;  1AOI A;  3AZL D;  3LEL B;  4KHA A;  3UTA C;  2FJ7 C;  5F99 D;  1KU5 A;  4E44 A;  1U35 B;  4H9O A;  4H9N B;  1P3G A;  4H9Q A;  3W98 C;  5FUG A;  3REL A;  2F8N G;  4H9S A;  4Z66 C;  4XZQ D;  4ZUX B;  5GSU B;  1TZY A;  1A7W A;  3W99 D;  5B33 D;  1P34 C;  2ZM5 A;  2PYO A;  3REI A;  1M1A A;  5B0Y D;  5CP6 C;  4LD9 D;  4CAY A;  5JA4 B;  5BNX A;  5AV8 C;  3LZ0 A;  3MGP C;  1F66 B;  2HIO B;  4WU8 C;  3LZ1 A;  3AN2 A;  2DQN C;  5B24 B;  3REJ A;  1KX5 C;  5DNN C;  3KXB A;  5AV5 A;  5CPJ A;  4X23 C;  1EQZ D;  3WTP A;  2F8N A;  2Y2P A;  3VH6 W;  5GT0 B;  5B0Z C;  3X1S D;  1P3B B;  3WA9 A;  3X1V D;  2NZD C;  5B1M B;  3MGQ D;  2YFW B;  2Y2G A;  4YM6 B;  3B6G B;  5G49 B;  2CV5 A;  5JRG C;  5AY8 B;  3MNN B;  5GXQ A;  3AFA D;  4J8V D;  1ID3 C;  3AZG D;  2BYM A;  3LEL A;  1B6W A;  5C3I C;  2DF4 C;  3AV1 B;  5B40 D;  1Q9C A;  3B0D C;  3KSY A;  2ZY3 A;  4J8X B;  1U35 A;  1P3K C;  4EO5 C;  4CSR A;  3AZI A;  4J8W C;  2FJ7 B;  3UTA B;  2Y2H A;  4WU9 B;  3X1U D;  3O62 B;  5GSU A;  3MVD C;  5AVB C;  5BNV B;  3REK C;  3W98 B;  1P3O B;  5JA4 A;  1KX3 D;  2G5I C;  3X1T B;  4JJN C;  1P34 B;  2HIO A;  5CP6 B;  3W96 A;  5B24 A;  1P3L B;  2ZY5 A;  3MGS B;  3REH D;  3MGP B;  2NQB D;  5AV6 C;  3C1C C;  1N1J B;  4WU8 B;  5GT0 A;  1P3P A;  3B0B A;  3AV2 D;  3NQJ A;  4QLC C;  4X23 B;  1HTA A;  4YM6 A;  3WKJ C;  3WAA B;  5G49 A;  3EPJ A;  3AZK D;  1HQ3 B;  2W8S A;  5AY8 A;  3MNN A;  5DNM A;  1P3F C;  3AZL C;  5B31 A;  3AZF B;  3AV1 A;  5F99 C;  3B0C W;  4ZUX C;  5JRG B;  4J8X A;  5AV9 D;  3AZJ B;  5C3I B;  2FJ7 A;  3UTA A;  3A6N D;  4DRA A;  3B0D B;  4DRB A;  4XUJ D;  1P3K B;  4EO5 B;  3F6T A;  1AOI D;  1PZR A;  3KWQ D;  3W99 C;  1F66 C;  3W98 A;  4Z66 A;  3H0R C;  3EPK A;  2JCH A;  1P3A D;  1P3I D;  3UTB B;  4NFT A;  3VH6 T;  1P34 A;  3W97 A;  5B2J D;  5CP6 A;  1P3B C;  5AV8 A;  4Z5T D;  1TZY D;  3KUY D;  3TU4 B;  5B1M C;  5B32 D;  3MGP A;  4JJN B;  3REI D;  3MGR D;  2YFV B;  3B6G C;  4WU8 A;  2Y2L A;  5B1L D;  2Y2Q A;  1KX5 A;  5GT3 C;  4H9P B;  3X1V C;  5DNN A;  1P3M D;  5E5A D;  5AV6 B;  3LZ1 D;  4X23 A;  3AN2 D;  3C1C B;  3REJ D;  2RIQ A;  5B0Z A;  3AZH A;  3AFA C;  5AV5 D;  5CPJ D;  2F8N K;  2NZD A;  3AZG C;  3WTP D;  2L5A A;  2F8N D;  2Y2M A;  5B2I B;  3UT9 D;  3WKJ B;  4WU9 C;  1ULY A;  5BT1 D;  5JRG A;  3O62 C;  2JE5 A;  1P3F B;  3AZM B;  3LJA C;  1ID3 A;  3VH6 A;  3AZL B;  1P3O C;  2CV5 D;  5F99 B;  3X1T C;  1P3K A;  2RVQ D;  2IO5 B;  5CPK D;  4J8W A;  4NE5 A;  1P3L C;  4XZQ B;  3MGS C;  4UPK A;  4R8P D;  3AZI D;  1M18 D;  3W99 B;  3MVD A;  5AVB A;  3REK A;  1TAF B;  5B33 B;  4ZBJ C;  4LD9 B;  3REH C;  2HUE C;  1BH9 A;  4JJN A;  2NQB C;  4YS3 D;  3A1K A;  3WAA C;  1HQ3 C;  3A1I A;  4KUD D;  1WWI A;  4H9P A;  3AV2 C;  2HIO D;  5AV6 A;  3B0C T;  1EQZ B;  3C1C A;  3W96 D;  1M19 D;  3C1B D;  3X1S B;  5AVC D;  1ZLA D;  5GT3 B;  3X1V B;  3AZJ C;  4QLC A;  3MGQ B;  1P3P D;  5CPI C;  3WKJ A;  4H9N A;  3AFA B;  5AV9 C;  4KGC D;  1P3F A;  1KX4 D;  1S32 D;  4J8V B;  3AZG B;  1WWS A;  3AZL A;  5B40 B;  5F99 A;  3MNN D;  5DNM D;  4ZUX A;  3UTB C;  3LJA B;  5B31 D;  3KWQ C;  3TU4 C;  3AYW D;  1P3A C;  3X1U B;  1P3I C;  3AZN D;  2ARO D;  3W99 A;  1F66 A;  1TAF A;  5B2J C;  4J8U D;  3KUY C;  4Z5T C;  1KX3 B;  4HGA C;  5B32 C;  3MGR C;  2VQR A;  4ZBJ B;  4Z66 D;  5B1L C;  1P3B A;  3REH B;  2HUE B;  3H0L C;  5B1M A;  1P3M C;  5E5A C;  2YFW A;  5B2I C;  3W97 D;  2NQB B;  5CP6 D;  3B6G A;  5AV8 D;  4H9R B;  3B6F D;  5GT3 A;  3AZM C;  3AV2 B;  3X1V A;  2Y2J A;  3UT9 C;  1KX5 D;  3AZE D;  3AZK B;  3FDD A;  5DNN D;  3AFA A;  2IO5 C;  2ZY2 A;  3AZG A;  3AZF D;  5B0Z D;  2UWX A;  4XZQ C;  3AZH D;  5CPI B;  3EG5 B;  4WU9 A;  5AV9 B;  4NE6 A;  3O62 A;  2RVQ C;  2NZD D;  3LJA A;  5BNV A;  5B33 C;  5CPK C;  1P3O A;  5B0Y C;  3KFU G;  4LD9 C;  4UUZ B;  1P3G D;  3X1T A;  4R8P C;  1ID3 D;  1AOI B;  3REL D;  1M18 C;  3KWQ B;  2BYK B;  1P3K D;  1P3L A;  2FFF B;  3MGS A;  2Y2I A;  1P3A B;  4J8W D;  1P3I B;  2PYO D;  4YS3 C;  1M1A D;  1EQZ C;  1N1J A;  3LZ0 D;  5B2J B;  4WV4 B;  3X1S C;  4KUD C;  3KUY B;  4Z5T B;  1TZY B;  3H0M C;  1T3U A;  4HGA B;  3MVD D;  3VH5 W;  5AVB D;  3REH A;  3REK D;  5B32 B;  3MGQ C;  2NQB A;  3REI B;  3MGR B;  1B67 A;  3WAA A;  4G91 B;  5B1L B;  1M19 C;  3C1B C;  1HQ3 A;  5AVC C;  1F1E A;  4H9R A;  3KXB D;  1ZLA C;  3AV2 A;  4E45 A;  4J8V C;  1P3M B;  5E5A B;  3LZ1 B;  3AN2 B;  3REJ B;  5B40 C;  3WA9 D;  4WNN B;  5AV5 B;  5CPJ B;  4KGC C;  1KX4 C;  1S32 C;  4NE3 A;  3C1C D;  3WTP B;  3AZJ A;  3UT9 B;  5GXQ D;  5CPI A;  3V9R B;  3X1U C;  5AV9 A;  4QLC D;  3R45 B;  3LEL D;  5B32 G;  2JSS A;  1U35 D;  4WJ3 C;  4M6B A;  3EPL A;  1KX3 C;  3AYW C;  1R4V A;  3AZN C;  3UTB A;  1BFM A;  2BG1 A;  2ARO C;  3KWQ A;  5CPK B;  5B0Y B;  4ZUX D;  4J8U C;  2BYK A;  5GSU D;  3TU4 A;  4CSR B;  3AZI B;  4R8P B;  1P3A A;  1P3I A;  1M18 B;  3WTP E;  2YFV A;  4Z2M H;  5B2J A;  3KUY A;  4Z5T A;  1F66 D;  5B32 A;  4YS3 B;  3W97 C;  3MGR A;  5B24 D;  3AZK C;  5B1L A;  4KUD B;  3B6F C;  3P5J B;  1P3M A;  5E5A A;  5B2I A;  5GT0 D;  3W96 B;  2F2A C;  3AZE C;  2J8P A;  2Y2K A;  1P3B D;  3C1B B;  1M19 B;  5AVC B;  3EPH A;  4WNN A;  1ZLA B;  5B1M D;  5BS7 C;  3AZM A;  4YM6 D;  3AZF C;  3B6G D;  3A6N C;  1P3P B;  3UT9 A;  5AY8 D;  3AZH C;  5GT3 D;  4XUJ C;  3NQJ B;  3V9R A;  4KGC B;  3NQU B;  1AOI C;  1KX4 B;  3R45 A;  1S32 B;  3AV1 D;  1H3O B;  4J8X D;  4XZQ A;  1P3G C;  5DNM B;  3AL0 C;  4G92 C;  3REL C;  2FJ7 D;  5B31 B;  4H9S C;  3UTA D;  5B33 A;  5CPK A;  4WU9 D;  5B0Y A;  4LD9 A;  1JFI B;  3VH5 T;  3O62 D;  1TZY C;  2XD1 A;  3AYW B;  3LJA D;  4R8P A;  3W98 D;  3AZN B;  1M18 A;  2PYO C;  3REI C;  1P3O D;  2ARO B;  5KDM B;  1M1A C;  3LZ0 C;  4G91 C;  4J8U B;  3X1T D;  2Y2O A;  1P34 D;  2CWE A;  3LZ1 C;  3AN2 C;  4YS3 A;  1EQZ A;  3REJ C;  4Z66 B;  2LY8 A;  1P3L D;  3X1S A;  3MGS D;  4KUD A;  3KXB C;  5AV5 C;  3MGP D;  5CPJ C;  1BH8 B;  3WTP C;  5B31 G;  3MGQ A;  4WU8 D;  3W97 B;  3WA9 C;  5AV8 B;  1M19 A;  3C1B A;  5BT1 C;  5AVC A;  3B6F B;  1ZLA A;  1Z2C B;  4Z2M G;  4X23 D;  4J8V A;  2XD5 A;  2CV5 C;  4AWL C;  3WAA D;  1HQ3 D;  5BO0 B;  5B40 A;  3AZE B;  5GXQ C;  1KX5 B;  3VH5 A;  5DNN B;  2F8N H;  4KGC A;  3NQU A;  3LEL C;  1KX4 A;  1S32 A;  2G5H C;  1H3O A;  3A6N B;  5B0Z B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...