1HU3A

Middle domain of human eif4gii
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
243
structure length
204
Chain Sequence
SDPENIKTQELFRKVRSILNKLTPQMFNQLMKQVSGLTVDTEERLKGVIDLVFEKAIDEPSFSVAYANMCRCLVTLKVPNFRKLLLNRCQKEFEKDKAAKDKARRRSIGNIKFIGELFKLKMLTEAIMHDCVVKLLKNHDEESLECLCRLLTTIGKDLDFEKAKPRMDQYFNQMEKIVKERKTSSRIRFMLQDVIDLRLCNWVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A conserved HEAT domain within eIF4G directs assembly of the translation initiation machinery.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Translation
molecule keywords EIF4GII
total genus 60
structure length 204
sequence length 243
ec nomenclature
pdb deposition date 2001-01-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02854 MIF4G MIF4G domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.180 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1hu3A00
3RK6A 2I2OA 3EIQC 1UG3A 3D3MA 2RG8A 2IU1A 1N52A 4JHKA 4B8CB 1H6KA 1HU3A 3FEXA 3JUIA 4CRWA 1H2VC 1UW4B 2ZU6B 4GMLA 4JHJA 4B89A 1H2TC 1H2UA 4CEMA 4LUNU 1N54A 3FEYA 2IONA 4GMJA 4C9BB 2VSOE 2HM8A 4B8AA 1PAQA 2VSXE 2IOSA 2KZTA 2GGFA 2FULA 2NSZA 2KZTB 3L6AA 2IOLA 3EIJA 4IULA 4CT4A 5ANRA
chains in the Genus database with same CATH superfamily
1OCZE 3S7FA 3ZNGA 3UIPC 3DPYA 4I6JA 4I9CA 3HG0D 5ARFA 4ME2A 1K1AA 2J9QA 1JUQA 2FO7A 2OVFA 3TXMA 3AAAC 3CIAA 4P29A 5BW8C 3MGBA 2DZNA 5ANLA 1E8ZA 2WXHA 4AM9A 3ENEA 2ZXWE 3SGHA 4GYWA 1TNYA 1OCOE 2IQCA 3J5PA 1MHQA 1NA3A 2IF4A 4M7CA 3L13A 3PRZA 1KZOA 4U0UA 5E76A 2IONA 4EECA 2JLBA 3IHVA 1SA5A 3PZ3A 2F8XK 2R2LA 3D9IA 3Q49B 3L08A 2H6HA 4BETA 2WXMA 1TNBA 5LFAA 4EZKA 4HRLA 2V4LA 1ELKA 3CHOA 2AXZA 2OEWA 3UMVA 4N5CA 4GTPA 3CVVA 3FHEA 3T9KA 2YHCA 4MBGA 3FU5A 4DX2A 4JA7A 3LKUA 4YNDA 3BUAA 2M63A 3ZW3A 4JB8P 2WB2A 5AQ7A 3DXKG 1EF1C 4GZ3A 3PREA 1TNOA 1TEZA 5EKQD 4GTVA 2E0IA 2FO1E 4O60A 2QFCA 4JD2G 4G23A 2I2OA 4YVOA 4U07A 3B95A 1E8WA 3JQ0A 4G1TA 4ANWA 2GROB 4DI4A 5EIDA 2UY1A 3W9FA 2MHKA 2LSVA 4O1OA 4RG6A 1FCHA 5ANRA 2RFMA 1DCEA 2IU1A 3HDXA 3B7RL 5KJLA 2WMNA 1NA0A 4RLYA 5KJNA 1Z3XA 4LUNU 3LYAA 3EHMA 4E6HA 5EX3A 3RJVA 5FZSA 2GGFA 4K5AB 5CBOA 3E4BA 3Q75A 1H0AA 3CSTA 3QOUA 5JHBA 1TN8A 3HVEA 2EIME 1UW4B 3TWWA 4CDNA 2V5QC 1N11A 4FC8A 2XPIA 4A1GA 2WXQA 1N0QA 4UWKA 4Q96A 4CT0A 4ILHB 1MX4A 2J4DA 3C3RA 1B89A 4CDRA 1LD8A 4KVOA 3LXUX 1TJCA 4GAAA 5LCWJ 1HXIA 2ILRA 5FIOA 2ETBA 4JHKA 3CKCA 2KCLA 3ZKJA 1HE8A 4F1PA 4MS6A 3FULA 4CEMA 2YNQA 2L9BA 2WXNA 3SBSA 4G24A 2XPZA 4APFA 4UWGA 1HF8A 4IRUA 2OEVA 4PH4B 1N4QA 5BUZA 3R7RA 2UWJG 1EDUA 2AW6A 4B0ZA 3CVNA 1K8KG 4MRUA 2ONDA 3Q15A 4HLEA 5T4YA 3VTYA 3ZN3A 2JABA 1E8YA 4DX5D 3HIZA 4BSXA 4I1AA 4UQYA 2VSXE 2YINA 3CEQA 1SA4A 1OWPA 4GTRA 3PZ1A 5FWQA 2L6BA 3DSTA 5LOZA 1S0PA 2A5EA 4HB5A 2JEKA 2BEDA 3DSSA 2X6HA 4RVBA 4HOTA 2WQ6A 3G2SA 4K0RA 4JVSA 1QNFA 3QB2A 3IEGA 4UI9J 5JJ6A 2Y4UA 4IYPA 1ZU2A 2CHXA 3WG7E 3I4GA 3NOCD 5FTPA 3RSEG 1U3DA 4H7YA 2IY0C 4Q94A 2OV8A 2HYZA 2H6FA 3FU6A 2A4ZA 2A5UA 1ZBPA 2V4HC 4BWRA 1JCRA 3GYZA 3ZYQA 2X6JA 4J8EA 3TWRA 3FUNA 1OCCE 2WXLA 3UM2A 1X81A 4JEHA 1N95A 3ABLE 2R59A 5G04C 4FULA 2AVPA 1ELRA 2XHEA 1H2UA 4OVVA 2QY7A 1JCSA 3NOGD 4N5QA 2KZTB 2XS8A 3JXJA 4BT8A 1N4RA 4CCAA 2EQXA 4AV7A 1IXVA 1NZNA 2YHEA 4ATGA 1IQUA 3B7BA 4WNGA 5D0QD 3G2VA 1V54E 3Q73A 1OCRE 3PS6A 4LNUD 4U04A 4GYOA 3TWVA 3CVYA 3HXFA 3SFYA 3OXLA 2WQHA 4N39A 1TJFA 4EHMA 3D9OA 5CRUA 4XEIG 2J4BA 1N4SA 2KCKA 2PNNA 5E75A 2C2LA 3ZPJA 3EHNA 5KCMA 1WG0A 1SQMA 4EPZA 2DWZA 3ULYA 5LCWC 2WXPA 5AJDA 2VGYA 2QYJA 3FTXA 2WPVA 3HRAA 3TAXA 4HLLA 2AXUA 1X5BA 4GMRA 5AQ9A 4TV3A 2VQ2A 4U63A 4GTTA 5CERB 5KBAA 1WDYA 4A55A 3AS8A 4DI3A 3ZUVB 3FEYA 3TWXA 3SQVA 3AU5A 3E33A 3U3WA 2VGXA 4G2VA 3HXEA 4GA1A 3CK7A 2WXRA 4APOA 4Y6CA 5D66A 2WXGA 3FH5A 2GRNB 1N94A 3V31A 1BD8A 4XX5A 3CSFA 2VSYA 1O1RA 2ZIRA 3MJWA 2P9UG 5BT1A 2I6HA 4JL0A 2X6FA 1E90A 4OAVB 3CV0A 2VSNA 2DIWA 3ASOE 4UI9C 2XPYA 1VDYA 4DK5A 4ABNA 1IHGA 4J8DA 1D8EA 4HI8A 4A1SA 2ZGDA 2QZAA 2PL2A 1HX8A 3QWWA 1W3BA 3ASFA 4FLHA 3PUKA 3DXMG 4XKCA 3I5PA 2IFUA 3N71A 3CVQA 3Q47B 4L2LA 4URKA 2FF4A 3EIQC 5EN5D 3MEKA 3EUVA 2F8YA 2WXFA 1S63A 4HVBA 5G55A 2Y3AA 4ILIA 2CHWA 5FQ8A 5KJMA 4IN3B 5EDSA 2GRQB 3Q79A 3CQGB 5ITZF 4L2YA 4FJZA 3EHQA 3C72A 1LD7A 2E2EA 1Z3YA 5G05C 5C1DA 3ASDA 2RKKA 4EBAG 2MRIA 5CBNA 2VSOE 1H19A 2P9NG 3IXEA 3HXBA 3TWQA 4L1BA 3RO2A 2IEJA 2WMOA 4Y6WA 3NZUA 3FTVA 3B7SA 5ENQD 2NC9A 2B0OE 4JC8A 1AP7A 4TUUA 3BG1B 3LY7A 2CG3A 3FH8A 3JQ1A 5HS0A 3O4ZA 2GRLA 1A5EA 4WWPA 3T8MA 4I2WA 3PNTB 3ZGQA 5FQ7A 1PY1A 4TUMA 4U7EB 1O1SA 3IHYA 2XCBA 2WXIA 4HRNA 2NYJA 3SF4A 3FFLA 3HXDA 5HI7A 4FJYA 4BSZB 2ZU6B 3FUFA 1HG5A 4LERA 3LCAA 4I6EA 3PH0C 5ENRD 2GRRB 2IOSA 2ETAA 4I6GA 5AN8A 4UI9K 3CVXA 5ENSD 3ASNE 4LNBA 1UG3A 5CMWA 1BU9A 3D9JA 2BKGA 3RAUA 2VTBA 4EZLA 4L9PA 1H2TC 3D9MA 3KSQA 2WXJA 3AG2E 2J07A 3HVEB 1S70B 4MKTA 1NP7A 4E85A 3CHRA 5DIZA 1WAO1 5HRYA 3LS8A 3APCA 3SFXA 3TXNA 2KZTA 3TJPA 2Y0BG 4LCTA 4LSZE 5KNHD 5DBKA 2HR2A 2X6KA 4FHJA 1LTXA 1Q2ZA 1N52A 3RIBA 2R03A 3PUJA 4GYYA 1BPOA 4JA9A 4AY6A 4HNAD 5AIJA 4XKBA 2R05A 1HH8A 3QARA 3NAWA 2BKKB 2KM4A 4F53A 4N3CA 5EILA 3F6QA 4JHRA 1V55E 4CDMA 3DSWA 3SO8A 3PNLB 2J08A 3NZSA 3AG4E 4ANVA 3OXFA 5ARGA 1N0RA 2LXLA 1LF8A 3ZYKA 4HI9A 1O5MA 3EDTB 3FUIA 4N2SA 4GA0A 2DVWA 1FVHA 1ELWA 1RZ4A 3CVPA 1S64A 1KZPA 1H6KA 5A7DB 3CR3A 3CK9A 4XI9A 2EIKE 1QQEA 4G25A 4HXIA 5EIBE 1QBQA 1JWFA 3SFZA 3L9TA 4J6IA 3NQPA 4AOFA 3PE3A 3AG3E 1QZ2A 1U3CA 3ONKA 4HBDA 3UUXA 5HKPA 4UUCA 2VGXB 4O6FA 3AJIA 1TR4A 3T8KA 4YDYA 5JJ7A 2PM7A 3E34A 2EILE 1XNFA 2VYIA 5BV1A 5B3SE 4N3BA 4MLPA 3LVQE 5JMND 3GW4A 5AARA 5ENNA 3SHFA 4G8KA 1E7UA 3ESLA 5CMYA 2PM6A 2GRMA 1OT8A 3DWLG 2XEVA 4G26A 2XGSA 1N54A 2VJ8A 5CRVA 4TXQA 3FWVA 4DPRA 3I4RB 3ZYMA 2WXKA 4OYSA 4BY6A 3D3MA 1E8XA 3C98A 1Y6IA 3FY4A 2P9PG 5T3RA 4ANXA 3W9GA 1OWOA 3AU4A 4WWOA 4XI0A 4B94A 3U4TA 4CGWA 4YVQC 2CFUA 4KZ0A 2EIJE 3DSUA 4PDXA 1EPUA 3FTWA 3ML9A 3TGOA 3P2BA 5BXOA 3FTSA 1HZ4A 5AJLA 1IHBA 4YDWA 2P2CP 3S7DA 2KCVA 5BXUA 4AP2A 1OWLA 2FI7A 4J7WA 3T5XA 4R7LA 3OAWA 4ATZD 3U64A 2WM9A 4FLBA 4CT4A 2OVBA 4PS8A 4UWFA 4G8LA 2C0LA 4GZ5A 4GMLA 3IKOB 5AQBA 1TN7A 4CGVA 3HYMB 4WNEA 3PE4A 4L7TA 4BESA 1YYHA 4U8YD 3NBNB 3GZ1A 2MOWA 2EINE 4DRXE 1FPPA 4GCNA 1K3ZD 2AXVA 4LRZA 4JEUA 4RSYA 4CYMD 3SBTB 3G2UA 4I9EA 3CGHA 4AVXA 3E30A 4UQXA 3ZYLA 3TL5A 2HM8A 2PZIA 1NL4A 3EIJA 5BNWA 3CLJA 4J8FA 1D8DA 2ZISA 1H6OA 2Y1LE 1UOHA 4QFVA 4BFRA 3VLEA 1SVXA 3FUKA 3FH7A 1P5QA 5B1BE 2IOLA 4DUIA 5BV0A 2DYRE 2LSUA 3R9MA 5FJYA 1HO8A 3HHMA 4YDOA 1E7VA 3GZSA 2LXMA 3D9LA 4ANUA 1JWGA 2XEHA 5CECB 1ZB1A 3Q5MA 2DBAA 3FU3A 3LVRE 4ZHBA 3UKRG 4XZ4A 3CK8A 3UX4A 3UQ3A 1A17A 3V2OA 4N2QA 3PZ2A 3DBSA 3CHQA 4KXKB 4U0SA 4GPKA 4TXRA 3AS4A 3ZHEA 5KWDA 2KATA 3UM3A 2BTDA 5AAOA 2QYUA 3ZHEB 3UPVA 4HFGA 4NIKA 3ZXSA 5H7PA 4O1PA 4GZDA 4EZJA 2X3MA 1FT1A 2Q7FA 4GA2A 3PZ4A 4WAFA 5KJKA 2RG8A 5JHAA 2XZTG 4A3TA 3MYVA 3UT8A 1SW6A 3FU0A 4C0MA 4FHKA 3ASHA 3UM1A 5G04J 2PQRA 4ACKA 1OWNA 3ABME 2J09A 5FT9A 2BUGA 4EQFA 3DRAA 3B13A 3TWTA 1XGWA 3ULQA 3ONLA 4J0UA 3RU0A 3I3NA 3LJ3A 5D2MC 5G05J 3R9AB 5ENPD 2QC9A 4RG9A 1H6PA 2AWIA 5CEDB 2L0TB 3G2WA 3S2AA 1BLXB 5CCMA 3ML8A 3NF1A 3JCKC 3WXXA 4HOSA 3DPDA 4WUYA 4YDEA 4A3VA 3SZ7A 3S7JA 4HOQA 4HQDA 3SNXA 3QWPA 4M3OA 3EHRA 1KPSB 2XGOA 3UXGA 4HOUA 3UKUG 5JJTA 4BT9A 4AEZC 3D9PA 3ZVVA 2XENA 3UI2A 3FTYA 2LO6A 3UINC 2F0YA 4GU5A 4PUCA 4C9BB 3PZDA 2FBNA 4Q69A 3L6AA 1MX2A 3QWVA 3RRUA 5D0OD 3ISMC 1GW6A 1SZAA 1D9SA 3D9NA 4B93B 3MKQA 2I9CA 4FA6A 3SY2A 2IO2C 3ZRHA 1KLXA 5C2YA 1L5JA 3LY8A 3V2XA 4GZCA 3PDNA 5M72A 2LUHA 3K9IA 1EYHA 1DNPA 1PAQA 4UWHA 4V3IA 3MKRA 5T8IA 4FU3A 3ESKA 1DC2A 4F7AA 3R7QA 3ZFWA 3FUJA 3L82A 2IJGX 3PEVB 5J90A 3TG4A 2L6JA 5CCLA 1KT1A 2VTBB 1MZCA 3APFA 3QJZA 3V79K 2NXPA 4L23A 3LDZA 2CFZA 4GZ6A 2P58C 3ZXPA 4RQIA 3L54A 3OTNA 3FP3A 3U66A 3BG0B 3LPZA 5CEAA 4DLQA 5J08A 3X2QE 3IBEA 4XIFA 3MZLB 4KMOA 2OOEA 4X8QA 4B8AA 3UTMA 4DX1A 3P1UA 4F1SA 2J49A 4ZFHA 3JUEA 3JYSA 1UN8A 2H6GA 3CHPA 4LEUA 3U9WA 3LY9A 2KXPC 1N9AA 3L16A 3UT7A 2FEZA 3L22A 5FQ6A 3C5RA 4C48B 5ENTD 1INZA 2WXOA 3J5QB 2L0IA 2GW1A 2XQ0A 4C0EA 4JPSA 4I17A 5A6CA 3EU5A 4JZYA 4K5BA 4B8CB 1HU3A 3CVWA 4U95D 3UM0A 3RRNB 2KC7A 2KBXA 1MJ0A 3IV0A 2V0PA 1E96B 1YCSB 4QQIA 4WNDA 3FDHA 3C3OA 1WY6A 2X6IA 4JXTA 3NB2A 1OY3D 4GCOA 4I2ZA 4B89A 2P9IG 2BF0X 3Q4AB 4J8SA 4UQZA 2C0MA 4U96D 1MYOA 3MA5A 1Z5SC 4OAUC 3CHMA 2VGEA 1HS6A 3FUHA 5EYPF 4CRWA 2RD0A 4K03A 5HQ8A 1BI7B 3SI5A 2YQ8A 2I1JA 4I1MA 4A63B 3MKQB 4GPMA 4NQ0A 2GRPB 1IYGA 3TWSA 4J8YA 4LNGA 2P9KG 3FTUA 4WWNA 4BERA 4GMJA 2F37A 5A23A 3OXGA 4F3VA 5G2NA 4I43A 4NACA 2B6CA 1UJJA 3QNKA 3RO3A 3DEPA 4AY5A 4NRHB 4KVMA 1O1TA 4GB9A 1WM5A 1Y8MA 1RW2A 1NI1A 3QKYA 1JPLA 4AJWA 4U8HA 4CZ2D 3QAQA 2ZGGA 1G3NB 3ZIMA 3FUMA 4IULA 4HORA 3D9KA 5KNGA 2R02A 2XRYA 2XGMA 2Y4TA 4DX7D 5AYWD 1TYQG 1H2VC 4UWLA 2J8SD 1OWMA 3QDNA 4JHJA 3BQOA 2CHZA 2I1KA 4EBAA 4OVUA 1AWCB 4I1OB 3RRMB 4KT6B 4HS2A 3UIOC 3CVUA 1IQRA 4HRMB 3V30A 3CQCB 3KEAA 4XE0A 4DLOA 2HO1A 3DSXA 3SD5A 3EU9A 4KBQA 3GZ2A 3URZA 5JA4D 1N4PA 3MV2B 1KT0A 4FP7A 1TNUA 4TXPA 1QYMA 2H6IA 1OXJA 4GTQA 2DCPA 3FUEA 4TRQA 3FUDA 4GTOA 4G11A 3PEUB 3CVLA 2R17C 4F6RD 3AS5A 2WQ7A 3HXCA 1TN6A 1SZ9A 1UJKA 4Z68A 3KEZA 3PVLA 1NFIE 3QK0A 2PQNA 1YMPA 2ETCA 3MV3B 4GTSA 1OUVA 2Y69E 5LX8A 3Q9NC 2XRZA 4KYOB 2HE0A 3QC1A 1MQSA 4GTMA 3JUIA 2RFAA 3TWUA 2X38A 1K1BA 5FZQA 3LEWA 1UN9A 3Q7AA 2AJAA 2P9SG 2CG2A 1TNZA 5EYLA 5BPPA 3O48A 3BEEA 2NSZA 3KSLA 2R5SA 3C3QA 4WNFA 4BTBA 3MX3A 3RK6A 3ULEG 4PS3A 3E37A 4N3AA 1HFAA 1DCQA 4K5CA 3ASGA 5B1AE 2P9LG 3KAEA 3MCXA 2IO3C 1JCQA 2XEEA 4BTAA 4DJAA 3ZEFA 5IY5E 5FINA 1FT2A 3UT4A 3VLFA 5LP0A 5AQAA 2XZDG 3FEXA 1FVFA 3RKVA 2MYOA 3TG5A 3S7BA 3DEOA 1Z6TA 5FQ4A 1BI8B 3CHSA 2FULA 3B7UX 1HG2A 3T5VA 2LNIA 4D10C 1U2VG 1PC2A 2DZOA 4DX6D 4U8VD 3CKBA 2OCCE 5AENA 3Q7FA 4U0ZA 4AXHA 4AIFA 2LAIA 3EJNA 2DYSE 4KZCA 3VLDA 4JW1A 2XCCA 3AG1E 5ENOD 3D9HA 5FZRA 1MX6A 2LAHA 3ABKE 4H7XA 1IKND 4BX9A 2UY1B 1YA0A 3Q78A 3E32A 3APDA 4PS7A 1DVPA 3DSVA 5CHEE 4FADA 3LJNA 3G2TA 3JXIA 3KS2A 4ACLA 4ILGA 4LG6A 3L17A 3ZU7B 3VTXA 3BU8A 3Q9UC 3KD7A 2XS1A 4NURA 2V5FA 4BX8A 3FTZA 2V8SE 4BEPA 4W9RA 2WVIA 5EX0A 3B7TA
chains in the Genus database with same CATH topology
5ENNA 5KCMA 3CHPA 3S7FA 3SHFA 4LEUA 3U9WA 1SQMA 1E7UA 3ESLA 3LY9A 4I6JA 4I9CA 5ARFA 4EPZA 3L16A 4ME2A 5CMYA 2PM6A 2GRMA 2J9QA 1JUQA 5LCWC 2FO7A 2OVFA 2XEVA 4G26A 3TXMA 3UT7A 2XGSA 1N54A 2FEZA 2WXPA 3CIAA 5AJDA 2VJ8A 4P29A 3L22A 5BW8C 5FQ6A 2VGYA 3MGBA 1INZA 3FTXA 5ANLA 2WXOA 2WPVA 3FWVA 1E8ZA 3TAXA 4DPRA 2L0IA 2GW1A 3I4RB 2WXHA 4AM9A 2XQ0A 3ENEA 4C0EA 4JPSA 4I17A 3ZYMA 2WXKA 4OYSA 4BY6A 3D3MA 5A6CA 2AXUA 1X5BA 1E8XA 3SGHA 4TV3A 2VQ2A 4GYWA 4JZYA 4U63A 3C98A 1Y6IA 3FY4A 5T3RA 4B8CB 4ANXA 1OWOA 1HU3A 3AU4A 3CVWA 3JYSA 4WWOA 4XI0A 2IQCA 3RRNB 4B94A 4A55A 2KC7A 3AS8A 1MHQA 1NA3A 2IF4A 5E76A 3L13A 3PRZA 4U0UA 4YVQC 3U4TA 4CGWA 3IV0A 4DI3A 2CFUA 3FEYA 2IONA 4KZ0A 4EECA 4PDXA 2V0PA 1EPUA 3FTWA 3ML9A 2JLBA 3AU5A 3TGOA 3P2BA 3IHVA 1E96B 3FTSA 3U3WA 1HZ4A 2VGXA 4G2VA 4WNDA 4GA1A 3CK7A 2WXRA 3D9IA 3FDHA 4APOA 5AJLA 1WY6A 3Q49B 3L08A 4Y6CA 2X6IA 2WXMA 4JXTA 3S7DA 4GCOA 2KCVA 2WXGA 5LFAA 3FH5A 4I2ZA 4AP2A 4B89A 4EZKA 1OWLA 2BF0X 3Q4AB 4J8SA 2FI7A 4UQZA 2C0MA 4XX5A 2V4LA 1ELKA 3CHOA 3T5XA 3MA5A 2AXZA 3OAWA 4R7LA 3CSFA 3CHMA 3U64A 4N5CA 2WM9A 4FLBA 3UMVA 4CT4A 2OVBA 3CVVA 3FHEA 4PS8A 2VSYA 2YHCA 4UWFA 3FU5A 3MJWA 3LKUA 4JA7A 1HS6A 4YNDA 3FUHA 5BT1A 2M63A 3ZW3A 2I6HA 2C0LA 4JL0A 4CRWA 2WB2A 2X6FA 4GZ5A 4GMLA 1E90A 3IKOB 2RD0A 1EF1C 4K03A 4GZ3A 4CGVA 5HQ8A 3CV0A 2VSNA 3SI5A 2DIWA 3HYMB 4WNEA 3PE4A 3PREA 2YQ8A 4L7TA 4UI9C 5EKQD 1TEZA 2I1JA 4I1MA 2E0IA 2XPYA 3MKQB 1VDYA 2QFCA 4DK5A 3GZ1A 4ABNA 2MOWA 1IHGA 4NQ0A 4GCNA 1IYGA 4J8DA 2AXVA 4G23A 4JEUA 4LRZA 2I2OA 4RSYA 4A1SA 2PL2A 3SBTB 3G2UA 4I9EA 1HX8A 3CGHA 4YVOA 4U07A 4AVXA 3QWWA 3FTUA 4UQXA 3ZYLA 1W3BA 3ASFA 1E8WA 4FLHA 4WWNA 3JQ0A 4G1TA 3PUKA 3TL5A 4GMJA 4ANWA 2HM8A 4DI4A 5A23A 2UY1A 2PZIA 4XKCA 3I5PA 2IFUA 3N71A 2MHKA 2LSVA 3OXGA 3CVQA 3EIJA 4F3VA 3Q47B 5BNWA 4RG6A 5G2NA 4L2LA 1FCHA 3CLJA 4I43A 5ANRA 4J8FA 4URKA 2FF4A 3EIQC 4NACA 3MEKA 2IU1A 3HDXA 1UJJA 3B7RL 5KJLA 2WMNA 1NA0A 3QNKA 2WXFA 5KJNA 3RO3A 1Z3XA 4QFVA 4HVBA 4AY5A 4NRHB 4BFRA 5G55A 4KVMA 4LUNU 3VLEA 2Y3AA 4ILIA 4GB9A 1WM5A 3FUKA 1Y8MA 3LYAA 2CHWA 3EHMA 4E6HA 5FQ8A 5EX3A 3FH7A 1P5QA 3QKYA 1JPLA 4U8HA 5FZSA 3RJVA 3QAQA 4IN3B 4AJWA 2GGFA 5EDSA 5KJMA 3ZIMA 3E4BA 3FUMA 2IOLA 5BV0A 4IULA 4HORA 3CQGB 3D9KA 2LSUA 2XRYA 4L2YA 2XGMA 2Y4TA 5FJYA 1HO8A 4FJZA 3HHMA 1H0AA 5AYWD 3CSTA 3QOUA 1E7VA 3GZSA 4ANUA 3D9LA 2E2EA 5JHBA 1JWGA 1Z3YA 5G05C 5C1DA 3HVEA 1H2VC 3ASDA 1UW4B 4UWLA 1OWMA 3QDNA 4CDNA 4JHJA 3Q5MA 2CHZA 2I1KA 4EBAA 4OVUA 4EBAG 2MRIA 2DBAA 3FU3A 2VSOE 4FC8A 1H19A 4I1OB 2XPIA 3RRMB 4KT6B 4A1GA 4HS2A 4L1BA 3RO2A 3CVUA 2WMOA 3LVRE 4Y6WA 1IQRA 3NZUA 4XZ4A 3CQCB 2WXQA 3FTVA 4DLOA 4XE0A 3CK8A 3UX4A 2HO1A 4Q96A 4UWKA 4CT0A 4ILHB 3UQ3A 1A17A 3SD5A 3B7SA 4N2QA 2J4DA 3DBSA 2NC9A 4KBQA 3GZ2A 3URZA 3CHQA 1B89A 3MV2B 1KT0A 4FP7A 4KXKB 4U0SA 4JC8A 4CDRA 4GPKA 4TUUA 4KVOA 3BG1B 3AS4A 3LY7A 2CG3A 3LXUX 3FH8A 3ZHEA 3JQ1A 1TJCA 4GAAA 3O4ZA 5LCWJ 1HXIA 2ILRA 2GRLA 2DCPA 4WWPA 2KATA 4JHKA 2BTDA 3CKCA 3FUEA 4TRQA 3T8MA 2KCLA 1HE8A 3FUDA 3ZHEB 4G11A 3UPVA 3PEUB 4HFGA 3CVLA 3PNTB 4I2WA 4MS6A 2R17C 3ZGQA 3FULA 5FQ7A 1PY1A 4CEMA 3ZXSA 2YNQA 2L9BA 2WXNA 3AS5A 2XCBA 3IHYA 3SBSA 4GZDA 4EZJA 2WQ7A 4G24A 2XPZA 2X3MA 4APFA 4UWGA 1SZ9A 2Q7FA 4GA2A 2WXIA 1HF8A 4WAFA 5KJKA 4IRUA 2RG8A 1UJKA 4PH4B 5JHAA 5BUZA 3MYVA 3R7RA 4A3TA 2UWJG 1EDUA 3KEZA 2AW6A 3PVLA 3SF4A 3FFLA 3UT8A 4B0ZA 3FU0A 3CVNA 3QK0A 2PQNA 3MV3B 4MRUA 5HI7A 4FJYA 2ONDA 4C0MA 2ZU6B 3FUFA 4FHKA 1HG5A 3ASHA 3Q15A 4HLEA 5T4YA 3VTYA 4LERA 3ZN3A 1E8YA 3LCAA 3HIZA 5G04J 4BSXA 1OUVA 4I1AA 4I6EA 4UQYA 3PH0C 2VSXE 2YINA 2IOSA 2PQRA 5LX8A 3CEQA 4I6GA 2XRZA 4UI9K 3CVXA 1OWPA 4ACKA 1OWNA 5FWQA 4KYOB 5LOZA 1UG3A 2J09A 3QC1A 5CMWA 1S0PA 3D9JA 1MQSA 5FT9A 2JEKA 2VTBA 2BUGA 3JUIA 4EQFA 3B13A 4EZLA 2X38A 5FZQA 1XGWA 3LEWA 1H2TC 3D9MA 3ONLA 1UN9A 3ULQA 4J0UA 2WXJA 3RU0A 2CG2A 3I3NA 3LJ3A 2J07A 5BPPA 2X6HA 4RVBA 3O48A 3HVEB 5G05J 3BEEA 4HOTA 2NSZA 2R5SA 3R9AB 4WNFA 4BTBA 3G2SA 3MX3A 2WQ6A 4K0RA 3RK6A 4JVSA 4RG9A 2AWIA 4PS3A 4MKTA 1QNFA 3QB2A 2L0TB 1NP7A 4N3AA 3G2WA 3IEGA 3S2AA 4UI9J 1HFAA 5JJ6A 4E85A 5CCMA 2Y4UA 4IYPA 1ZU2A 2CHXA 3ML8A 3I4GA 3CHRA 3JCKC 3ASGA 3NF1A 5DIZA 1WAO1 3KAEA 3LS8A 3MCXA 3WXXA 3DPDA 4WUYA 5FTPA 4A3VA 3SZ7A 4HOSA 3S7JA 4BTAA 3APCA 4HOQA 3TXNA 1U3DA 2KZTA 3TJPA 4LCTA 4DJAA 4H7YA 3SNXA 5DBKA 3ZEFA 2X6KA 2HR2A 4FHJA 3UT4A 3VLFA 5LP0A 3QWPA 4Q94A 1N52A 2OV8A 3RIBA 4M3OA 2HYZA 3PUJA 4GYYA 1BPOA 3FEXA 2XGOA 4JA9A 3FU6A 1FVFA 4HOUA 5JJTA 3RKVA 2A4ZA 4BT9A 2A5UA 4AEZC 3D9PA 3TG5A 3ZVVA 1ZBPA 3S7BA 4AY6A 4BWRA 3GYZA 3FTYA 2LO6A 3ZYQA 4GU5A 5AIJA 2X6JA 4J8EA 4PUCA 4XKBA 4C9BB 1Z6TA 5FQ4A 3PZDA 1HH8A 3CHSA 3FUNA 3QARA 2FBNA 2KM4A 2FULA 3B7UX 4F53A 4Q69A 1HG2A 3L6AA 4N3CA 3T5VA 2LNIA 2WXLA 3QWVA 3RRUA 4JHRA 5D0OD 4CDMA 1GW6A 4JEHA 1SZAA 3PNLB 4D10C 1PC2A 3D9NA 3MKQA 2R59A 5G04C 2I9CA 2J08A 3NZSA 4FULA 3CKBA 2AVPA 4ANVA 4FA6A 3OXFA 4U0ZA 5AENA 4AXHA 3ZRHA 1KLXA 5C2YA 1ELRA 5ARGA 2XHEA 1H2UA 1L5JA 2QY7A 3LY8A 4OVVA 4GZCA 2LAIA 4AIFA 1LF8A 3PDNA 5M72A 3EJNA 4KZCA 3K9IA 1EYHA 1DNPA 3ZYKA 1PAQA 4UWHA 3VLDA 4JW1A 2XCCA 3EDTB 2KZTB 2LAHA 3FUIA 4V3IA 3MKRA 5FZRA 4N2SA 4GA0A 5T8IA 4H7XA 4FU3A 4BT8A 4BX9A 2UY1B 3ESKA 1FVHA 2EQXA 4CCAA 4AV7A 1ELWA 1YA0A 4F7AA 3R7QA 3CVPA 3ZFWA 3FUJA 1H6KA 5A7DB 3CR3A 3CK9A 3APDA 4XI9A 4PS7A 2IJGX 1NZNA 1QQEA 2YHEA 3PEVB 4ATGA 1IQUA 1DVPA 4G25A 4HXIA 5J90A 5CHEE 3TG4A 2L6JA 4FADA 5CCLA 4WNGA 1JWFA 3SFZA 1KT1A 5D0QD 3G2TA 2VTBB 4J6IA 3NQPA 4AOFA 3PE3A 3G2VA 3APFA 3QJZA 1QZ2A 3KS2A 2NXPA 4L23A 1U3CA 4ACLA 3ONKA 4ILGA 3LDZA 3PS6A 2CFZA 3UUXA 3L17A 4GZ6A 3VTXA 2P58C 3L54A 3OTNA 2VGXB 4O6FA 3FP3A 4U04A 3KD7A 3U66A 4NURA 4GYOA 3BG0B 3LPZA 4DLQA 5J08A 2PM7A 5JJ7A 3CVYA 3OXLA 2WQHA 2V5FA 4N39A 3FTZA 4BX8A 1TJFA 3IBEA 4XIFA 3MZLB 1XNFA 4KMOA 2OOEA 2V8SE 3D9OA 2VYIA 2J4BA 4B8AA 2KCKA 4W9RA 3P1UA 2WVIA 5E75A 4F1SA 5BV1A 5EX0A 2C2LA 2J49A 4MLPA 3LVQE 4N3BA 3GW4A 3ZPJA 3B7TA 3EHNA 1UN8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RK6 A;  2I2O A;  3EIQ C;  1UG3 A;  3D3M A;  2RG8 A;  2IU1 A;  1N52 A;  4JHK A;  4B8C B;  1H6K A;  1HU3 A;  3FEX A;  3JUI A;  4CRW A;  1H2V C;  1UW4 B;  2ZU6 B;  4GML A;  4JHJ A;  4B89 A;  1H2T C;  1H2U A;  4CEM A;  4LUN U;  1N54 A;  3FEY A;  2ION A;  4GMJ A;  4C9B B;  2VSO E;  2HM8 A;  4B8A A;  1PAQ A;  2VSX E;  2IOS A;  2KZT A;  2GGF A;  2FUL A;  2NSZ A;  2KZT B;  3L6A A;  2IOL A;  3EIJ A;  4IUL A;  4CT4 A;  5ANR A; 
#chains in the Genus database with same CATH topology
 1OCZ E;  3S7F A;  3ZNG A;  3UIP C;  3DPY A;  4I6J A;  4I9C A;  3HG0 D;  5ARF A;  4ME2 A;  1K1A A;  2J9Q A;  1JUQ A;  2FO7 A;  2OVF A;  3TXM A;  3AAA C;  3CIA A;  4P29 A;  5BW8 C;  3MGB A;  2DZN A;  5ANL A;  1E8Z A;  2WXH A;  4AM9 A;  3ENE A;  2ZXW E;  3SGH A;  4GYW A;  1TNY A;  1OCO E;  2IQC A;  3J5P A;  1MHQ A;  1NA3 A;  2IF4 A;  4M7C A;  3L13 A;  3PRZ A;  1KZO A;  4U0U A;  5E76 A;  2ION A;  4EEC A;  2JLB A;  3IHV A;  1SA5 A;  3PZ3 A;  2F8X K;  2R2L A;  3D9I A;  3Q49 B;  3L08 A;  2H6H A;  4BET A;  2WXM A;  1TNB A;  5LFA A;  4EZK A;  4HRL A;  2V4L A;  1ELK A;  3CHO A;  2AXZ A;  2OEW A;  3UMV A;  4N5C A;  4GTP A;  3CVV A;  3FHE A;  3T9K A;  2YHC A;  4MBG A;  3FU5 A;  4DX2 A;  4JA7 A;  3LKU A;  4YND A;  3BUA A;  2M63 A;  3ZW3 A;  4JB8 P;  2WB2 A;  5AQ7 A;  3DXK G;  1EF1 C;  4GZ3 A;  3PRE A;  1TNO A;  1TEZ A;  5EKQ D;  4GTV A;  2E0I A;  2FO1 E;  4O60 A;  2QFC A;  4JD2 G;  4G23 A;  2I2O A;  4YVO A;  4U07 A;  3B95 A;  1E8W A;  3JQ0 A;  4G1T A;  4ANW A;  2GRO B;  4DI4 A;  5EID A;  2UY1 A;  3W9F A;  2MHK A;  2LSV A;  4O1O A;  4RG6 A;  1FCH A;  5ANR A;  2RFM A;  1DCE A;  2IU1 A;  3HDX A;  3B7R L;  5KJL A;  2WMN A;  1NA0 A;  4RLY A;  5KJN A;  1Z3X A;  4LUN U;  3LYA A;  3EHM A;  4E6H A;  5EX3 A;  3RJV A;  5FZS A;  2GGF A;  4K5A B;  5CBO A;  3E4B A;  3Q75 A;  1H0A A;  3CST A;  3QOU A;  5JHB A;  1TN8 A;  3HVE A;  2EIM E;  1UW4 B;  3TWW A;  4CDN A;  2V5Q C;  1N11 A;  4FC8 A;  2XPI A;  4A1G A;  2WXQ A;  1N0Q A;  4UWK A;  4Q96 A;  4CT0 A;  4ILH B;  1MX4 A;  2J4D A;  3C3R A;  1B89 A;  4CDR A;  1LD8 A;  4KVO A;  3LXU X;  1TJC A;  4GAA A;  5LCW J;  1HXI A;  2ILR A;  5FIO A;  2ETB A;  4JHK A;  3CKC A;  2KCL A;  3ZKJ A;  1HE8 A;  4F1P A;  4MS6 A;  3FUL A;  4CEM A;  2YNQ A;  2L9B A;  2WXN A;  3SBS A;  4G24 A;  2XPZ A;  4APF A;  4UWG A;  1HF8 A;  4IRU A;  2OEV A;  4PH4 B;  1N4Q A;  5BUZ A;  3R7R A;  2UWJ G;  1EDU A;  2AW6 A;  4B0Z A;  3CVN A;  1K8K G;  4MRU A;  2OND A;  3Q15 A;  4HLE A;  5T4Y A;  3VTY A;  3ZN3 A;  2JAB A;  1E8Y A;  4DX5 D;  3HIZ A;  4BSX A;  4I1A A;  4UQY A;  2VSX E;  2YIN A;  3CEQ A;  1SA4 A;  1OWP A;  4GTR A;  3PZ1 A;  5FWQ A;  2L6B A;  3DST A;  5LOZ A;  1S0P A;  2A5E A;  4HB5 A;  2JEK A;  2BED A;  3DSS A;  2X6H A;  4RVB A;  4HOT A;  2WQ6 A;  3G2S A;  4K0R A;  4JVS A;  1QNF A;  3QB2 A;  3IEG A;  4UI9 J;  5JJ6 A;  2Y4U A;  4IYP A;  1ZU2 A;  2CHX A;  3WG7 E;  3I4G A;  3NOC D;  5FTP A;  3RSE G;  1U3D A;  4H7Y A;  2IY0 C;  4Q94 A;  2OV8 A;  2HYZ A;  2H6F A;  3FU6 A;  2A4Z A;  2A5U A;  1ZBP A;  2V4H C;  4BWR A;  1JCR A;  3GYZ A;  3ZYQ A;  2X6J A;  4J8E A;  3TWR A;  3FUN A;  1OCC E;  2WXL A;  3UM2 A;  1X81 A;  4JEH A;  1N95 A;  3ABL E;  2R59 A;  5G04 C;  4FUL A;  2AVP A;  1ELR A;  2XHE A;  1H2U A;  4OVV A;  2QY7 A;  1JCS A;  3NOG D;  4N5Q A;  2KZT B;  2XS8 A;  3JXJ A;  4BT8 A;  1N4R A;  4CCA A;  2EQX A;  4AV7 A;  1IXV A;  1NZN A;  2YHE A;  4ATG A;  1IQU A;  3B7B A;  4WNG A;  5D0Q D;  3G2V A;  1V54 E;  3Q73 A;  1OCR E;  3PS6 A;  4LNU D;  4U04 A;  4GYO A;  3TWV A;  3CVY A;  3HXF A;  3SFY A;  3OXL A;  2WQH A;  4N39 A;  1TJF A;  4EHM A;  3D9O A;  5CRU A;  4XEI G;  2J4B A;  1N4S A;  2KCK A;  2PNN A;  5E75 A;  2C2L A;  3ZPJ A;  3EHN A;  5KCM A;  1WG0 A;  1SQM A;  4EPZ A;  2DWZ A;  3ULY A;  5LCW C;  2WXP A;  5AJD A;  2VGY A;  2QYJ A;  3FTX A;  2WPV A;  3HRA A;  3TAX A;  4HLL A;  2AXU A;  1X5B A;  4GMR A;  5AQ9 A;  4TV3 A;  2VQ2 A;  4U63 A;  4GTT A;  5CER B;  5KBA A;  1WDY A;  4A55 A;  3AS8 A;  4DI3 A;  3ZUV B;  3FEY A;  3TWX A;  3SQV A;  3AU5 A;  3E33 A;  3U3W A;  2VGX A;  4G2V A;  3HXE A;  4GA1 A;  3CK7 A;  2WXR A;  4APO A;  4Y6C A;  5D66 A;  2WXG A;  3FH5 A;  2GRN B;  1N94 A;  3V31 A;  1BD8 A;  4XX5 A;  3CSF A;  2VSY A;  1O1R A;  2ZIR A;  3MJW A;  2P9U G;  5BT1 A;  2I6H A;  4JL0 A;  2X6F A;  1E90 A;  4OAV B;  3CV0 A;  2VSN A;  2DIW A;  3ASO E;  4UI9 C;  2XPY A;  1VDY A;  4DK5 A;  4ABN A;  1IHG A;  4J8D A;  1D8E A;  4HI8 A;  4A1S A;  2ZGD A;  2QZA A;  2PL2 A;  1HX8 A;  3QWW A;  1W3B A;  3ASF A;  4FLH A;  3PUK A;  3DXM G;  4XKC A;  3I5P A;  2IFU A;  3N71 A;  3CVQ A;  3Q47 B;  4L2L A;  4URK A;  2FF4 A;  3EIQ C;  5EN5 D;  3MEK A;  3EUV A;  2F8Y A;  2WXF A;  1S63 A;  4HVB A;  5G55 A;  2Y3A A;  4ILI A;  2CHW A;  5FQ8 A;  5KJM A;  4IN3 B;  5EDS A;  2GRQ B;  3Q79 A;  3CQG B;  5ITZ F;  4L2Y A;  4FJZ A;  3EHQ A;  3C72 A;  1LD7 A;  2E2E A;  1Z3Y A;  5G05 C;  5C1D A;  3ASD A;  2RKK A;  4EBA G;  2MRI A;  5CBN A;  2VSO E;  1H19 A;  2P9N G;  3IXE A;  3HXB A;  3TWQ A;  4L1B A;  3RO2 A;  2IEJ A;  2WMO A;  4Y6W A;  3NZU A;  3FTV A;  3B7S A;  5ENQ D;  2NC9 A;  2B0O E;  4JC8 A;  1AP7 A;  4TUU A;  3BG1 B;  3LY7 A;  2CG3 A;  3FH8 A;  3JQ1 A;  5HS0 A;  3O4Z A;  2GRL A;  1A5E A;  4WWP A;  3T8M A;  4I2W A;  3PNT B;  3ZGQ A;  5FQ7 A;  1PY1 A;  4TUM A;  4U7E B;  1O1S A;  3IHY A;  2XCB A;  2WXI A;  4HRN A;  2NYJ A;  3SF4 A;  3FFL A;  3HXD A;  5HI7 A;  4FJY A;  4BSZ B;  2ZU6 B;  3FUF A;  1HG5 A;  4LER A;  3LCA A;  4I6E A;  3PH0 C;  5ENR D;  2GRR B;  2IOS A;  2ETA A;  4I6G A;  5AN8 A;  4UI9 K;  3CVX A;  5ENS D;  3ASN E;  4LNB A;  1UG3 A;  5CMW A;  1BU9 A;  3D9J A;  2BKG A;  3RAU A;  2VTB A;  4EZL A;  4L9P A;  1H2T C;  3D9M A;  3KSQ A;  2WXJ A;  3AG2 E;  2J07 A;  3HVE B;  1S70 B;  4MKT A;  1NP7 A;  4E85 A;  3CHR A;  5DIZ A;  1WAO 1;  5HRY A;  3LS8 A;  3APC A;  3SFX A;  3TXN A;  2KZT A;  3TJP A;  2Y0B G;  4LCT A;  4LSZ E;  5KNH D;  5DBK A;  2HR2 A;  2X6K A;  4FHJ A;  1LTX A;  1Q2Z A;  1N52 A;  3RIB A;  2R03 A;  3PUJ A;  4GYY A;  1BPO A;  4JA9 A;  4AY6 A;  4HNA D;  5AIJ A;  4XKB A;  2R05 A;  1HH8 A;  3QAR A;  3NAW A;  2BKK B;  2KM4 A;  4F53 A;  4N3C A;  5EIL A;  3F6Q A;  4JHR A;  1V55 E;  4CDM A;  3DSW A;  3SO8 A;  3PNL B;  2J08 A;  3NZS A;  3AG4 E;  4ANV A;  3OXF A;  5ARG A;  1N0R A;  2LXL A;  1LF8 A;  3ZYK A;  4HI9 A;  1O5M A;  3EDT B;  3FUI A;  4N2S A;  4GA0 A;  2DVW A;  1FVH A;  1ELW A;  1RZ4 A;  3CVP A;  1S64 A;  1KZP A;  1H6K A;  5A7D B;  3CR3 A;  3CK9 A;  4XI9 A;  2EIK E;  1QQE A;  4G25 A;  4HXI A;  5EIB E;  1QBQ A;  1JWF A;  3SFZ A;  3L9T A;  4J6I A;  3NQP A;  4AOF A;  3PE3 A;  3AG3 E;  1QZ2 A;  1U3C A;  3ONK A;  4HBD A;  3UUX A;  5HKP A;  4UUC A;  2VGX B;  4O6F A;  3AJI A;  1TR4 A;  3T8K A;  4YDY A;  5JJ7 A;  2PM7 A;  3E34 A;  2EIL E;  1XNF A;  2VYI A;  5BV1 A;  5B3S E;  4N3B A;  4MLP A;  3LVQ E;  5JMN D;  3GW4 A;  5AAR A;  5ENN A;  3SHF A;  4G8K A;  1E7U A;  3ESL A;  5CMY A;  2PM6 A;  2GRM A;  1OT8 A;  3DWL G;  2XEV A;  4G26 A;  2XGS A;  1N54 A;  2VJ8 A;  5CRV A;  4TXQ A;  3FWV A;  4DPR A;  3I4R B;  3ZYM A;  2WXK A;  4OYS A;  4BY6 A;  3D3M A;  1E8X A;  3C98 A;  1Y6I A;  3FY4 A;  2P9P G;  5T3R A;  4ANX A;  3W9G A;  1OWO A;  3AU4 A;  4WWO A;  4XI0 A;  4B94 A;  3U4T A;  4CGW A;  4YVQ C;  2CFU A;  4KZ0 A;  2EIJ E;  3DSU A;  4PDX A;  1EPU A;  3FTW A;  3ML9 A;  3TGO A;  3P2B A;  5BXO A;  3FTS A;  1HZ4 A;  5AJL A;  1IHB A;  4YDW A;  2P2C P;  3S7D A;  2KCV A;  5BXU A;  4AP2 A;  1OWL A;  2FI7 A;  4J7W A;  3T5X A;  4R7L A;  3OAW A;  4ATZ D;  3U64 A;  2WM9 A;  4FLB A;  4CT4 A;  2OVB A;  4PS8 A;  4UWF A;  4G8L A;  2C0L A;  4GZ5 A;  4GML A;  3IKO B;  5AQB A;  1TN7 A;  4CGV A;  3HYM B;  4WNE A;  3PE4 A;  4L7T A;  4BES A;  1YYH A;  4U8Y D;  3NBN B;  3GZ1 A;  2MOW A;  2EIN E;  4DRX E;  1FPP A;  4GCN A;  1K3Z D;  2AXV A;  4LRZ A;  4JEU A;  4RSY A;  4CYM D;  3SBT B;  3G2U A;  4I9E A;  3CGH A;  4AVX A;  3E30 A;  4UQX A;  3ZYL A;  3TL5 A;  2HM8 A;  2PZI A;  1NL4 A;  3EIJ A;  5BNW A;  3CLJ A;  4J8F A;  1D8D A;  2ZIS A;  1H6O A;  2Y1L E;  1UOH A;  4QFV A;  4BFR A;  3VLE A;  1SVX A;  3FUK A;  3FH7 A;  1P5Q A;  5B1B E;  2IOL A;  4DUI A;  5BV0 A;  2DYR E;  2LSU A;  3R9M A;  5FJY A;  1HO8 A;  3HHM A;  4YDO A;  1E7V A;  3GZS A;  2LXM A;  3D9L A;  4ANU A;  1JWG A;  2XEH A;  5CEC B;  1ZB1 A;  3Q5M A;  2DBA A;  3FU3 A;  3LVR E;  4ZHB A;  3UKR G;  4XZ4 A;  3CK8 A;  3UX4 A;  3UQ3 A;  1A17 A;  3V2O A;  4N2Q A;  3PZ2 A;  3DBS A;  3CHQ A;  4KXK B;  4U0S A;  4GPK A;  4TXR A;  3AS4 A;  3ZHE A;  5KWD A;  2KAT A;  3UM3 A;  2BTD A;  5AAO A;  2QYU A;  3ZHE B;  3UPV A;  4HFG A;  4NIK A;  3ZXS A;  5H7P A;  4O1P A;  4GZD A;  4EZJ A;  2X3M A;  1FT1 A;  2Q7F A;  4GA2 A;  3PZ4 A;  4WAF A;  5KJK A;  2RG8 A;  5JHA A;  2XZT G;  4A3T A;  3MYV A;  3UT8 A;  1SW6 A;  3FU0 A;  4C0M A;  4FHK A;  3ASH A;  3UM1 A;  5G04 J;  2PQR A;  4ACK A;  1OWN A;  3ABM E;  2J09 A;  5FT9 A;  2BUG A;  4EQF A;  3DRA A;  3B13 A;  3TWT A;  1XGW A;  3ULQ A;  3ONL A;  4J0U A;  3RU0 A;  3I3N A;  3LJ3 A;  5D2M C;  5G05 J;  3R9A B;  5ENP D;  2QC9 A;  4RG9 A;  1H6P A;  2AWI A;  5CED B;  2L0T B;  3G2W A;  3S2A A;  1BLX B;  5CCM A;  3ML8 A;  3NF1 A;  3JCK C;  3WXX A;  4HOS A;  3DPD A;  4WUY A;  4YDE A;  4A3V A;  3SZ7 A;  3S7J A;  4HOQ A;  4HQD A;  3SNX A;  3QWP A;  4M3O A;  3EHR A;  1KPS B;  2XGO A;  3UXG A;  4HOU A;  3UKU G;  5JJT A;  4BT9 A;  4AEZ C;  3D9P A;  3ZVV A;  2XEN A;  3UI2 A;  3FTY A;  2LO6 A;  3UIN C;  2F0Y A;  4GU5 A;  4PUC A;  4C9B B;  3PZD A;  2FBN A;  4Q69 A;  3L6A A;  1MX2 A;  3QWV A;  3RRU A;  5D0O D;  3ISM C;  1GW6 A;  1SZA A;  1D9S A;  3D9N A;  4B93 B;  3MKQ A;  2I9C A;  4FA6 A;  3SY2 A;  2IO2 C;  3ZRH A;  1KLX A;  5C2Y A;  1L5J A;  3LY8 A;  3V2X A;  4GZC A;  3PDN A;  5M72 A;  2LUH A;  3K9I A;  1EYH A;  1DNP A;  1PAQ A;  4UWH A;  4V3I A;  3MKR A;  5T8I A;  4FU3 A;  3ESK A;  1DC2 A;  4F7A A;  3R7Q A;  3ZFW A;  3FUJ A;  3L82 A;  2IJG X;  3PEV B;  5J90 A;  3TG4 A;  2L6J A;  5CCL A;  1KT1 A;  2VTB B;  1MZC A;  3APF A;  3QJZ A;  3V79 K;  2NXP A;  4L23 A;  3LDZ A;  2CFZ A;  4GZ6 A;  2P58 C;  3ZXP A;  4RQI A;  3L54 A;  3OTN A;  3FP3 A;  3U66 A;  3BG0 B;  3LPZ A;  5CEA A;  4DLQ A;  5J08 A;  3X2Q E;  3IBE A;  4XIF A;  3MZL B;  4KMO A;  2OOE A;  4X8Q A;  4B8A A;  3UTM A;  4DX1 A;  3P1U A;  4F1S A;  2J49 A;  4ZFH A;  3JUE A;  3JYS A;  1UN8 A;  2H6G A;  3CHP A;  4LEU A;  3U9W A;  3LY9 A;  2KXP C;  1N9A A;  3L16 A;  3UT7 A;  2FEZ A;  3L22 A;  5FQ6 A;  3C5R A;  4C48 B;  5ENT D;  1INZ A;  2WXO A;  3J5Q B;  2L0I A;  2GW1 A;  2XQ0 A;  4C0E A;  4JPS A;  4I17 A;  5A6C A;  3EU5 A;  4JZY A;  4K5B A;  4B8C B;  1HU3 A;  3CVW A;  4U95 D;  3UM0 A;  3RRN B;  2KC7 A;  2KBX A;  1MJ0 A;  3IV0 A;  2V0P A;  1E96 B;  1YCS B;  4QQI A;  4WND A;  3FDH A;  3C3O A;  1WY6 A;  2X6I A;  4JXT A;  3NB2 A;  1OY3 D;  4GCO A;  4I2Z A;  4B89 A;  2P9I G;  2BF0 X;  3Q4A B;  4J8S A;  4UQZ A;  2C0M A;  4U96 D;  1MYO A;  3MA5 A;  1Z5S C;  4OAU C;  3CHM A;  2VGE A;  1HS6 A;  3FUH A;  5EYP F;  4CRW A;  2RD0 A;  4K03 A;  5HQ8 A;  1BI7 B;  3SI5 A;  2YQ8 A;  2I1J A;  4I1M A;  4A63 B;  3MKQ B;  4GPM A;  4NQ0 A;  2GRP B;  1IYG A;  3TWS A;  4J8Y A;  4LNG A;  2P9K G;  3FTU A;  4WWN A;  4BER A;  4GMJ A;  2F37 A;  5A23 A;  3OXG A;  4F3V A;  5G2N A;  4I43 A;  4NAC A;  2B6C A;  1UJJ A;  3QNK A;  3RO3 A;  3DEP A;  4AY5 A;  4NRH B;  4KVM A;  1O1T A;  4GB9 A;  1WM5 A;  1Y8M A;  1RW2 A;  1NI1 A;  3QKY A;  1JPL A;  4AJW A;  4U8H A;  4CZ2 D;  3QAQ A;  2ZGG A;  1G3N B;  3ZIM A;  3FUM A;  4IUL A;  4HOR A;  3D9K A;  5KNG A;  2R02 A;  2XRY A;  2XGM A;  2Y4T A;  4DX7 D;  5AYW D;  1TYQ G;  1H2V C;  4UWL A;  2J8S D;  1OWM A;  3QDN A;  4JHJ A;  3BQO A;  2CHZ A;  2I1K A;  4EBA A;  4OVU A;  1AWC B;  4I1O B;  3RRM B;  4KT6 B;  4HS2 A;  3UIO C;  3CVU A;  1IQR A;  4HRM B;  3V30 A;  3CQC B;  3KEA A;  4XE0 A;  4DLO A;  2HO1 A;  3DSX A;  3SD5 A;  3EU9 A;  4KBQ A;  3GZ2 A;  3URZ A;  5JA4 D;  1N4P A;  3MV2 B;  1KT0 A;  4FP7 A;  1TNU A;  4TXP A;  1QYM A;  2H6I A;  1OXJ A;  4GTQ A;  2DCP A;  3FUE A;  4TRQ A;  3FUD A;  4GTO A;  4G11 A;  3PEU B;  3CVL A;  2R17 C;  4F6R D;  3AS5 A;  2WQ7 A;  3HXC A;  1TN6 A;  1SZ9 A;  1UJK A;  4Z68 A;  3KEZ A;  3PVL A;  1NFI E;  3QK0 A;  2PQN A;  1YMP A;  2ETC A;  3MV3 B;  4GTS A;  1OUV A;  2Y69 E;  5LX8 A;  3Q9N C;  2XRZ A;  4KYO B;  2HE0 A;  3QC1 A;  1MQS A;  4GTM A;  3JUI A;  2RFA A;  3TWU A;  2X38 A;  1K1B A;  5FZQ A;  3LEW A;  1UN9 A;  3Q7A A;  2AJA A;  2P9S G;  2CG2 A;  1TNZ A;  5EYL A;  5BPP A;  3O48 A;  3BEE A;  2NSZ A;  3KSL A;  2R5S A;  3C3Q A;  4WNF A;  4BTB A;  3MX3 A;  3RK6 A;  3ULE G;  4PS3 A;  3E37 A;  4N3A A;  1HFA A;  1DCQ A;  4K5C A;  3ASG A;  5B1A E;  2P9L G;  3KAE A;  3MCX A;  2IO3 C;  1JCQ A;  2XEE A;  4BTA A;  4DJA A;  3ZEF A;  5IY5 E;  5FIN A;  1FT2 A;  3UT4 A;  3VLF A;  5LP0 A;  5AQA A;  2XZD G;  3FEX A;  1FVF A;  3RKV A;  2MYO A;  3TG5 A;  3S7B A;  3DEO A;  1Z6T A;  5FQ4 A;  1BI8 B;  3CHS A;  2FUL A;  3B7U X;  1HG2 A;  3T5V A;  2LNI A;  4D10 C;  1U2V G;  1PC2 A;  2DZO A;  4DX6 D;  4U8V D;  3CKB A;  2OCC E;  5AEN A;  3Q7F A;  4U0Z A;  4AXH A;  4AIF A;  2LAI A;  3EJN A;  2DYS E;  4KZC A;  3VLD A;  4JW1 A;  2XCC A;  3AG1 E;  5ENO D;  3D9H A;  5FZR A;  1MX6 A;  2LAH A;  3ABK E;  4H7X A;  1IKN D;  4BX9 A;  2UY1 B;  1YA0 A;  3Q78 A;  3E32 A;  3APD A;  4PS7 A;  1DVP A;  3DSV A;  5CHE E;  4FAD A;  3LJN A;  3G2T A;  3JXI A;  3KS2 A;  4ACL A;  4ILG A;  4LG6 A;  3L17 A;  3ZU7 B;  3VTX A;  3BU8 A;  3Q9U C;  3KD7 A;  2XS1 A;  4NUR A;  2V5F A;  4BX8 A;  3FTZ A;  2V8S E;  4BEP A;  4W9R A;  2WVI A;  5EX0 A;  3B7T A; 
#chains in the Genus database with same CATH homology
 5ENN A;  5KCM A;  3CHP A;  3S7F A;  3SHF A;  4LEU A;  3U9W A;  1SQM A;  1E7U A;  3ESL A;  3LY9 A;  4I6J A;  4I9C A;  5ARF A;  4EPZ A;  3L16 A;  4ME2 A;  5CMY A;  2PM6 A;  2GRM A;  2J9Q A;  1JUQ A;  5LCW C;  2FO7 A;  2OVF A;  2XEV A;  4G26 A;  3TXM A;  3UT7 A;  2XGS A;  1N54 A;  2FEZ A;  2WXP A;  3CIA A;  5AJD A;  2VJ8 A;  4P29 A;  3L22 A;  5BW8 C;  5FQ6 A;  2VGY A;  3MGB A;  1INZ A;  3FTX A;  5ANL A;  2WXO A;  2WPV A;  3FWV A;  1E8Z A;  3TAX A;  4DPR A;  2L0I A;  2GW1 A;  3I4R B;  2WXH A;  4AM9 A;  2XQ0 A;  3ENE A;  4C0E A;  4JPS A;  4I17 A;  3ZYM A;  2WXK A;  4OYS A;  4BY6 A;  3D3M A;  5A6C A;  2AXU A;  1X5B A;  1E8X A;  3SGH A;  4TV3 A;  2VQ2 A;  4GYW A;  4JZY A;  4U63 A;  3C98 A;  1Y6I A;  3FY4 A;  5T3R A;  4B8C B;  4ANX A;  1OWO A;  1HU3 A;  3AU4 A;  3CVW A;  3JYS A;  4WWO A;  4XI0 A;  2IQC A;  3RRN B;  4B94 A;  4A55 A;  2KC7 A;  3AS8 A;  1MHQ A;  1NA3 A;  2IF4 A;  5E76 A;  3L13 A;  3PRZ A;  4U0U A;  4YVQ C;  3U4T A;  4CGW A;  3IV0 A;  4DI3 A;  2CFU A;  3FEY A;  2ION A;  4KZ0 A;  4EEC A;  4PDX A;  2V0P A;  1EPU A;  3FTW A;  3ML9 A;  2JLB A;  3AU5 A;  3TGO A;  3P2B A;  3IHV A;  1E96 B;  3FTS A;  3U3W A;  1HZ4 A;  2VGX A;  4G2V A;  4WND A;  4GA1 A;  3CK7 A;  2WXR A;  3D9I A;  3FDH A;  4APO A;  5AJL A;  1WY6 A;  3Q49 B;  3L08 A;  4Y6C A;  2X6I A;  2WXM A;  4JXT A;  3S7D A;  4GCO A;  2KCV A;  2WXG A;  5LFA A;  3FH5 A;  4I2Z A;  4AP2 A;  4B89 A;  4EZK A;  1OWL A;  2BF0 X;  3Q4A B;  4J8S A;  2FI7 A;  4UQZ A;  2C0M A;  4XX5 A;  2V4L A;  1ELK A;  3CHO A;  3T5X A;  3MA5 A;  2AXZ A;  3OAW A;  4R7L A;  3CSF A;  3CHM A;  3U64 A;  4N5C A;  2WM9 A;  4FLB A;  3UMV A;  4CT4 A;  2OVB A;  3CVV A;  3FHE A;  4PS8 A;  2VSY A;  2YHC A;  4UWF A;  3FU5 A;  3MJW A;  3LKU A;  4JA7 A;  1HS6 A;  4YND A;  3FUH A;  5BT1 A;  2M63 A;  3ZW3 A;  2I6H A;  2C0L A;  4JL0 A;  4CRW A;  2WB2 A;  2X6F A;  4GZ5 A;  4GML A;  1E90 A;  3IKO B;  2RD0 A;  1EF1 C;  4K03 A;  4GZ3 A;  4CGV A;  5HQ8 A;  3CV0 A;  2VSN A;  3SI5 A;  2DIW A;  3HYM B;  4WNE A;  3PE4 A;  3PRE A;  2YQ8 A;  4L7T A;  4UI9 C;  5EKQ D;  1TEZ A;  2I1J A;  4I1M A;  2E0I A;  2XPY A;  3MKQ B;  1VDY A;  2QFC A;  4DK5 A;  3GZ1 A;  4ABN A;  2MOW A;  1IHG A;  4NQ0 A;  4GCN A;  1IYG A;  4J8D A;  2AXV A;  4G23 A;  4JEU A;  4LRZ A;  2I2O A;  4RSY A;  4A1S A;  2PL2 A;  3SBT B;  3G2U A;  4I9E A;  1HX8 A;  3CGH A;  4YVO A;  4U07 A;  4AVX A;  3QWW A;  3FTU A;  4UQX A;  3ZYL A;  1W3B A;  3ASF A;  1E8W A;  4FLH A;  4WWN A;  3JQ0 A;  4G1T A;  3PUK A;  3TL5 A;  4GMJ A;  4ANW A;  2HM8 A;  4DI4 A;  5A23 A;  2UY1 A;  2PZI A;  4XKC A;  3I5P A;  2IFU A;  3N71 A;  2MHK A;  2LSV A;  3OXG A;  3CVQ A;  3EIJ A;  4F3V A;  3Q47 B;  5BNW A;  4RG6 A;  5G2N A;  4L2L A;  1FCH A;  3CLJ A;  4I43 A;  5ANR A;  4J8F A;  4URK A;  2FF4 A;  3EIQ C;  4NAC A;  3MEK A;  2IU1 A;  3HDX A;  1UJJ A;  3B7R L;  5KJL A;  2WMN A;  1NA0 A;  3QNK A;  2WXF A;  5KJN A;  3RO3 A;  1Z3X A;  4QFV A;  4HVB A;  4AY5 A;  4NRH B;  4BFR A;  5G55 A;  4KVM A;  4LUN U;  3VLE A;  2Y3A A;  4ILI A;  4GB9 A;  1WM5 A;  3FUK A;  1Y8M A;  3LYA A;  2CHW A;  3EHM A;  4E6H A;  5FQ8 A;  5EX3 A;  3FH7 A;  1P5Q A;  3QKY A;  1JPL A;  4U8H A;  5FZS A;  3RJV A;  3QAQ A;  4IN3 B;  4AJW A;  2GGF A;  5EDS A;  5KJM A;  3ZIM A;  3E4B A;  3FUM A;  2IOL A;  5BV0 A;  4IUL A;  4HOR A;  3CQG B;  3D9K A;  2LSU A;  2XRY A;  4L2Y A;  2XGM A;  2Y4T A;  5FJY A;  1HO8 A;  4FJZ A;  3HHM A;  1H0A A;  5AYW D;  3CST A;  3QOU A;  1E7V A;  3GZS A;  4ANU A;  3D9L A;  2E2E A;  5JHB A;  1JWG A;  1Z3Y A;  5G05 C;  5C1D A;  3HVE A;  1H2V C;  3ASD A;  1UW4 B;  4UWL A;  1OWM A;  3QDN A;  4CDN A;  4JHJ A;  3Q5M A;  2CHZ A;  2I1K A;  4EBA A;  4OVU A;  4EBA G;  2MRI A;  2DBA A;  3FU3 A;  2VSO E;  4FC8 A;  1H19 A;  4I1O B;  2XPI A;  3RRM B;  4KT6 B;  4A1G A;  4HS2 A;  4L1B A;  3RO2 A;  3CVU A;  2WMO A;  3LVR E;  4Y6W A;  1IQR A;  3NZU A;  4XZ4 A;  3CQC B;  2WXQ A;  3FTV A;  4DLO A;  4XE0 A;  3CK8 A;  3UX4 A;  2HO1 A;  4Q96 A;  4UWK A;  4CT0 A;  4ILH B;  3UQ3 A;  1A17 A;  3SD5 A;  3B7S A;  4N2Q A;  2J4D A;  3DBS A;  2NC9 A;  4KBQ A;  3GZ2 A;  3URZ A;  3CHQ A;  1B89 A;  3MV2 B;  1KT0 A;  4FP7 A;  4KXK B;  4U0S A;  4JC8 A;  4CDR A;  4GPK A;  4TUU A;  4KVO A;  3BG1 B;  3AS4 A;  3LY7 A;  2CG3 A;  3LXU X;  3FH8 A;  3ZHE A;  3JQ1 A;  1TJC A;  4GAA A;  3O4Z A;  5LCW J;  1HXI A;  2ILR A;  2GRL A;  2DCP A;  4WWP A;  2KAT A;  4JHK A;  2BTD A;  3CKC A;  3FUE A;  4TRQ A;  3T8M A;  2KCL A;  1HE8 A;  3FUD A;  3ZHE B;  4G11 A;  3UPV A;  3PEU B;  4HFG A;  3CVL A;  3PNT B;  4I2W A;  4MS6 A;  2R17 C;  3ZGQ A;  3FUL A;  5FQ7 A;  1PY1 A;  4CEM A;  3ZXS A;  2YNQ A;  2L9B A;  2WXN A;  3AS5 A;  2XCB A;  3IHY A;  3SBS A;  4GZD A;  4EZJ A;  2WQ7 A;  4G24 A;  2XPZ A;  2X3M A;  4APF A;  4UWG A;  1SZ9 A;  2Q7F A;  4GA2 A;  2WXI A;  1HF8 A;  4WAF A;  5KJK A;  4IRU A;  2RG8 A;  1UJK A;  4PH4 B;  5JHA A;  5BUZ A;  3MYV A;  3R7R A;  4A3T A;  2UWJ G;  1EDU A;  3KEZ A;  2AW6 A;  3PVL A;  3SF4 A;  3FFL A;  3UT8 A;  4B0Z A;  3FU0 A;  3CVN A;  3QK0 A;  2PQN A;  3MV3 B;  4MRU A;  5HI7 A;  4FJY A;  2OND A;  4C0M A;  2ZU6 B;  3FUF A;  4FHK A;  1HG5 A;  3ASH A;  3Q15 A;  4HLE A;  5T4Y A;  3VTY A;  4LER A;  3ZN3 A;  1E8Y A;  3LCA A;  3HIZ A;  5G04 J;  4BSX A;  1OUV A;  4I1A A;  4I6E A;  4UQY A;  3PH0 C;  2VSX E;  2YIN A;  2IOS A;  2PQR A;  5LX8 A;  3CEQ A;  4I6G A;  2XRZ A;  4UI9 K;  3CVX A;  1OWP A;  4ACK A;  1OWN A;  5FWQ A;  4KYO B;  5LOZ A;  1UG3 A;  2J09 A;  3QC1 A;  5CMW A;  1S0P A;  3D9J A;  1MQS A;  5FT9 A;  2JEK A;  2VTB A;  2BUG A;  3JUI A;  4EQF A;  3B13 A;  4EZL A;  2X38 A;  5FZQ A;  1XGW A;  3LEW A;  1H2T C;  3D9M A;  3ONL A;  1UN9 A;  3ULQ A;  4J0U A;  2WXJ A;  3RU0 A;  2CG2 A;  3I3N A;  3LJ3 A;  2J07 A;  5BPP A;  2X6H A;  4RVB A;  3O48 A;  3HVE B;  5G05 J;  3BEE A;  4HOT A;  2NSZ A;  2R5S A;  3R9A B;  4WNF A;  4BTB A;  3G2S A;  3MX3 A;  2WQ6 A;  4K0R A;  3RK6 A;  4JVS A;  4RG9 A;  2AWI A;  4PS3 A;  4MKT A;  1QNF A;  3QB2 A;  2L0T B;  1NP7 A;  4N3A A;  3G2W A;  3IEG A;  3S2A A;  4UI9 J;  1HFA A;  5JJ6 A;  4E85 A;  5CCM A;  2Y4U A;  4IYP A;  1ZU2 A;  2CHX A;  3ML8 A;  3I4G A;  3CHR A;  3JCK C;  3ASG A;  3NF1 A;  5DIZ A;  1WAO 1;  3KAE A;  3LS8 A;  3MCX A;  3WXX A;  3DPD A;  4WUY A;  5FTP A;  4A3V A;  3SZ7 A;  4HOS A;  3S7J A;  4BTA A;  3APC A;  4HOQ A;  3TXN A;  1U3D A;  2KZT A;  3TJP A;  4LCT A;  4DJA A;  4H7Y A;  3SNX A;  5DBK A;  3ZEF A;  2X6K A;  2HR2 A;  4FHJ A;  3UT4 A;  3VLF A;  5LP0 A;  3QWP A;  4Q94 A;  1N52 A;  2OV8 A;  3RIB A;  4M3O A;  2HYZ A;  3PUJ A;  4GYY A;  1BPO A;  3FEX A;  2XGO A;  4JA9 A;  3FU6 A;  1FVF A;  4HOU A;  5JJT A;  3RKV A;  2A4Z A;  4BT9 A;  2A5U A;  4AEZ C;  3D9P A;  3TG5 A;  3ZVV A;  1ZBP A;  3S7B A;  4AY6 A;  4BWR A;  3GYZ A;  3FTY A;  2LO6 A;  3ZYQ A;  4GU5 A;  5AIJ A;  2X6J A;  4J8E A;  4PUC A;  4XKB A;  4C9B B;  1Z6T A;  5FQ4 A;  3PZD A;  1HH8 A;  3CHS A;  3FUN A;  3QAR A;  2FBN A;  2KM4 A;  2FUL A;  3B7U X;  4F53 A;  4Q69 A;  1HG2 A;  3L6A A;  4N3C A;  3T5V A;  2LNI A;  2WXL A;  3QWV A;  3RRU A;  4JHR A;  5D0O D;  4CDM A;  1GW6 A;  4JEH A;  1SZA A;  3PNL B;  4D10 C;  1PC2 A;  3D9N A;  3MKQ A;  2R59 A;  5G04 C;  2I9C A;  2J08 A;  3NZS A;  4FUL A;  3CKB A;  2AVP A;  4ANV A;  4FA6 A;  3OXF A;  4U0Z A;  5AEN A;  4AXH A;  3ZRH A;  1KLX A;  5C2Y A;  1ELR A;  5ARG A;  2XHE A;  1H2U A;  1L5J A;  2QY7 A;  3LY8 A;  4OVV A;  4GZC A;  2LAI A;  4AIF A;  1LF8 A;  3PDN A;  5M72 A;  3EJN A;  4KZC A;  3K9I A;  1EYH A;  1DNP A;  3ZYK A;  1PAQ A;  4UWH A;  3VLD A;  4JW1 A;  2XCC A;  3EDT B;  2KZT B;  2LAH A;  3FUI A;  4V3I A;  3MKR A;  5FZR A;  4N2S A;  4GA0 A;  5T8I A;  4H7X A;  4FU3 A;  4BT8 A;  4BX9 A;  2UY1 B;  3ESK A;  1FVH A;  2EQX A;  4CCA A;  4AV7 A;  1ELW A;  1YA0 A;  4F7A A;  3R7Q A;  3CVP A;  3ZFW A;  3FUJ A;  1H6K A;  5A7D B;  3CR3 A;  3CK9 A;  3APD A;  4XI9 A;  4PS7 A;  2IJG X;  1NZN A;  1QQE A;  2YHE A;  3PEV B;  4ATG A;  1IQU A;  1DVP A;  4G25 A;  4HXI A;  5J90 A;  5CHE E;  3TG4 A;  2L6J A;  4FAD A;  5CCL A;  4WNG A;  1JWF A;  3SFZ A;  1KT1 A;  5D0Q D;  3G2T A;  2VTB B;  4J6I A;  3NQP A;  4AOF A;  3PE3 A;  3G2V A;  3APF A;  3QJZ A;  1QZ2 A;  3KS2 A;  2NXP A;  4L23 A;  1U3C A;  4ACL A;  3ONK A;  4ILG A;  3LDZ A;  3PS6 A;  2CFZ A;  3UUX A;  3L17 A;  4GZ6 A;  3VTX A;  2P58 C;  3L54 A;  3OTN A;  2VGX B;  4O6F A;  3FP3 A;  4U04 A;  3KD7 A;  3U66 A;  4NUR A;  4GYO A;  3BG0 B;  3LPZ A;  4DLQ A;  5J08 A;  2PM7 A;  5JJ7 A;  3CVY A;  3OXL A;  2WQH A;  2V5F A;  4N39 A;  3FTZ A;  4BX8 A;  1TJF A;  3IBE A;  4XIF A;  3MZL B;  1XNF A;  4KMO A;  2OOE A;  2V8S E;  3D9O A;  2VYI A;  2J4B A;  4B8A A;  2KCK A;  4W9R A;  3P1U A;  2WVI A;  5E75 A;  4F1S A;  5BV1 A;  5EX0 A;  2C2L A;  2J49 A;  4MLP A;  3LVQ E;  4N3B A;  3GW4 A;  3ZPJ A;  3B7T A;  3EHN A;  1UN8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...