1HU8A

Crystal structure of the mouse p53 core dna-binding domain at 2.7a resolution
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
186
structure length
186
Chain Sequence
TYQGNYGFHLGFLQSGTAKSVMCTYSPPLNKLFCQLAKTCPVQLWVSATPPAGSRVRAMAIYKKSQHMTEVVRRCPHHERCSDGDGLAPPQHLIRVEGNLAPEYLEDRQTFRHSVVVPYEPPEAGSEYTTIHYKYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRDSFEVRVCACPGRDRRTEEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the mouse p53 core DNA-binding domain at 2.7 A resolution.
pubmed doi rcsb
source organism Mus musculus
molecule tags Dna binding protein
molecule keywords CELLULAR TUMOR ANTIGEN P53
total genus 35
structure length 186
sequence length 186
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2001-01-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1hu8A00
4IJTA 2PCXA 2BIMA 3Q05A 1H9DA 4IBYA 3D0AA 2XWCA 2XWRA 2FEJA 4LO9A 3VD1A 4AGPA 2BIOA 2ADYA 3VD2A 4HJEA 2RMNA 2BIPA 4QO1B 4XR8C 2J1XA 2WGXA 3WTXA 3D08A 2J1WA 1EANA 5AOJA 4AGQA 2IOMA 5AB9A 3WTSA 3WTUA 1HJCA 5G4OA 4IBWA 2J1YA 5BUAA 2OCJA 3TS8A 4G82A 3D06A 2H1LM 2AC0A 5ECGA 2X0WA 3KZ8A 1IO4C 4AGMA 5G4NA 2IOOA 3QYMA 3EXJA 4MZRA 4A63A 5G4MA 5A7BA 2X0UA 4L0YA 2P52A 1TUPA 5ABAA 4IBSA 3VD0A 3Q01A 3D05A 3WTYA 1CO1A 3Q06A 4GUQA 3WU1A 3WTWA 4AGLA 3IGLA 5LAPA 2AHIA 3EXLA 1YCSA 4GUOA 5KBDA 1UOLA 3D09A 2X0VA 3KMDA 4IBQA 2YBGA 5LGYA 1KZYA 1GZHC 2J6WA 2IOIA 4L18A 4IBTA 5AOMA 4IBZA 1GZHA 2ATAA 1E50A 4KVPA 3ZMEA 3WTTA 4LOFA 1TSRA 1CMOA 4LOEA 4IBUA 2J21A 2VUKA 2J1ZA 2BINA 3IGKA 1EAQA 5AOLA 4L0ZA 2J20A 3QYNA 3US0A 1T4WA 2MEJB 5AOKA 1LJMA 4MZIA 4AGNA 1HJBC 4IBVA 3D07A 5AOIA 1EAOA 2GEQA 3WTVA 3US1A 2BIQA 4AGOA 1HU8A 4G83A
chains in the Genus database with same CATH superfamily
2CUHA 1CD9B 1U8KA 4GXVL 4A7TA 3WS6C 2J8OA 5FO7B 1AD9B 3M88A 3UG4A 3FOLA 5GPRA 4XCCL 5D6CB 1T1YA 3BAKA 5FYLD 1OSZB 1YJDH 2AJXL 3BWUC 4M7ZB 4B50A 3S8WA 3ZYOA 3BKML 1LO2H 1TU2A 3B9EA 1RURL 4OCSH 4XMZA 3VWKD 1C16B 4I3RH 2CBMA 2GUOA 1TTCA 4OZFB 3C12A 2X53A 3KEHA 3TVMC 4B9KC 1NSNL 2EDYA 1KGWA 2Z93A 4AZUA 3GSNH 4WO4B 1Z1WA 4JO3H 4JY4B 3WLBA 1WE5A 4OIBA 2P8MB 4HPOH 3PRZA 4XN4A 3WNLA 1WTLA 4FQLL 1KZQA 3ZQXA 3HPJB 1JPFA 4FNSA 4E9YA 1E65A 3M7OA 1NOLA 4F9PA 2YBRB 1RHFA 2NUTB 3P9WB 2ED6A 4EIUA 3LRSB 1J8RA 1CTNA 4XZUA 2YUVA 1A6VL 1XXDC 3ASNB 4YXHH 3G04B 1EUUA 1T21B 3MO1B 4AQ1C 2DIBA 2EDRA 3QQDA 2AQ3A 1A4JA 2Q10A 1MW1A 4HFWA 3SJVE 3ZUNC 3P0VH 4P9HC 4JM2F 5DSCB 2C3GA 2B14A 4BM7A 5F9AC 4F58L 2Z91B 4EIGB 4LCYA 4NWTH 3FTUA 3MTXA 2WUBL 4ZG1A 4MHHI 2QSTA 4IKJA 5A2FA 4DIXA 5BRZE 1AG6A 1HYRC 2YPKB 2JB5H 4D94A 2WZ5A 4MCZB 3NZ8B 5F1KC 4OLWH 2DMBA 5IVXB 1SEQH 2RD0A 4AQAA 5F6HJ 3WTYA 1ZJBA 3T3MF 3UJJH 4ZXBA 1NUDA 4BZ2A 4BFRA 4DP8X 2Y3AA 3FRPB 3C5ZD 4XAKE 4EQ3A 2IAMB 2A0LD 1OALA 3MYJB 3TBVA 2IPKB 4WJG3 5A6MA 5IY5B 3GSUA 1WISA 4EVNA 3CSYB 3V9FA 5ACLA 1M7DB 1A7OH 2BNQD 2DPKA 3QO0B 1UM5H 1Z5YD 4UAOB 1A9BA 3CDYA 3HBZA 2DLFL 4KROB 4J3WA 1TENA 4IGBD 5KYUA 3ZT7A 5T33H 1MF2H 1T2QH 4TVUA 1YN6B 4FMVA 2PYEE 4WW2A 1GS6X 1UWFA 4Q6KA 3V9EA 5JHLA 3MACL 1L6XA 3O3DB 4WY7H 4D7BA 4J39A 1HZHH 1L6PA 3QYNA 3AS3A 1JBJA 1WZKA 2CE6A 3GZKA 1ZHKB 2VITA 4EOWH 4ICXA 4JB9H 4R4ND 1LVEA 2MCMA 2I5YL 1ADWA 1QZNA 3KS0H 3DA0A 4DGYL 1SQ2N 3S34H 2ZP0T 3LAFA 3V0EA 4L1HA 1AKJA 1MAJA 5JORB 1IVLA 1GAFL 1ONQA 2JJSA 2Z4QB 4LMQE 1LEIB 2F54A 4NHCH 4XCEB 1N7MH 1R3LA 4MJHA 4FQCL 4Y2LA 4R8WH 4RZKA 2BC4B 5DZNA 2XPYA 3L3GA 1AR1C 3H9YA 4JM2C 3CSYA 3S48A 3SPJA 1H3UA 2BNQE 3LRLA 4D9RE 3EG9A 2ZUTA 1F4AA 4WW1B 3PQYB 1W9XA 1BF5A 1EFXD 4P2QA 3EOAA 5CGYC 4MCZA 4MMXA 2J1WA 1ZHBA 2ZKWA 2GI0A 4HU2A 3VX1A 5IBTL 1AXIB 4XI5D 5C08A 3DIVA 2XBDA 3HAEH 4V1DE 4QRUB 4QNPF 1I1FA 1KJ2B 2A1WH 3DJ9A 4U3HA 1RJCA 4GMTH 3PYCA 4G1MB 1EJ8A 1RI8A 3LQAH 4M5ZL 4HAKA 2PTTB 4MSWB 4OD2A 4AJVA 4WO4C 5C86A 1G94A 4XWOC 3KPSE 3US9A 2Z65C 3P30H 2JCCE 3GJFB 4JKNA 1PMYA 4M03A 4WFEE 2J5LC 4FEMA 2CD0A 2OL3L 3E7JA 4DVRL 3VQLA 4WKZA 2WQAA 2QTEA 3MV7A 4M3KB 3LKQA 3WGVB 3U82B 1CFBA 3GBEA 3V95A 1EFXA 4ADJA 1UACH 3TBWA 2BHYA 5GJSL 5I28A 5AKRA 4PJ9C 2GB2A 2P8MA 2L7QA 1D5ZA 1HDMB 5KS9E 5IB4B 5BRZD 1NLBL 4G8GA 5FO2A 4B0MM 4FAAB 3S9DB 1JF5A 4U1NB 4GLRI 4B3EA 4MMXB 1FCCA 3FO1A 3ZHDA 1JFHA 3MNVA 3FTVA 1MJ7H 2VDRB 4FNRA 2NNRA 3QHZL 4ZFFA 4LOUC 5CF3A 1AP2B 5LGYA 1A14L 1MHHB 4RRPM 1G9MC 1ITBB 2X4SB 2A74C 4J1UA 5K1NA 1EEZA 3DARA 5DWPA 5BZWA 4XXDB 2CLVB 4FZEH 1BF2A 2CNYA 5FO7A 4B53A 4HOZA 3U2JA 4NIKB 4P2CG 4RFNB 3L3GB 2XVKA 2B59A 2XN0A 2ZOKA 4H25B 1RUMH 4HZLB 3QZWB 3V5DA 4UV7H 4L0ZA 1DE4B 1O6SB 3MBXH 5C8JA 3NBNA 1JDDA 5E8OA 3NQKA 1GIGH 2H32B 3W9DB 3BD4A 3EOYG 4Z78A 2APSA 3DX6A 3ZKNC 3AUWB 2XA8H 3AACA 4XRCB 3HBQA 4XTRD 2VT0A 2FLRT 1SJEB 3ZU8A 5LXVA 3CVBA 3IDYC 5BS0A 4Z7NB 4YWGL 2X3CA 3H53A 4K5OA 1K9TA 3CFQA 1AQDA 5CGMA 1EWHA 3B2VH 3T6WA 4W70A 1KGYE 5EWIH 3BW9A 1W6WA 1TKWA 4NZDA 3FULA 4F8PA 3HB3C 4PSRA 1RJYB 4V1DB 5J8OA 1ETA1 3HS8A 2OMTB 1Z9PA 3MRIB 3QR1A 4HDIA 3LY6A 5DJ6B 3B7UX 4G8FA 3K1DA 4WTZA 1WZLA 5I6PA 5IVOA 5E9DE 1R3JB 3ETBJ 5JQHC 1L0PA 3LVEA 3LKQB 1MFCL 4AUYA 3VXNB 5I6OA 3GIVA 2OM5A 2XRAH 4AQZA 3D6GA 5CCJA 2ICWA 1HTYA 5GZND 2OQJA 3FQYA 4LLMB 8FABA 1HWWA 1PW3A 3GUTB 1YC8A 4ILDA 3NZ8A 3VXRE 4HMCA 1B3JA 1TZHA 4M7KL 3C5SA 4QHPA 5KVFL 3MJWA 5DMGD 4BV1A 2ITCB 4GW5A 3UFIA 5J13B 1AHMA 4HFUL 4F37F 5A6LA 2JB6A 5AZUA 4CC4C 1FO0L 1JWSB 1QA9A 3OZLA 1NCBH 4FLQA 1MHEA 3JV0A 1G0XA 2Y6TE 3QH3A 3RGHA 1DHKA 4NKQB 2ATPB 4EI0A 3TURA 3QNYB 5I1KL 1NDGA 4AQ8A 3KLSA 3S37X 5H4ZA 4NWUH 3W9EB 1L9TA 3GB7B 4QRTB 1FHGA 1RK1B 2JKWA 3HG4A 1C7TA 3NJFA 1J1OH 4TPRH 3SPIA 3BPOC 3BPLB 3PDOA 1LO2L 4WHTB 3KDPB 4W9IC 4CKVX 4G80B 3LXBA 4GG8B 3VXUB 1C12B 1YEJH 3DV6B 3D69A 3U25A 5E7BA 2E74C 1CFQA 4Y16C 1JYVA 6TAAA 2HKFH 5SX5H 3GBNL 3KXFD 3J7HA 2VR8A 3KS0J 5K1JA 5BV7H 3UGEA 3MUUA 5DURD 1U42A 2B1AH 1QSFA 1UB6A 1J8SA 3LS5H 3BVDB 3TONA 1MELA 2CGRL 2VMDA 3PWLB 4ZSOE 2OL3B 4OSUH 4Z7NE 4QOKE 3DVGA 1HXMA 1TZGL 3FOLB 5BRZA 1G6RL 1XIWC 2EQDA 4OCXL 1U92B 3E6FA 4KXBA 1HE7A 1E90A 4YSQA 2NY3B 4QXUH 5D4JA 3AC0A 3O3AB 2DYPA 4AEFA 1D5BA 1JHTA 3L1GA 3DDGA 4MWFA 1WBZB 4UT6L 2DM3A 1KOAA 4G6KL 4X6EA 3AW5A 5GHWL 1YEEL 4NFCA 1KIPB 1OSYA 4MZ2A 3FSZA 1XH3B 3QCUL 1CL7H 1BZEA 5TDOB 1KIQB 2A6IA 2MFNA 1VGEH 4NIYE 4XHJD 5C2BL 1Q9KA 4U4BA 1DBJH 5AW9B 3QIWC 4B0MB 4R7DB 4XXWC 5EF1A 2DEYX 3JT2A 4YDMA 3GHBH 4AT6A 1SLUA 2AERT 3MI6A 1CR9H 5BVJA 1NCIA 1DSFL 3BKJH 4RISL 1CFVL 1UJ3B 5HYJD 2IGLA 3UTSA 1DEDA 1G9ML 1MLCA 2D2OA 5CM1A 4S10A 1FNAA 4IW4C 4NO2A 4O02A 3SPGA 4LHJB 4A7GF 5I1HL 3TFKD 5I76B 1EFXB 2VC2B 1NMBL 1P84J 2D2CC 4NSKA 2J4WL 2AK4E 3AREC 3KWXA 3GXPA 1X7QB 2L3BA 2BW4A 4JRXE 1VENA 3G9AB 3FO2A 4P4RB 5DMIH 5C09B 1AY1H 4G8EB 4ZD3H 4ZMLA 5BVPL 2OXGB 2OSYA 4WW2F 2ADIB 1MWAH 2UWEA 5D2NA 2VL4A 2DI7A 3HLAA 1N5AB 3Q6GL 4HWEH 5DU7A 4JRXD 2CKBB 4HEME 1B9ZA 1JGIA 4O51A 1LP9A 3KGRA 1XSIA 2K70A 4O58H 5CEZL 4OJDH 2IWEA 3DXAA 4EN3A 4DUWA 4X6DA 2B1OA 5CLYA 5K1VA 4ZX4A 3FK3A 1WZMA 5E2TL 4R4FL 4DKAA 4RFEB 4HKZA 3VFNA 3VG0L 2VXTH 2VDNB 2XTLA 1R5WB 4GEJA 2VDOL 1JGDA 1HHIB 5AENA 1VZHA 5B1BB 1L3WA 3VMOA 2F6AA 3APCA 1YQVL 5L8KB 3VTMA 4H8QA 1KIPA 2H0EA 3IDMB 4W4OA 3ZDZE 5GSVB 3J07A 3AT0A 3GSNA 2EIMB 4UM9A 3LKOA 2YD2A 1NPJA 4HP5A 2XG5B 2VIRA 3HR5A 3G7TA 4YPGB 3WFBH 1IEBB 3TH2T 4R0LB 3QFJB 1XF4B 3QG6B 3CX5K 1F86A 1MFCH 2FATH 1CFTA 3EBIA 3T6XA 1I8LC 3HTLX 1MWAL 1RZPA 2J20A 5C9JB 2H4EA 1E4WL 1V55B 4HXBL 5EORH 2Y6SC 4JFVA 5E5LA 3KYKH 1QMUA 2AXWA 2JQAA 1J9SA 2AEQH 5TGBA 1HESA 2OMYA 2IANE 3LRHA 5AD0B 3MUHL 1JD7A 2HX9A 2VAJA 1L0QA 4PY7B 1S5HA 5AYTA 5D1XC 4NC2B 3MRDA 5E8PA 1RJZB 2P8LB 1HHJB 3QUYA 4PY8I 2XC8A 3VG0H 1ZS8B 3B1TA 2QGEA 3II1A 2IFFH 2ED8A 2AQRA 4GG8A 2UZYB 4MMXC 1UKSA 3ARBD 3O9WC 3NAAH 4XE5B 1C1EL 3CSPA 4JKPH 4JZJA 1OWRM 2O6PA 1IM3A 1TQCB 3GMMA 2PPEA 4GRMA 4NO0A 2JI3A 4ICWA 1JNHA 4ZNEA 4NJ9H 2X4PB 3WE6B 4LRIC 5J1AA 3AROA 2UZXA 4FG4A 4RMQA 2F74A 3O0RH 3V6FB 3PU7A 4KO5A 4A2MA 1S7UA 3VI3A 4DOHB 5GS0D 3RFRA 4TQPA 4IYKA 4UTAA 1I7UA 2R0ZH 5EU5B 5H94B 4KRPB 3VI3B 5F9DC 4B60A 2P5WD 1BZ9B 2ENSA 2P24B 4DP4X 4KUZH 5KBLA 1AANA 3WNJA 4XPAL 5F0MB 1KB9J 2XBZA 4YHPA 5KTEL 1NLBH 1F5WA 5DYFA 5KSAD 1ZXKA 2CM5A 1LNUA 3WN5C 1MNNA 3QQ9D 4N0UA 1I8MA 2VSCA 3GHBL 1RH8A 3IDYB 5ETUA 3V0FA 1I3GH 1MXDA 1RZJL 3GM8A 1EEYB 2ALWA 4PN6A 5DVNA 2X0UA 5IVXE 3RVUC 1QPXA 4UB0H 3FAWA 1HH6A 2O4EA 1MEXH 4YDNA 4Z7OF 3MRNA 3QHZH 4N3TA 4OCWL 4YSUA 3QIBA 5ID0B 3FPXA 3LH8A 3QULB 3QFDA 5HYQB 2O5YL 3OAWA 3VXRD 4JW3A 3WJMB 2M2DA 1SRDA 3QFJD 1K3IA 1DCEA 1TSHA 2GUOB 1BWWA 2EIJB 3WI9A 4UOZA 1F4XH 5IIEB 4LVHB 4I5BB 4WU5A 5E99L 4WV1C 5FOBB 2A6KB 3R4RA 2WQXA 3FBQA 5CEYB 5TE4L 4AIOA 2KPWA 3CLFL 4KKCD 3BQUB 3P77A 1FJ1A 1G6RH 3FCSB 1UURA 4XC1L 1MG2C 1IGMH 1OGAD 4NOBA 4RGNC 4X6CE 3VFGL 4DVRH 3QRBA 3HAEA 4QHKJ 3F04A 4X6CF 1T5WB 4NQQA 4KKLD 4TQ8A 5IMMB 3E2HC 1OHZA 3FUFA 2OP4L 4X4YA 3IS1X 3T0VA 3SN6N 2W59A 1KYUA 1TT6A 3U46A 4ELKA 4Z76A 1QVOA 5D7IF 4NNYB 1XTLA 4PB0L 1NMCC 2EABA 1MHHA 4FG0A 4X0KB 1YMMD 2WMPB 4M6OL 4RGND 4LBEB 2CLRA 1SVBA 2VLRE 5LUMA 2CK0H 4HUWB 1BIIA 1JF1B 1QBLH 2HLFD 2OMZA 5DURB 1KIRA 5E2VH 4QJ4B 4IRJC 4Q9QL 2HZHA 4AOFA 4EI6B 3EDJA 3HE6B 5JQ6L 2W0FA 4TPRL 2I07B 3C5JA 3LQMA 4YEEA 4L8SB 2IO5A 1A2YB 4G72B 4NO5B 1KJ3H 1HXYA 3MJ8B 4N9GB 1WIUA 4K71C 1A6UH 2APBA 3ARGB 3AXHA 3LPOA 1CS6A 3HNSL 1EGJA 2NLJA 5AG8A 1XF2A 3QK0A 2MQGA 3LXAA 3ARZA 1GKEA 3H4FA 3VXTA 2AQTA 4MNHA 5AAMA 1IGFL 3AJ7A 5KSVB 2OFQA 4YR6B 2NTFB 2G75B 5AWNL 3D25A 1RUPH 1K8DA 5ESAA 2A74A 3PV7A 1FZMA 1S7VB 2FSEB 3KJ4B 1BDYA 1I8UA 1QWNA 4O02B 5EU4B 5C0AB 2AC0A 2CO3A 4CMMA 5I5JA 4ZUUA 2DH3A 3SGKC 1OAZH 4CSSA 4Z23A 3HOGA 3WHXA 3NZHH 1NAML 3MRRA 1DBMH 1FL3B 4PIRF 2CUAA 1KBGH 2G3NA 3CVHH 1IIKA 4HWZA 4JZJC 4ZFOA 4J2XA 2WBXA 2LT9A 4LEOB 1KCVH 1IM3B 1E3FA 1WITA 4RDQG 1DTUA 3BUTA 4UQ3A 1FGNL 3QUML 4XO3A 3C2SA 1DQQA 5MEQB 2JVUA 4E5XA 2DQGH 4G8FB 4WVRA 3FRUB 4TV3A 4N1HB 4QYOB 1TJXA 1O7VA 2EDNA 1G7IA 1SBSH 5FW6A 1IAIL 4O5LH 1JI2A 3B56A 1NL0H 5AB1A 2JB5L 2Q76B 1P1ZA 2J6WA 4CUCA 3ILPA 2WQSA 3O0LA 4LSUL 2X4NB 3QDAA 4PG2A 1AZNA 5F3BB 2GBTA 3DVNA 1T1XB 1OPOA 2XPZA 3FNKA 3NUKA 2AEPH 5CP3A 4JPIB 2FL5A 4PGBB 1YSOA 4HIIA 5CZVH 4AEIL 4NT6B 4XO9A 1L7IL 3RVTD 5GS2H 1VCBC 4AGNA 3ILQC 1SFHA 2NZ9D 3B2PA 4Y19A 5K9JH 1NAMB 4GS7C 3WDHA 3DV6A 4TL5A 4UT9H 4GRLB 2D3NA 2KDGA 3FO9B 3EHBC 5CKAA 3QO0A 1DVUA 1MQKH 4NYLB 2JKRM 1YRKA 4W9FC 3K6OA 5IJVB 1NCNA 5DT1L 5IMKB 5DUJA 4OCWH 3H3PL 4TXVB 3T6VA 2XV2A 3MUGA 1G6RB 4OUUA 4RFEA 3HZYB 4QO1A 2BSTA 3HVNA 2FX9L 1GS8A 1A3RH 4CNIB 5HHPA 2QVKA 1VFBA 4JFZH 1CDIA 5F88B 1YYLH 4MB1A 2EECA 2VW7A 4UQ9A 2P5EB 1JDCA 1NGYA 4YSCA 3CFKA 1ZLEA 4PJDF 4AYFA 3UAJA 1G43A 1PFOA 2UWEB 5D2NB 5F1NA 4LSUH 3J27A 1BVKA 1SMOA 1F11A 3QJZA 3GEWB 1U8PB 2J25A 3O6FB 4N8CH 4L37B 4NUGL 4UT9L 3RDTA 5BRQA 2E6PA 1JTTA 1IEAA 1GZQB 4YIQB 1CL7I 2ZKHL 3MUZ1 1IX2A 1R3JA 3ARDA 3VA2C 1V7NL 1WCBB 3KPQA 4JG5A 1MFVA 1Q94A 1OT2A 2GJPA 3BWZA 2MKLC 5IW6A 4LSRL 5HGHB 4U2YA 1P7QB 1MY7A 3EO0A 3FYIB 1KPUB 1E30A 6PCYA 3IBOA 3CVHL 1GW6A 3QQXA 2WKOF 1A9EB 4CNIA 3ZQWA 4MBRA 5HHOD 2E7LA 4DPBX 2WIIA 4P23C 2AV7A 1SBSL 4PJAF 4PRDB 3SBPA 1NTDA 4DFIA 2NW3B 4Z0XA 1PZBA 3VFWA 1AQKH 3H3BC 4HV8A 4OZFH 2OAAA 3IDGA 1O7DC 1ILSA 2XTSA 4Q8BA 3VSQA 3CVIL 4DP1X 2VZVA 3QIWD 3NCWA 4M7LH 3ZTJH 5EUKB 3TYGH 1U8KB 5DHMC 2XZAL 1RUPL 1ASQA 4XBGA 3IGUA 1XH0A 4HXBH 1I31A 1OARL 1SY6A 1PY0A 4QOKB 1TVDA 4H4NA 5D8JL 1CZ8L 1IB5A 1CDCA 3TO2B 1U92A 1DANU 3IF1B 2HTKD 3E0GA 3EYFB 5CUSH 1EJOH 2LABA 1K6QH 3T65B 1A7RH 1LDPH 5E5UB 1XAKA 5LXGH 1KGCE 1ZV9A 3MV9A 2X4TA 1G7MB 2OZ4L 3LPPA 1EHLH 1OTUD 2V7NA 1HHKA 1I1YB 3HRZA 4KJPC 3DXAD 4LF3A 4XVUC 1UM5L 4Y2DD 5E6ID 3SGJA 3ZKSD 4EN3D 1A9EA 2BIQA 1K4DB 3GMLA 4WSJA 5JYMA 1VEPA 4GKLA 3KYMA 4P0DA 5E0FA 4JFUA 2EE6A 4E9WA 2QLVB 4UILH 1H19A 2WGNB 4WEBL 5DRZA 4JS7A 4PVBA 5A6IA 3LZPA 4PB0H 4U1LA 1IFRA 3CTTA 4HUUA 1SXCA 4JREB 5LGKA 3G5ZA 4HCRA 4HJSA 4WAFA 5BCAA 4LDOB 5D70H 4HIJA 2O61A 3CPLB 1PX4A 4GB9A 1L0YA 4F37K 5EZPA 3UBXG 4Z77A 2DLEA 4JHUA 1MUJA 2EDHA 4JJ5B 4PWJA 5GZNA 2G0KA 2ZSVA 1UD2A 3WXWH 2ZWNA 2D0GA 4J3VA 5FLVA 3TWYA 3ETTA 4A2HA 1BVOA 4Z7UA 4OZHF 3ARGD 3WE1A 4FNPA 3BAEH 3VI4B 3GMRA 5CZXC 4U1MA 2M8XA 3OKKB 3NJJA 5EMYA 4MTMA 4FXGC 3ATAA 5IMOA 3FQRB 1FORL 3FTXA 3HW7A 3VI3F 1P7QD 4YZWA 3HIZA 4NAQA 4N5UA 4PRID 3WIHA 1A21A 1KMGA 4H26A 5KN5A 1A3LL 1G7QA 4TSBL 3IU4H 5J1AB 2DM7A 5ESAB 2GIYA 5J6SA 3R1GL 1JXJA 5HJ3A 1OTTD 3ATDA 2EIDA 3PABA 4CRPA 3VRIA 1JNNL 4JDZA 4NQED 5HHNB 4LVEA 5D2NC 3QUMB 1CDGA 2BPBA 1RZ7H 4HCFA 4E9VA 2I7OA 1MFUA 3G5ZB 2LHAA 3CDZB 4M5YH 4U1GB 4I3RL 3STLA 1TUPA 1HFUA 2R1YB 1DBAL 2VZOA 4UZSA 2QKIA 1OGAA 3LTVA 2HN7A 1F4XL 3PWJB 1UASA 2VLME 3HG1E 4OJCA 2XN9D 1E27B 3L9RB 1VSCA 4GFTB 3ZT6A 2OR9L 5IGXH 4X6DE 1C5DB 1U6AL 1XFPA 1ZWIB 4Y8AA 3HS0C 4FI6A 4JPQA 4NZTL 1E8YA 3V0WH 4MXWH 5IV2A 1N68A 1Q72L 3ZZ1A 2A5UA 4XVSL 5D2LF 5CWSB 2VDNL 3D34A 4PJ5B 4JQIH 4ELKB 3W82A 1HHGA 3PL6B 3MRGA 2DDQL 3CHQA 4AKQA 3QUKA 3NFSL 3U2SB 2DQFB 3UYPA 1TXKA 1CI5A 1WVZA 1TZIB 1AMXA 1P1VA 4H20L 3TO4C 1U21A 3AY4A 3QWRD 3U83A 1OAKL 4JGUA 4KQ0A 2VYRE 3H54A 3IDMA 3SDCC 2HYMA 3RPBA 3S2AA 4R5XA 5C07B 2XVGA 4N8VG 3I50L 2IDCA 4ANUA 2IFFL 2R0ZL 3VFWB 4K7FB 5T5NF 1DEEB 1S78C 3L1OL 1QSEB 1JS4A 1CXEA 2HT3C 4JFED 4W6YB 3JWOL 5GGQH 3WJMA 1J8HE 1CGSH 4GI6A 3SKUD 5HTSA 5I0ZA 2XWRA 2A6JB 4WNSA 1OZTG 1RU9L 1UCBL 1DJWA 2BHZA 2FEEL 3WDIA 3GMNA 3A67L 5EORL 3L4YA 4JDTH 5TF1L 4LCWA 2R0KL 4I3SL 2YZ1A 3RWEB 4HLJA 4XO4A 4E5XG 4FQIL 3UOAB 3TN0D 4ZZFA 1FO0H 4G2AA 3UTZB 1G87A 3HAEG 3BMWA 1BVLA 1JHLH 1TNMA 4Y19E 1LO4L 2Y5EA 4JFYB 1FZOA 1DBKL 4UOW0 1BP3B 1RSYA 1P4LB 3DX8B 3T0ED 3DETC 3EAKA 3PG2A 3HPLA 4QD2E 2AEQL 1GJIA 4B9YA 3OR7B 2J1YA 2PTTA 3QWNA 4F2FA 4Y9BA 1T1WB 1VFAA 3RWDB 1CYWA 1JXGA 3S8FB 2XWZA 2IJ0C 2XFXB 3L17A 2QQKL 3MFFB 1DVTA 5CMAB 4JY6A 4CKQA 3M17A 3RZWA 1U3HD 1Y1UA 2E8ZA 3FJTA 4X80L 3BZFA 4OF6A 2ARWA 4PH8A 4JRXA 3PAUA 1AO7E 4Y9FA 5DEFA 1JF1A 3EYVB 4HJJH 5EV7A 4D0CA 5EEYA 3HE6C 3K8KA 1M2VB 5KUKA 2ZYRA 4V2CB 2ZCKL 3NTCL 3CVDA 4HJJL 1HCVA 2YMTA 3MV8E 2NY1D 4PJCB 1DQVA 2AXHA 5E1AA 3OF6A 5SWZA 2ZNXA 3ARGC 2GK0B 5IM7B 1UYWL 4XN8A 2HFGH 1HKFA 4LCIH 2CBOA 3CHSA 3W5MA 1R33A 3THML 3CFTA 2E9GA 1PG7X 3EJJX 3L3KB 1SOQA 3SYPA 4MA7L 4O9HL 4Q6IA 1IGYB 2QVFB 2XWBA 2A9ML 2QFRA 1D3CA 1IGTB 1S9KC 2VJ8A 2NDGA 1RZKC 3NP3A 2F53D 2E7DA 3WXVL 3MJ9A 1GA2A 3IDUA 3RTLA 2F8IA 1PG7H 1E2ZA 3BIKB 3OLGA 3T8XA 3KM2A 1DANT 2J21A 2VUKA 3PWUB 2A83B 5AG9A 1T7VA 1UB6B 3C6SB 2E59A 3UTTE 1MIEL 4QHMA 3GPEA 2LOEA 2H1PL 4MYWB 5DD3L 2QZQA 3FQUA 2YXVA 4Y0GA 3WL9B 1L9QA 1FQ9C 2X4UA 4PUBL 4EN3B 3CX5J 2NMSA 4K3DH 2YAPA 3STLB 2RFXA 5T8IA 2FHCA 1ZVHA 4X4ZA 2AJZA 5F9JA 2WLYA 5C97A 3FSOA 3B5GA 2ZOWA 3A6BL 3GHEH 1YLBB 2I60H 5AVUB 3TTSA 5E4OA 3I02B 5FK9A 1DQJB 4HC1A 3NPSB 3OB0K 1DSFH 1BMGA 1IC1A 2R2BA 3RGVB 3LD8C 3F58L 5TE6H 2FQDA 2WVSA 2V37A 1L9SA 3JZYA 3NESA 4PQXA 3PPEA 3RHWK 3NSFA 1QSFD 3QCTH 4MNQA 3RDTC 1A6TB 1IC0A 1HKLL 4OSUL 5TE7L 1F4WL 2JJUA 3DX9A 3FYEB 2OZNA 1KBKA 4JCMA 4NN7C 5DHXB 3R1GH 1MH5A 2ENPA 3NABH 3JV4A 3GI8H 3HI1A 1BREA 4JN1L 4JFWA 4PRPA 4UIMB 4JM2D 4B95C 3LN4A 3ZBMA 5F9OL 2DL9A 5T3XL 4G70B 2F7RA 4HLZH 3AY2A 1IARB 1KLFA 2X38A 4KXZI 1BQHB 4CC4A 2Y23A 3GTVA 1XF2B 3DUUA 4G6JL 2NXYD 5DJAB 1B3IA 2IOOA 5FHAL 3T1WA 3A23A 2GVYA 2WM0A 4LL1A 4NKDB 1CDBA 2EVIA 4G43B 4XN1A 1UWEL 5D1ZC 3MRPB 1FDLL 4Z6AT 3K3QA 4JY4A 2YUZA 4Q97A 2AP2A 1J1XL 2XZQH 3T5WA 4Z3FA 1YPZF 1BBDH 1E5BA 3WEXA 1RP8A 3V7AE 4CC0A 5KYXB 3FQUB 1N18A 4APQD 3LS4L 1BWMA 3BHBA 4OZGA 3PP3H 4JG0L 1S7XA 4QXGH 4RX4A 3KVPA 4AGLA 5IROD 3F7PC 3MA9H 1S9VB 3GLAA 3WGUB 4D3CL 1LEKB 1N9PA 1A8JH 2X0VA 4HPYH 3IKCA 3O6KH 4F57L 1NGQH 4PRHD 2OCFD 4JO2H 3PUCA 1EXUA 3EGDA 4R0LA 2XWTA 4NZFA 1KBVA 3B9KA 5D7JB 1LO0H 4DKEH 4UTBA 5C0EB 2OX5A 1TSRA 2BY1A 2YXMA 1KGJA 4DQAA 2UXGA 1TPXB 3X11B 1HXMB 3P73A 3V4VH 1NCBL 4CADA 1R46A 2X9YA 5LBSH 5ALCL 3RNKA 5D1QD 1RIUH 1TTRA 4U1KB 5L7XL 1FP5A 2YGQA 1K4CA 1ACCA 3X12B 1I8IB 2QELA 4L48A 3W3BA 5IR1A 1TQTA 2OMXB 3C09B 5GGSB 2M26A 3GS4A 3D12B 4GIPD 3P4MA 2K78A 5BJTA 1PYWB 3GBMH 5J89A 3RVXD 2Z7ZA 1F3DJ 4HS8H 3K4DA 4NHUB 3WAJA 3EADA 4OD3H 3GSOA 2BSSB 3DYPA 3TA3A 2NPLX 3LZQA 4HEPA 1EZSA 3CXDL 1E9QA 4ETYA 1W16A 1M7IB 2JLLA 2XWCA 3MNZB 3U0WH 3WD5H 4BQBA 5HHXL 1OB1A 4WJKB 4LHQB 1G5AA 3BEWB 4MZ3A 3RNQB 3U36A 1S9WA 3QXWA 2HXAA 1A7RL 1LDPL 3MBXL 4LEXH 1K6QL 2AV1A 4FQHB 1XEUA 2R0WH 2EDWA 1IC5H 3UTPD 2A73B 3TVMD 4CN4A 4YNYA 5K59F 5DA4A 4POZD 2MHAB 3Q8CA 4ZTEA 5H94A 3KYAA 3OJ2C 4QPEA 3UP6A 5GS3A 3WIFB 4UIKL 4AUUA 3ME0A 2OULB 4PJEE 5DVLA 5FWRA 5GJTH 3VJ6A 1BD2E 1FV1B 1HCYA 2AJUL 4GH7B 4MAUL 3L5WA 4WHCA 4HPOL 3MLUH 3TBTB 2R2BB 2OMUB 2L7UA 1FAKT 2NQDA 1YYLL 3OJVC 1K2DA 3I02A 2JCCB 4N22A 1CF8L 2DICA 5FCUH 4F33B 2VZ3A 5GQBA 1VIWA 1LWRA 2BZDA 4OKVA 3WIAA 5IB2A 4DKFL 5I71B 3P9MB 4NO0D 1E4XH 4P57B 1DLHB 1J88A 2FJFB 3G5VA 1B0RA 3IFNL 4Y19B 3I6GB 3C60C 2B16A 4Y9EA 3GNML 4YSAA 4XMKH 3BW9B 2DQDL 3FQWA 4I4WA 4MD5A 2WY3B 5J4MA 5IOPB 4NCC2 3M7FB 2PETA 4XP5H 4NUGH 3M45A 4JE4B 3WKQA 1DQML 5EEZA 5GJSH 5DEJA 3DPBB 1NAKL 4XPFL 5JW5A 2H3KA 4P5MA 2ICEA 3H42H 3ILPB 4PWIA 3NRQA 3WTTA 4LOFA 1T03H 3KPRD 3MLXL 1E27A 1CK0H 4BK5C 1DBBH 1ZHLB 1Q38A 2ARJQ 4QI3A 4OZHB 4RGOH 3V2AR 3U36B 3R8QA 1U8IA 1DJHA 4LXFA 2HN7B 3PWJA 5B1JA 1OB1B 2IAAC 2VR7A 4XGZB 2NW2A 3WY4A 4H1LH 1R6VA 3VWJB 2IV8A 3MV8B 1QUPA 1PPIA 3M07A 4LSTL 1DQQB 2VCOA 1D9KD 4OM0H 2IANB 1NCAL 4ACPA 1YAZA 4JRLA 3OZ9H 4O00A 3B9KD 2YPLA 4TTGA 1ZA6B 4CVZB 2UUDK 4PY8J 2AANA 1QATA 2NX5D 3AQDA 2HG5B 3OG6B 4YDLC 1S46A 2XQBL 2H26A 3L81A 4BSVB 1NDGB 3RWJA 3TBSB 3QUMH 4LLWA 3ECQA 2WINB 5EO0B 1MCPL 4ELMA 4HIQA 3MC0A 4JB9L 4XXWA 2A9DA 5D93C 4WO0A 1WHOA 2H6OA 3FSAA 4M4PA 1OP3H 5IW6B 4OLXL 2FO4B 5D6DC 1L5GA 1OAYL 2PPAA 4HKXB 1F4YL 1HOCB 1HZHL 1BOGA 1YEGL 1OP4A 3K8MA 2JH2A 4FNQA 4MVBC 5C0EA 4JZNA 4LLUA 4JMNA 3NIFE 4XCYB 1QFPA 3V5HB 3DGDA 1E2WA 5ELIA 5HDRA 3WKMH 1BQLL 2RACA 3GI9H 4LIQE 5IB3B 1ZK5A 4WWNA 4L3CA 3BCFA 1TOXA 1OP5H 4M61A 2DQEH 2RHEA 1P9MC 1CT8A 4KTEL 2VLKB 3QDHA 4OLYH 4Q74A 1IGFH 3VGBA 2V9TA 2BVPA 3CJJA 4KNUA 2FIRT 2D7PA 5BJTB 5JZ7D 4ODXA 3KBHE 3U30C 4APXA 2OZ4A 4ALAH 4EN2A 4BQCA 1I1YA 1QSEA 2WQUA 3GXIA 3HRZB 2KYIA 3KH4A 3NZSA 1A6UL 5ISZE 5F7UA 4LAJH 1LD9A 2MTPA 2XPGB 2LVCA 4I9WE 4KRNA 4L9LA 1C9SA 3MRQA 5G5DB 2EDMA 3CXDH 3B2DC 5E8NA 3I85A 1NAMH 3OMAB 1U8QA 4NWTL 3RIAK 3L3IA 3F5WA 2E86A 1ZS2A 4HLZG 4Q2ZB 2BVYA 1XD1A 5BPPA 1T5XB 1D7DA 5I1GH 4DCQB 1Q9OB 4HCRL 3NCYP 5F9WB 1IGCH 3UJIH 1N6UA 3X17A 1NC4D 4HUKB 3DO7B 4KZEL 1AZCA 4JFDB 4R4BA 2Q3AA 2WUCH 3TNNB 4OLWL 5I0DA 2D4DA 5FV2A 1ZXQA 4ZXBD 1AYOA 4HJ1A 4LCCC 1MH5B 2V0AA 1OGTB 3FB8B 2WSPA 3NPSC 5CGTA 1R19A 3MSPA 3V6OE 4B9PA 4RWHA 3WKML 5ALCH 3H0TB 1MI5A 4Y5YC 4YAQA 1SF5A 5CJXC 1NIBA 2V2WA 1H5BA 1TYRA 1QFWI 4JO3L 1FN4A 2BZ7A 2W60A 3CSGA 2D7MA 2OMVA 3E8UL 1YVLA 2P46B 1ZWIA 4GJTB 5ANMB 3MOBL 2ODHA 2Z6FA 4PCYA 4NBYB 3PIQB 1JV2A 4Z7QB 5BZDA 1YUHB 4GBXD 3ABKB 3L3DA 4X99A 5JHDA 1BIHA 3OKOA 2ZYIA 4AM0A 4NEHB 2IFGA 5FKPA 4KMQA 5DHDA 5KS9F 2AJYH 5F8RC 4KVCL 4EVNB 2FWUA 4JHAL 4NZRH 4PJDB 3QIBD 4WKZB 1XF3B 3PL6D 2EXWD 1GYUA 3LSOA 3O45A 5EBWA 1CDYA 4KOBA 3QNXB 5DYOA 1E4KC 2NOYA 4NQCA 1I3RB 3MCLL 1UEMA 1S3KH 3X14B 1MIML 1RZJH 1BXXA 1EX0A 5D7IA 4EI5C 1VKXB 4YJZL 1ZLVK 4L3AA 3NDYE 2RMNA 3TJPA 3G3LA 3LIZL 1PZ2A 3DX0A 2XZZA 1S78D 4OVVA 4CGTA 5I6MA 1XF1A 5FB8A 5F88A 4U1SB 4XCCH 3GS7A 2A9CA 2J88H 1TZHB 3DJSA 4A1RA 4F8LA 2AJ3A 1LO3L 3ETSA 3VI4A 3EYOB 1EIBA 2BSEA 3M8OH 3MMEB 1FC2D 4K0OA 2UZXB 3KEDA 2ZPKH 1HJCA 1NFDF 4CBPA 1MREH 3O9WD 3L4XA 4W9JC 5SWQB 1DFBL 3Q9QA 3QG7H 1AZUA 5KVDL 2R2EA 1DQLL 2XDHA 4W9ZA 4B7IA 5IEKB 1LMIA 3UPCA 2Y1YA 4Z7AA 3GNMH 3ZTNH 3Q9PA 1F2XK 4FTDA 1UFGA 2ORBL 2FJHB 3C60A 5IB5A 4NJ9L 1URIA 2FYVA 5FYLL 4XP9H 1YMHA 3E6HA 4WDIB 1F1DA 3G9VA 1S7QB 4P04A 3HE6A 4PTUA 3O2WL 5EOCJ 2R15A 1XCQA 4DGWC 4HIIB 2C7UB 4FE9A 1WFUA 1CDUA 5GS1C 4M8VA 5DRWB 3MLZH 4XBEL 4KK5C 4U3SB 4R96A 3EFOA 4IKLA 1S4IA 4ZMAT 1EZVX 2AJSH 3QEGL 5DK3A 1JG9A 2QHLA 2DY2A 4LQ1A 3SBWA 5KJ4A 4Y4KD 5LO7A 1GTNA 5EHFA 4IMLB 1SJHA 4UIKH 5A16B 4M62H 4AQEA 3EOTH 4ZMNA 4YOKA 4YDVB 1ZLUH 1NQBA 3MXVH 5HDBF 4U1HB 1EA9C 1JWMB 1C5BH 2XX1A 4HW6A 3CPUA 4FFVC 1H6FA 1T5XA 2B59B 1AHWB 1NCGA 5IESL 3REVA 1UA7A 4GT0A 1IFHL 4FX5A 4KK8D 4WFFE 1XAUA 4ZX3A 3BQUA 3P77B 3FMGL 1N0XL 4H7VA 3GSRA 2K9FB 1PLCA 4QT5B 5B1KA 3W0WD 5F70A 5L9DL 1KY6A 3QVAA 1AGDB 3QJOA 1KPRA 3R06B 2R7EA 1QBBA 1XGUA 6FABL 1UOKA 5TQ0H 3CSBA 1D9KC 5IJCC 2GBVA 2ICES 3R06A 2VLMD 4G83A 4Z7VB 5HXMA 3V0GA 1D6VL 1F8TL 3HC2A 4HS8L 3VFMB 3FC8A 2WTRB 3D0LB 3MKKA 1Q4NX 5EC1B 3ZE2B 1G7HB 3X3GL 3K8LA 4ODVL 4U6XB 5AW5B 2V2XA 3BYYA 3DGGA 2HPTA 3CUPA 4M61B 4BZ2H 1KCRH 1YPZB 1X6LA 1IQDB 1T0NB 2WVVA 1XBDA 3D85B 2J55A 4H1LG 1EBAA 1RXLA 3EJYD 2R51A 4F93B 3CSTA 3MRJB 1J18A 4I48A 2P42B 4XP4H 2Z1KA 5DO2C 1UC6A 1N8ZA 1MFBL 3UZVB 1KLGB 5DVOA 5L88L 3R0NA 3T4YB 4PWKA 2VDQB 3ROLB 1JPEA 3MJ9L 5J6GB 3ML8A 4FABH 1F3JB 1PY9A 2ADGA 3MRBB 1OSPH 4N8VB 4PRBA 2Q86B 3MCYA 4NAJA 2WO3B 3WENA 3V0AC 1FVDB 1GPOH 3WUWG 4YDJB 2O5XH 5JR1H 4PPTA 1G1YA 5C08B 1WAPA 1YNTB 2PXYD 1S8DB 3DLQR 2WJ5A 2UZIL 3EW3B 1FLRL 3DRTB 5EO9B 3UZEA 3RX8A 2Z8RA 4ZJ9A 5HI3D 5DHYB 3QS3A 1I8IA 4MLSA 4ZSOB 5FCSH 1Z0MA 4EI5B 2OMBA 4OLZH 4HS6A 3D4YA 3BKJL 3T8VA 4BHUA 1HX0A 3ARQA 4R4FH 5FO8A 5DK0B 3HNVH 4NERA 1FL5A 4I3SH 4OIIL 4TLSA 1P5UC 3ASOB 3MLYH 3K1KC 3QUMA 4AL8H 5KSBA 4YGVB 5DK0A 3VD5A 3L13A 3MRMA 5IG7B 2NSMA 3NFNB 4ZX6A 1B6DA 4AEEA 4CMHB 4FOMA 4GG6B 1XQ4A 5J9PA 2FQEA 4PJIA 2OA9A 4RWYL 2DQFA 3UYPB 1H8LA 4H26B 2XN1A 5SX4I 5GS0C 5KN5B 2K6YA 2G3XA 3B7SA 3EYOA 2PTVA 1O6VA 1AZVA 1HAUA 2VDQH 2VLKD 3C6EA 4FYRA 4OCNC 4PRHA 2Y1VA 1CF1A 1VB9A 3LDBB 5GHWH 3TEXA 3D09A 4EXPX 1TIUA 2YXFA 1UB5A 5B1JC 1OCWH 2CCWA 3AM8C 3TYFB 2NZ9C 3ZR6A 4BHUI 4WI4A 2OS7A 4HXAL 2VR4A 1QQDA 3U9UB 2VXUH 3O4LB 4OY9A 2TRHA 2UZPA 3PDDA 3ZW3A 5CIPA 4FZ8L 4LKXB 5GGVL 3SDAD 1AXTH 4OI7A 2FWOA 2FJFA 1UWYA 4HK3N 5AOLA 3MLTB 4KKNA 2B39A 3K2KA 3C60B 2VDNH 4IOFD 4Y4KA 3PWPE 4WU7A 4N2BA 3RVVD 5TTRA 3RWCB 1VPOH 3NYKA 5IM7A 3TT3H 1V3LA 5DF0A 2ZG1A 2AZAA 2E8YA 5EBMB 1DR9A 4OD1H 4P5KA 4WTZG 4AYSA 3I75B 5E9DD 2GJRA 4AQAB 5I1GL 3MGTB 3DRTA 4RFOL 5MENE 2DQTL 2V3EA 1CFMA 1YNLH 5EZOL 1MW3A 2R7EB 3S5ZA 3WJLC 4A6YL 3UTQB 3DXAB 3TA3C 3IJEB 4L29A 3WIIL 1DJZA 1I82A 2BXZA 3BAJA 5DZ9A 4BFJA 4DEUA 4LOUD 1U8LB 5BUPA 4HJIA 5KYNA 2CH8A 4ANWA 3P4NA 5FYKD 1UOWA 2PF6A 2C3WA 2JKSA 1P9MA 2ZX6A 5I17B 2F74B 5C0BD 2GHZA 1IAMA 3TWCL 3F84A 4MNGB 4G8EA 1D7BA 4JO4H 1R1CA 2F5BH 1FIGH 1A25A 4JKWA 5KS9B 5IW1A 1OLLA 4ZMVA 4NQSB 5E2WH 4MASA 1MDTA 1BXVA 3SE3C 1G7PB 1W0VB 1GPOL 1S9VA 2F1EA 1BAFH 1G5GA 5KSUA 2A9MH 4N6RA 2ROXA 2NY7H 1KPVB 2DAVA 5F7WC 2EUWA 4PJBF 3NGBB 3CN1A 4GT7A 5DRWA 1D5IH 1QOKA 2K0RA 4PRDA 5EC1A 2WLLB 4BK5A 4YBHA 4J8RA 1ETZB 1A0QL 2VN4A 5I19L 4E41E 5IT2L 1B0GB 1KEML 1K8IA 4L3ED 4HQQL 3ZO9A 2GSGA 1DUZB 4PV9B 1AQDB 4R7DA 2A77H 4WWKD 1A1MA 5DRXB 3CBRA 3OTTA 2BS9A 5IR1B 1UXWA 3NIDF 1TVBB 5JHLH 1W72L 1U8CA 2QKIC 2FJHA 3D2UD 1ETJA 4LP5A 5IB5B 2EKSB 4BZ2L 3RNKB 2P5PA 1OSZA 1BQ5A 5JIQA 1AKJD 1PAMA 3TZVC 2QADB 3B2VL 3VQ1C 1A6WH 4QLRA 4BK4A 3C2AH 4HG4K 2XWBB 2YEQA 2YOCA 4QAWA 1FZJA 1LK3L 2FB4H 5ALBH 3SKNA 4ZUVB 2J8UF 4R7XA 4WEMB 3T6ZA 3GSNB 2X70A 2Q5BA 4XNMA 1GZHC 3RWGB 6FABH 5L2KD 1FJ1B 2JFCA 1RZFH 2NY4B 3KLLA 4PJ5A 5DLMH 5FB8B 1CU4H 5AUMB 4P8QA 4Z95L 3GMPB 1D5XA 5TH2A 5LXGL 5INCA 1YNKL 3T2OA 5JPNA 3W1ZA 3VYOA 1LD9B 3UTQA 2P44B 3UERA 4G7SB 4PHZA 3HI6H 4R3SB 2FAUA 3O41A 2AVFA 4PV9A 5J12C 4XPBL 1SYVB 4RQQB 1R3IH 2YPLD 4ODXB 5I1AB 3QNXA 1GVIA 5T5NG 5TF0A 4CC1A 3B2MA 3MN8A 2ZSWB 4X7SH 3H9SD 3Q5OA 4A04A 3BSZH 3QFGA 1N12A 3MRKA 4UQDA 4AGOA 4K94L 3UEZA 5JUEL 1KTLB 3B8YA 2XXMB 2DYPD 3O11A 2ADIA 4I3GA 2NY5C 4ZPVB 1BM7A 1LNUB 4LAQH 1H9DA 2VLJA 5E8EA 1A9VA 4FTVE 1JV2B 1WAAF 3CFJA 1KB5L 3SGDH 4DGVH 3FU5A 3BVNB 5I2IB 4JL1A 4F8NA 5EF3A 1EGJL 3RUGE 3QH3B 3LKRA 4AVJA 5B38A 3EYSH 4DGVL 1XCTA 3U7WH 4ELME 5DJ2B 3BPNC 1N3NA 1EVUA 4FQJH 2CIIB 5L2KE 1UD5A 1S7UB 1PKQB 3UO8B 4PVMA 2A6DA 2JIXB 4MJ5A 3NCFB 3ZGIA 2Y5QA 4KDTC 2MWCA 5FLUA 4ABQA 1EV2E 3L7FA 1M57B 1A14H 1HL4A 3CMOL 2EE2A 5L4IA 4YHZH 4OFDA 4K07A 4HC1H 5B22A 1BJMA 4G82A 4O4YH 5F71A 2YAMA 5C0RL 5HYEA 3RZCA 3BFQG 5ICZB 2YLKA 3PGDA 2F8VA 4MJ4A 1NANH 1AO7B 3H9SB 2LGNA 3LRGA 4LRIA 5DFAA 3MV8A 3ZIYA 3WKPA 5KAQF 2EDFA 2R1XB 3MUY1 4MCYA 2FWSA 4WEUD 4P46B 1AZBA 1DZ0A 4PJ8A 3DK2A 2F0CA 5TGBB 3X1EA 3MCLH 4J23A 4M1DL 1F6LL 3K80A 5I8EA 3SY6A 1IQWL 5GZNC 4ORGA 1XIWB 4NHCL 1H6TA 3OC5A 3P30L 4HIXH 3MV9B 3CZFA 4QRPA 3RQ3A 3SY0B 5JQIB 3HCVB 4F7CB 2X4NA 2XHNA 4H0LC 3WNOA 3CZNA 1OSEA 2CDGB 4YBLC 4MDJA 3ZX1A 4KMTL 5K39A 5KBKA 1WA0X 3OM3B 4FFYA 4IBZA 4DTGH 3V7MA 1DDHA 5CFHA 2QSQA 4WSKA 3KLAB 1ZVNA 1CE6B 2ROYA 5LQBH 5CILL 2FJSA 1QP1A 1D9KA 1WC7A 5JXEC 1I9RH 5CSZA 2YFOA 4KAQL 3SCMB 1FVEB 3FB5B 4M5TA 3RVWC 4J12A 5BZWB 2Y7QA 4LVNB 1NFKA 1M05B 1T2QL 5A7EA 1J5OH 1LO0L 4PM1A 4NOFA 4HJGB 2D03L 1KTRL 3SJVA 5GGSA 3RUGF 4NRZB 1NGQL 1JZGA 5BOPA 3D3VA 3X12A 2VE6A 4HJGA 4X0KA 2YPKA 2X1WL 4R7LA 4AG4H 5F7DB 2QVIA 1SJXA 1GYVA 4CMMB 3IFPB 1ET8A 3RPKA 1R4XA 1RUQH 4N26A 4X83A 4IOSD 4C4KT 1ZSDB 3BOVA 2CGYA 4X8CA 4C83B 4XPGL 3NJLA 3RTQA 1B2YA 4BKLA 2Y7NA 4IMLA 5A16A 2VM9A 1DBML 3FH8A 1FDLH 3L48A 4YBQC 1LE9B 2WKGA 3KM1A 4V1DD 4AX3A 2NXYC 3S4SB 4M1GH 2XIIA 4I89A 1HL5A 5A40E 2X12A 3NSCA 1XIWA 3RX9A 1S7XB 2DIEA 3MRLA 4KTEH 4M5SA 3NMEA 3DROB 3WKNA 1P5UA 2Y4SA 3CMOH 4G8GD 4JG9A 2ARJA 3DURA 2X0WA 3OPZH 3S36L 5LWYL 5M94B 2B08A 4RAHA 2MRYA 3EOAB 2X89D 1MQ8A 4HA1A 3D39B 3E6HB 4JE0A 3I9AA 4WGWB 5HDOA 4WW1A 3B83A 4IMKA 1RZJC 3SGEH 4MVBD 3QWRA 5AB2A 4LNVA 3UTPE 1K2DB 5AAWC 2BC4A 3KGUA 2BVQB 2PR4L 3MFGB 3EDEA 2E47A 4QRAA 3GRGA 2Z35A 1COBA 1EAPA 3OKYA 4OZHA 5CZXD 3DVIA 4MKMA 1V7NH 2JIXA 4KK8C 1WWAX 3RE0A 3G6JB 6PAZA 5LDUA 3ULSA 2LVEA 5AVZB 1Z9SA 1MCLA 2DQUL 2LW3A 4AWJC 4EZKA 3IU3B 3OZ9L 3B5TA 3MDJA 5C0DB 1VJSA 4P2QE 5KVEH 1LWHA 3BAIA 4Y89A 5DS1A 4BE5A 2WXHA 3TX4A 2JNZA 4PS4H 5EOTA 2FGWL 4GW4B 2FX7H 2DM2A 3HNVL 1JZ2A 5GZOA 1HYSD 3U6RB 3TEUA 1QPKA 2CHWA 5CU5A 4NKDA 3SPHA 4KVNH 1M7DA 4CMHC 3BP7A 4HX1B 4X8JB 4XP5L 1ULVA 2WTRA 5FFLA 5DJCA 4FADA 4LVNC 3W5NA 4MLIA 1F18A 2VN5A 1U2CA 4TUKL 1QTPA 4APQA 1QHOA 5FA3A 5L88H 2ATPA 4R2GB 4MJ5B 2WTPA 4BJLA 4G7YL 1NCTA 4OBRA 4F7KA 4PRIB 3MJGX 1FNHA 3CFKB 4PJGE 4YK4B 5D5MB 3TJEH 3OKDB 4AMWA 4MAYD 3O8XB 4UB0L 5J3HD 4G3YH 4AQ1A 1HSAB 2W91A 5DQ9B 1PX3A 3VTAA 1CYGA 1ITCA 3X1GA 4L2LA 5D7IB 1ZHBB 3ZXAC 4WCYH 4Z7UB 2DOCA 2F58H 1CI3M 2WV3A 1CICA 2QKSA 4Q6IB 3NCMA 5DHEA 3BO8A 3FUMA 5EN2A 2QQKH 2ZAIA 4AV0A 3WFZA 1SJHB 4U1IA 4AQEB 1W0WA 1YMMB 3T2PA 4P23D 1YEHL 4GMSH 4KY2A 4YZFE 4JQIA 3FW6A 1FNEA 4Q4EA 5H35B 1BAFL 4LPTA 3RTQD 3MRQB 2VISB 1OCOB 3AFLA 4X42A 4N6QA 5B3JE 1SXBA 4HKZB 1PD6A 5T3XE 1ID2A 5GRVL 1RJYA 4V1DA 1U3HA 1YC7A 3AXIA 2HRGA 1JDAA 4HVBA 1IL1B 1LO5A 2QVTA 3EJZC 4L8DB 5D7KE 3SPVA 2QVMA 4X6DB 4A6YB 1MWOA 1QAWA 5IROC 2E7CA 4FLOA 4RGNE 4HETA 3ZDXF 1P4IL 1IKNA 1EEQA 2ZOOA 1T1WA 1VFAB 4G43A 5B7EA 4FKHA 1AQ8A 4QRSA 1BVNT 1GGTA 2VABB 2EDQA 4MDIB 4JL2A 3VFVB 3MV7E 1DLFH 1M3IA 2ZCLH 1UT2A 3UYOD 1UM4L 4AIEA 5I18L 2AJSL 4XNQB 1H3VA 1DVSA 2JI1A 4E68A 2JV6A 5JXAL 1IQDA 1T0NA 2NT0A 5TQ2L 4K5LA 1VGKA 3KPRE 4NENB 4LCUA 4ESKA 1EMTH 4AZ8A 2Q6WA 1G9HA 1LEKA 3MBEA 1OE2A 1KBWA 4K73A 1OAKH 5DR5L 4XOBA 2UWEF 1NGWA 1DP0A 2Z34A 4ZOCA 2BS71 2BSCA 2R4RL 5HGAA 2H2SC 2OSLB 4ZO9A 4HEMA 4L05A 5H2BA 1MFNA 3LH2L 4HJUA 4Y4FA 3SQBA 3VXRA 2WLNA 1T7YA 3CLEL 1D5RA 3CCHA 4G8IB 4BRVA 4JY6B 4MXQD 4P5KB 5J5EA 5I6XC 1ZT7B 2HLAA 3KJ6H 1T20B 5ID0A 3JVGC 2Y1AA 2YPLB 3IFLH 3VWJC 4IGBA 4NPYB 3V0WL 3BLPX 1J0JA 3KR3L 5HGBB 1U2HA 3EGXA 3EGSB 3UGUA 5A43C 5JIIA 2A74B 2J88L 4FULA 4Y5YA 2VXTL 3ZIMA 4XT1C 2VSDA 1NIAA 3Q44A 1T7WA 1ECZA 4G7QB 4GSDH 2X4UB 3L2MA 3LIZH 2BSRA 2QMKA 3B3IB 3Q13A 1E6JH 5GISH 2Q7YB 5J13C 2MCPH 3NJVA 2CGZA 1DBAH 4UIMA 2ZG2A 3DVGB 1NGPH 1CE1L 4QHMB 3RWEA 2F08A 1WIPA 2HT3D 4HUVA 3KPPB 3NIFB 3KWWA 5I5MA 1QLFB 2PABA 2Q3XA 4D9QD 3GKZA 5F3BA 1SXNA 3BZDA 5C6TL 4JN2A 5CJBA 3D30A 2Y07H 3NG5A 2VKWA 3VXME 3UZQB 2G4EA 4JHAH 4ZUWA 5IKCB 1KCBA 1CURA 4X5QA 2CPCA 1S7QA 4L3FA 4PWHA 3S96A 3OKMB 2PPCA 2G2RA 1UXSB 4TNEA 3EUDA 3WNNA 1Q9OA 1QW9A 5DTFB 2HJFB 2NX5A 3QQ3A 1QVOB 2CJUL 4Q4IA 5E94A 2J72A 4UQIM 5CXPA 3WG7B 5ICYA 2IH8A 4MQXD 1BPVA 1XSJA 2ADJA 4XP4L 5CBEB 3AB0C 3HVDA 4C58B 3EHBB 3SCMD 3SBRA 1TLKA 1E4XI 1CGXA 1JWUA 1XWVA 2VJ0A 3MMEA 4PY7A 4QGYA 1S9YB 2XYCA 4IOSA 2XIBA 4TVSa 3S3JA 4AKPA 5IMLB 3IDIA 2PKDA 4OJAA 4GS7B 3S5YA 3FOMA 5I66B 1YPZE 2ICEB 1VF5C 4FXTA 1FVCB 4KX9A 4PGBA 1V7MH 5KSBF 2DTSA 4YH6A 2N01B 5CLWA 5JXAH 3A6BH 4AH2B 1MAKA 2YGVA 3IDJB 5IJDC 4F9LA 5IVXF 4JFEE 4PRHB 3CDGA 4LVOB 2CXGA 3BI9X 3WMPA 3CSFA 2NTFA 4K3JH 5TQ0L 1KZYA 3RJQB 4ZK8A 4N9OB 1YN6A 1O7DE 2ZX9A 4LPXA 5EU7C 5IQLA 3KWUA 3WBDA 1XF3A 5DJ0A 1GZHA 4P2OD 3X1BA 3BJ91 4AK2A 5KVDE 2ZD0A 4GKNB 1JAEA 2NY0C 3LNFA 3CWGA 2KERA 4LCWB 4RDQF 4UU9B 1V05A 1JZ4A 4HIPA 4Z7OB 3DGCR 5IEHB 1R9FA 1YEDA 5BZDB 1JYWA 4GW4A 4KKRA 4B9CA 3MJ7B 5B4MC 2FX8L 5FM5M 3SKJL 4Q6YA 5HHMB 2AI0H 2OMZB 2UWEE 5D2NE 5EBLA 5C0FB 3DIFB 5D72H 2YPVH 3HZKB 5T1LB 4M1CC 1JZIA 1E5AA 1WV7T 2QR0B 3CN2A 4MXQC 4OCYL 3QEGH 1JZDC 2F53E 2Y7QB 4Z76B 3RB5A 3ZL4H 1JZEA 4ZMYA 5C09E 1QSVA 1R3HA 1WC7B 1SOKA 3P40A 1KYOJ 1SN5A 5D1ZI 1QTSA 2MMXA 1NGZB 4UDUB 4P99A 3CFIC 1PQZB 3HFFA 3FUHA 1YEIL 1Z3GL 1BZ7A 2PO6D 1CLCA 1H6UA 3IKCB 2XBTA 5FUZH 1BQRA 2EEBA 4F8TA 5DHVA 4IHOB 3GRWL 5B8CA 2EACA 4WU5B 1G7HA 1JCKA 2HH0L 4Y2DC 1FGVH 3IXTB 1BEYL 4OZIB 2K6WA 3H2WA 2QPDB 4J4PC 1SHWA 1CQKA 3B37A 5JW4M 1FH5H 4GMSL 2ERJC 3S5LB 3AS0A 1B0RB 1QFWH 4JDVB 2AK4A 3FTZA 2E27H 5ANHA 4A39A 1UA6L 3MCG1 3C6LC 1DL7H 3LPFA 3BYTA 1ZPLA 3MLVL 3RFZA 4DW2H 5DUPL 3RWHB 1JZ8A 2JKNA 3AMKA 4QRRE 8CGTA 1C8QA 1C5CL 4P2RD 5FYJU 2NDFA 2NY6D 2A0LC 1TZAA 1A7NL 1WYJA 3EKCA 3DX1A 4Y2OA 5HI5D 4IOIB 3NEXA 2ZOKB 4H25A 4N5EC 1QHPA 3W2DL 4Y5XC 3AU1B 5JXED 1YY9C 2P24A 2QZ5A 3FCSA 5KJRH 4QOKD 6CGTA 5IP4A 2DMGA 2DQHL 2R23A 1HSAA 2YKKA 4J6RL 3VB8A 2R0LL 2EDEA 3QDJD 4C4KO 1Y6MR 4BRJA 3RWFB 2VWEC 2ENYA 1U91A 2H3NA 3RWJB 5HVFB 4XN7A 1U8HB 2NQ3A 4P05A 4XN2A 2Q2LA 4KXCA 4HLEA 2X4PA 4PP1C 1EJ6A 4ODSH 4CSZA 5I24A 1HH9A 2FGZA 1NIFA 1OHQA 3MRNB 2O61B 4APQC 5I9QB 3TH4T 1PEZA 3BKYH 5DO2D 3QIWA 4ODUA 5CNHA 4M7JH 4NI3A 2V17H 1KGUA 4I9XA 4LL9A 2ZX7A 3GSOB 4L4VE 5J6HA 2WVUA 3QZBA 2WUCL 3US1A 4XP1L 2OTUB 2CO4A 1YUHA 4AYMC 3FPYA 4HWBL 1CLVA 3CXFA 1Q9WB 2JJSC 2OTWB 3WKYA 3FL7A 4NC1C 4WFHE 1A5FL 3HHRB 4S1DD 4U1GC 4DFHA 2ICWJ 2NY2C 2AJ3B 4IIQC 1QW8A 1RJLA 1ZT4A 2WXJA 3C5ZA 4UT6H 1DQIA 4G7RB 2DBLH 1O7SA 4LO9A 4M5YL 2PWGA 3RILA 4MNQB 1H15B 1SMAA 1X9QA 1YNTF 3RTQC 2GYSA 1HAWA 3T0EE 1MAMH 4WENB 4CAGA 1G7IB 4OLVH 4QO1B 4ZZKA 4XNDA 5HDQL 3ARVA 4MB5A 1X4XA 2VDKB 3MRMB 2D31B 2B1AL 4JRYB 3OXRA 1I4FB 1XGRA 3EBGA 4DK6A 2W88A 2ZUYA 1KDIA 3CPLA 1KCLA 4QXWA 1OP3K 3ESUF 4LLAA 4GMTL 3TBYB 2VN3A 1FNSL 3R7RA 1I4FA 4BK8A 4KQ4H 4E9LA 4L9LB 4Q9BA 4PGDB 2IAMD 1U8MB 2X6MA 3GGWB 3SSGA 2CQVA 3BE1H 5LBSL 4ETQA 4FFYL 4PJ8D 2O6FA 3CXHK 2PO6A 4X6DF 1PZAA 2D7TL 2VXQL 3FTGB 2FHFA 2OYPA 1X6NA 1ETZA 2P5WE 1J0HA 1F4YH 2CDEA 5KYWB 1N3NB 1GY2A 2X42A 2WCPA 1XL6A 2BNUA 3QJFA 4PJ9A 5FYLE 4CA4A 4N2GA 5I1KH 4A7QA 4F15B 4AYBA 1BAWA 1VADA 2XQYK 3BRGC 3IS0X 4L3CB 3IF1A 4YLBA 4PJGA 2AJVL 2ZXCA 3O8XC 4KPHH 4PJ5D 5KVGH 2JJVA 3DRQB 4LQFL 4CDGC 1CJYA 3MODH 2AJVH 1GC1C 3S35L 1N6QL 4XMUA 1FNSH 1NFIA 4FQQB 2J6EL 3MRKB 2J3SA 4YQXL 2CLVA 2X44D 1E50A 3BESR 2P5EA 2X10A 1HS6A 3IJEA 4L29B 4ZFOB 4LIQH 2DQCH 1EFQA 5CJ5A 1BFVL 4N1EA 1LQSR 3E80A 3FO1B 4YDIL 1X4YA 5HVGB 5D8JH 1RFDH 2ZIDA 3QUXA 5E03A 3WHE1 4JFPB 4DESA 4AMKH 1GGCL 3H42L 2GJJA 5HVHC 5JW3H 3HI5L 3PPSA 3TEZA 3BX7C 3CH8A 4XVTL 3T2LA 1U3HC 1SN2A 2JWYA 1B0WA 3HPLB 3AG3B 4QJ5B 4IOIA 3L3JA 4P5RA 3BP5A 2V9UA 3BUPA 4OLVL 4KK5D 1T21A 3AVEA 1MAML 1DQTA 3LQZA 4YHNA 3VXQB 1MEXL 1JGUL 5IHBA 1N2RA 4JZNB 3QIUA 4K7PY 1BVKB 1TVHB 4M8QA 2H8PA 2GBUA 2GFBA 4OZGE 3K6DA 3AREB 4HD9A 4R96B 2DKMA 3QAZC 4JDVA 1FIEA 2FUTA 3FCUB 4AEHL 1UWGH 3VM5A 1E3XA 1R5IA 3G5XB 1QLRB 2FECL 1EANA 3AADB 4PJFE 1Q1PA 1YEKH 3QFDB 4E41A 3EO9L 3EBHA 1DEEA 4PLNC 5IG7A 4NQUA 4BYHA 1NPUA 4G42B 1SF3A 1U3JA 3C8KB 5I0WA 1XZ0B 4PWEA 1XGRB 4R84A 3FO9A 5TDPA 1TZ8A 2FBOJ 4R83A 1PD0A 2CCLA 3QP3A 4MWFB 2OMWB 5DUBB 5DD6A 1A3RL 2UY7B 1ZGLP 5IKCA 4O02H 4OCSL 3MV11 3PL6A 4IOFC 4JPKH 5H4YA 4OZIF 3ZK0A 1OEZW 4ZUUB 4OW6A 4TSAL 4PBVC 2DJUA 32C2B 3OLEA 3ULUL 2X3BA 1P7BA 5E6IA 3OR6A 3O81A 1R0AH 3IN0A 1QI3A 1DQJA 3RNQA 3B9AA 1W72B 4JQVC 4WI0B 4AK1A 1CGYA 3KCPB 3UROR 3SJVD 5M95B 3KPRA 5KEZA 3STZA 3RJDA 3WUWB 4F3FA 5GXBB 5ITFA 3OJDA 4NKMA 4WI0A 4PJDE 1L9OA 5I19H 2AXJA 3D0LA 5JHDB 3FB6B 1CN4A 1M56B 2F5AL 5FYJH 5I1AA 4R2GD 1EK3A 3OMZA 2JELH 2A2QT 2OMYB 3MUJA 4GRWE 4YC2C 3SE8L 3TCTA 4WFGD 2VRAA 3TL5A 2ZP9A 1VERA 3W57A 2A7BA 1G4RA 2FIKB 3MODL 3LJ3A 2BY2A 3WJJC 1NCJA 1T6BX 1NJ9A 2A9NH 3HG3A 1KYOK 4QT5A 1TTAA 1I1FB 5FDWA 1JZ6A 12E8H 3BFWA 3CFUA 5FUZL 4JHWH 3VQ2C 2EEAA 3P02A 1BLIA 1AHWA 1IU1A 3VMPA 4Z78B 3GUTA 4GAYB 4LSPH 5LCVL 5MEPA 5J9PB 2EYRB 4NKIH 2XWTB 1UKQA 4OFQA 2F19H 5TDPB 5MI0B 4P23A 5DQJA 2GW5A 3NRFA 4S0SD 1PKQE 3LRSA 3IETB 2G2NA 2VABA 4YLQT 4NBZB 3EH4B 5GSRA 3KHQA 1TNNA 4ZD3L 5BVPH 1D5IL 4L4VB 5CD3A 3SE3A 3ZE0E 3FT4B 1UXWB 3OX8B 4E36A 1AKJB 5JORA 2L7EA 3HZVB 5JTWA 3BLKA 3FQNB 3FT3B 3I50H 1GJWA 2JJTA 3IE4A 3LN5A 5E1GA 1Y18B 2PUQT 4OZFA 5ADOL 1E4JA 5E2WL 5D2LE 2BVPB 1HHKB 1TLMA 3FU6A 1HDMA 3FU8A 2E76C 3D51A 1UOVA 3SBQA 1N5AA 5DHVB 4LEBA 1JFQH 5DRNB 5EZIH 1SEQL 1PZDA 1EEYA 2D3LA 1TVHA 4M8QB 4PJ8C 3JV5A 1T66D 4ZFGL 4LSSL 4FHJA 4IRSB 1QD0A 4OZGF 4YHNB 1EBPA 2NT1A 2V5TA 4ISVB 3FFDA 2KMWA 4G9FB 1E8ZA 2QQNH 3V5DB 1XXFC 1INEH 1XL4A 1G1CA 5CGBA 2Z31C 2KZWA 1PAZA 2C8NA 1CTOA 1MCEA 2VERA 3EDDA 4KNTA 5E6ZA 1MCIA 4F2MB 2I60L 4F1ZA 3GHEL 1NANI 2F1AA 4G1MA 5GZOC 2KZKA 2CR3A 4PREA 1YEEH 1UJ3A 2FT8A 2GT9A 5F7FA 3ULUC 2CO1A 2E4TA 3VRJB 2YBGA 4IQHA 4Z7WB 5E6RB 3VYNA 3BXNA 2BO0A 4OZGB 3U9WA 2LFGA 4XPHH 4OCXH 2OP4H 4JO5A 4JKLA 4Z7WA 5CEZD 4OV5B 4D8PA 5IFHL 2DKUA 1HZKA 5J7CC 5LNGA 1JXKA 2J44A 3FH7A 3KXFE 4N90E 4OFPA 4U7SA 2F8OA 4S1DC 3ZHFA 5B3NA 5K9KB 3K4AA 2AJZB 5F9JB 2WANA 5GIRA 4O2CB 5FA4B 4M48H 4AM0B 1DJIA 5JR1L 2SODB 3KYOA 1E6JL 1A4JB 2Z4QA 1LEIA 2ZXDA 1S5IH 4M7LT 5B1CA 3SDYH 5ICUA 1YG9A 2R0LH 3CFNA 2J8HA 4DJMA 5LJYH 2JIXD 1JNLL 2L7JA 2CM6A 1T7ZA 1SMDA 3M1BA 5IQ7L 4PW9A 4KROD 1KTDB 3L3OB 4L1BA 4AC2A 4PRPB 1CDHA 3SB3A 4OGYH 3MGAA 2DMKA 3CZFB 1BFOA 4RSVA 2EDLA 1CBVL 4ZS7H 4HMEA 1ZVSA 3FUEA 5EG6C 1C5CH 3DX9B 4WWPA 4XO5A 5IFAH 3SO5A 3QAQA 4PWFA 3FU9A 4Z5RB 3T0BA 3C08L 3N85L 5IZ7A 1V3MA 3HS9A 5D1QC 2E27L 1U8MA 3D08A 4GKOA 1XBRA 4PJ6A 5I1IL 1AGEA 1I1RA 4HFUH 3PQYD 4OKVB 2EVJA 3Q5YA 3U4EA 1VLXA 1YY9D 3SKOA 2ILLA 4JZJB 4UQBA 4M7KH 5KVFH 1QKZH 3UABA 2IPKA 3SYQA 1XIWD 5DQJB 4N90D 4L4TB 2H0PA 5FOJA 2B7DT 1RUAL 1A02N 1OSPL 1FFNB 1IM9D 1MI5E 1MW2A 3CXHJ 3BUQA 4HJ0C 3D39A 4EI5A 2AKRA 4LLQA 1F58L 3GKWH 1OGPA 4POZC 1PSKH 4GLRH 4FFZL 4PI0A 2E6JA 3KPNA 3TFBA 4QRBA 5C2UB 2XV6B 3IRZA 2MIZA 3Q2CA 2QQNL 1KYDA 3F62A 1ORSA 2F7PA 2BHUA 2CMRH 3NIGB 3PWNA 2YAOA 5EDXA 3MRBA 5CIPH 3KWWB 3HC4H 2ZYSA 3RAJL 4NUJB 5BV7B 2FE0A 3JUYA 2APFA 4M62L 1KCSL 5KG9A 3HUJF 3OKEB 3U9PH 5CEZE 4QKXB 2R39A 3MAWA 3QDMD 1J8HA 5GRJH 2VKXA 4YSPA 3LQZB 4JPSA 4GW1A 3MJ6A 1ILUA 3OHMB 4LE8A 4PTTB 2XY1A 4PD4J 4C56D 4C59B 1YCSA 5D1XD 4UINH 3VTTA 2E3VA 1YPZA 3QDGB 1U30A 3IXAA 5I75C 3TF7C 1O5DT 3DHUA 1A9BB 2RTTA 2V9RA 2NLJB 2YQGA 4Y16A 5LGJA 2LQRA 2ZSWA 4KO6A 25C8H 3SO3C 3S5LG 4FI7A 2I07A 4EEEA 4EO5A 2C9RA 2IADA 2ZCZA 3MGOB 4P5TA 3W9EA 5DLLA 5LBGA 4KHXL 4ZAKB 1EDHA 5CZKA 2W81C 5GGRY 5H37H 5C0CB 3VXPA 1PSKL 3FCGA 5JNYB 2HWZL 4W9HC 2VSMB 2OSLA 3LZFL 2Z3FA 1KPRB 5E4AA 1Z9OA 4V33A 2AK1H 4K7FA 2A4CA 2APVA 2KLTA 3V8OA 5B3SB 4LSPL 2FT7A 3DOIA 4QNPE 4WKXA 2WXNA 1KCUH 2ZUVA 4QTHB 4ONHB 5T3XD 3LHPL 3C8DA 2VGLM 3GRBA 4EZLA 1LO3H 1OM3L 2VDOH 5IGXL 1JTOA 2J1KA 4HZLA 1ND0B 1TFPA 1QFUL 1K5WA 1P5VA 3SE9L 2WYTA 3ARFA 1IAKA 4JFZL 1Y6NR 4GO9A 4XZUB 3OSVA 1TTBA 2PXYC 5HHME 5IWLC 3TBBA 2X4RB 2UXFA 2AW2A 4OJYA 3X1FA 4XAKD 5F1SA 4B3VA 4DEPC 3CN3A 2D3VA 3W81A 1O9ZA 2YGNA 4NRXA 4IJ3C 2FX7L 2WGXA 4RMRA 1I7TB 1SEBB 3JV6B 1T80A 3I6KB 3G5YB 4GUCA 4LCWE 4KWUA 4KRLB 4KRMB 3QCVH 1PZ5B 5D7SH 3GGWA 3EO9H 1JHKL 1GZPA 3N1MC 3AREA 1X7SA 2OCJA 2E9WA 1OP9A 2H1LM 3NH7H 3FTYA 2CDFA 2H5UA 2CLZB 4YSTA 3O3UN 3NACL 4UNUA 3MOBH 2VDMH 2QV4A 4YDKL 2AK4D 2PW2B 1HI6A 3EFFA 4UM8B 4POUB 5C6TH 2DTMH 3W9DA 4ES8A 5IQ9A 1UATA 1KXTB 4MZRA 5JOEA 3S36X 5E6SB 3ULAB 4YHPB 3QORD 2HUEA 3Q2NA 1L5GB 1E0OB 4WUUD 5C3TA 2QEJA 1PKQA 1VGEL 1TEGA 5DA0B 1KN2H 3HMWH 5EUOB 2GQHA 4O5LL 5E8DH 1KGXA 4ATWA 3WAKA 1HWGB 3ZHLA 4LDLB 1Z2KA 3MNVB 3N0AA 2E9JA 5DZOA 3S35X 3FRPG 1C5DA 1TFHA 4TLTA 1CVRA 1MCDA 5IFJA 4J2QA 2OYKA 3CAFA 1CGUA 2I5YH 2E9IA 1ROWA 3GO1L 1YEKL 2FTAA 3LHAA 3IDNB 2WNGA 3VXOA 1O0VA 1D6EB 1MCCA 3CDZA 5GGTA 5ID1B 5JPMA 4HSCX 2WTOA 4G5ZL 4WHTA 4U1LB 4WK2B 3IDNA 4XCEA 3DTXB 3MLWL 5EU6D 4ZW8A 4BA8A 2WXOA 4NHUA 4MCNA 2B3RA 3QI9C 5K39B 1HNGA 3SDDB 4UT7H 2PCYA 3ES6A 4NX0A 5C0JB 2EH7H 2EIZA 1U93A 2HKFL 3RUGB 3F12A 3GINA 1RZ8A 3N41F 4MSWA 4QTIH 2V7NB 3H6JA 2X6AA 2E9BA 4Y16D 5B21A 5KSAC 3CVHB 3DSNA 3HE7A 3WEAA 5L4MA 4NNYA 1I7UB 4JVPA 2N7SA 1ET7A 1OT1A 4YSRA 4TNVK 4GSQA 1WH0A 3T77B 3HZMB 2GC7C 2P26A 1E9PB 4F7MB 3FBKA 3DO7A 1KJ2H 3HN3A 4MD0A 35C8H 3DTDA 4NKIL 5TD4A 1KC5L 3F7YA 2VN6A 2ZSVB 1KXTA 1KXQA 3FQ4A 4AMKL 2ADYA 4PJIE 1ZANL 2Y24A 3L16A 4U33A 2N59A 3GLZA 4JPVH 4P9MH 2KPNA 4A7SA 4QGTA 5AFAA 5F0LB 2X4QA 4XR8C 3V52H 4NQVB 1A3ZA 4RAVB 1FZKA 3BVUA 4WF7A 4F1SA 5JA9A 3H9SE 2OKMA 5FOBA 3F85A 3A22A 1ICTA 4JKMA 1T04B 3BIAX 4M6OH 4AGQA 4YHYB 2DWEA 2R83A 4OGXH 4JFQA 4XNUL 5IVXA 3P0GB 4N68A 4PJBE 2WNKA 1ODUA 2GTQA 2XRAL 4DP9X 3DSNB 4FQLH 2O1AA 4B97A 1BHGA 3GMOB 1NEPA 1IQWH 1QRND 1M1XB 5D7EA 1WFOA 5I0XA 1XB8A 5B8CC 1W8NA 3D25B 4H40A 3D4CA 2V5RA 5C0CD 1BVLB 5DD1H 5KYYB 5F6IB 3CN0A 4Z7OE 4RMWA 2BWDA 2JE8A 5EEXA 2PN5A 3SDDC 3MNWA 3RURA 4E0RB 5JLZA 2YBRA 1X9LA 5F7EL 5MENA 2C5DC 2JSFA 3WO4B 1KB5A 1B6UA 2B9AA 2I32A 4NP4H 2F54D 2H2SD 3IFNH 3I3EA 4B5EA 5LAXA 3CZEA 1IC7H 2FEEI 1DQKA 4Z7VA 5HYJA 1SYVA 2VDMB 4RQQA 4QY8A 3GS0A 3ISYA 3KW7A 1NKGA 1FYHB 4NKOA 4LSTH 1EZVY 4M02A 5EOCH 2H2PC 3ATBA 2IBBA 2YARA 1WRFA 4RGMB 2VLRD 5IBLD 2K1MA 1YMME 4Y4FC 3BSGA 5FGCB 1CFNB 3WLWC 1QSEE 4J3BA 1YEDB 2WZAA 1T83A 1DBBL 3EG9B 1ASOA 1PZUB 5D71L 3QDMB 1OO2A 2F53A 3H7BA 4M6ML 4Y1AB 2BFGA 1KB5H 1QRNB 4HMDA 1WWWX 5DMKB 1J9RA 2NY3D 4BFIA 2IAND 1F42A 4JUTA 2VERN 4N2DA 2NCMA 4IU2A 1PS3A 4Y1AD 1EERB 5ANME 3EFOB 2G5UA 1KNOB 1AGFA 1AAJA 4EXKA 4X7SL 1GZPB 2YN5A 5H37G 3ZJAA 3EDFA 3WLBB 2KLRA 3BKYL 1JPGB 2DWDA 3U0WL 4RZCB 4WK0B 3NJKA 1EO5A 4ODSL 2ZZUT 4QF1A 1JZHA 1GOFA 5KYUB 1M7XA 4YHKL 4IHOA 1MCKA 1OAZL 3RDTD 2AGJH 2OJEA 1P7KA 1XGTB 3NH7L 1MCSA 1E6OH 1MDAA 4PJ5E 4ECNA 5KS9A 1ZE3H 3QSKB 1FG9C 5ECGA 1WZ1H 2JJTC 3ZLQC 2PCFB 4PJFA 3CDCA 3TPKA 4EBQL 4KPHL 4EZJA 3T77A 1H8SA 2P5WB 3D33A 3O2DA 2IC2A 2GY7B 1BG9A 4N0UE 1RKRA 3G08A 5CBAB 3H2PA 2YPLE 1FVDA 2JB6B 1G84A 5AVVB 1HWHB 4X6BB 3ARPA 2YWYA 4TVPL 4X5PA 43C9B 4K5PA 3VH8B 2OXHB 3B9KC 3WD5L 3BMVA 3E8VA 4L4VD 3KBEA 5KWYC 2Y25A 3UZVA 2A77L 4AM0Q 1NFDB 2VXQH 3ARBA 3D05A 3CZLA 1I3RA 4I48B 4J3OC 1S9XB 3WFHA 1VDGA 2BSRB 1GAFH 4G9DA 3I9GL 1YUKB 2Q9OA 3GIVB 4MA1B 2ZJSL 3BPCA 3CV5A 5T1MB 1IGJA 5ACMA 3OLDA 2IGFH 2LLLA 4KQ4L 1XGTA 2YO3A 5FXCH 3QPQD 2D9QB 1QUNA 4G11A 2EH7L 4OGXL 2AK1L 4XNUH 1IGJB 3TA3B 3T08A 4EN3C 2PP7A 3SGEI 3L3DB 3UZEC 5FEBA 3EYUH 2XJLA 3VFMA 5C9KA 1QBML 4CN1A 2KZBA 4X9HA 2H6PB 1E28B 1BQSA 2EKJA 1A0QH 2X7LA 3OKEA 4L0PB 25C8L 3C6SA 3V79C 4QHUB 2V2TA 2FSDA 1JPTH 5ERWA 3RHWF 3K71B 4U1KA 4WFHD 3LKNB 4H13C 1ZDSA 3FB8A 3U0PA 4TQHA 1DCLA 2XN2A 1USZA 1YNLL 4OGQC 1NMBH 5HDBE 1HU8A 2ESVA 2NR6D 2O72A 2YA1A 5C0IB 2X1XR 4GFXA 3FCTA 3C75A 1JGEB 2YD9A 1KJMA 2O6EA 5EBGA 2WZPA 3WSQH 1B2WH 1INDH 3WIHH 1CR9L 2GBAA 2P4AB 3QCTL 5DK2A 5E2JA 3GEFA 1BBDL 2BIOA 1ZIAA 2ZONA 2WCGA 2Z92A 1JV5B 1SLVA 5ACZB 3KCWA 3QRGH 2R29L 4I2XE 1THAA 3MQIA 2BOBA 4BQ6A 2DV6A 1ZTXL 2Q8AL 4C47A 1N0LB 5BW7C 5JIKA 4YHYC 2GY5A 4RFOH 2VXVH 1NA8A 2M83A 5SWSB 1KYFA 3MX0A 4YLCA 4OCRH 3Q48A 4G6FB 2VSKB 3G5XA 5GGTH 5F1IA 4XZ4A 4X9IA 4PJFF 3FT4A 3OX8A 1YMHB 4WDIA 4N3UA 4OJEH 5DD5H 2CJ3A 4PGEB 1S2EA 5ECJE 5HD8D 5B8CB 5BS0B 1TU2B 5I16B 1F6AA 2H8PB 4OTXH 1SJEA 2ZXQA 4FXKC 3LEYH 5TFSH 2WWMC 5JHMA 4PU2A 3UAJC 5KJRL 1N8OE 1ZGLM 3MV01 2P9RA 4M6NH 3UP1A 4IU2B 5IW1B 3FO2B 2O93L 1MVUA 4IRJB 1SZNA 3RFZC 5K9QG 2G60L 2R8SL 1JSYA 3D39E 1SYSA 2D8KA 3IFOB 1HK6A 4IIQB 2ITEA 1SGKA 2W65A 2IF7A 3GBNH 1P4UA 4AC4A 4PV1C 2XYBA 3Q8BA 1I3VA 2W07A 2WXMA 4QHUA 3Q8FA 4ODWB 4JO8A 4MD4B 3TIDB 5HHPB 3V6ZB 2P5EE 3UBGA 1HNFA 4WEEA 5D7JD 5HJBA 4MDRA 4AIZA 1UYWH 1N64L 2HG5A 1MFDL 4ODWA 5E2UH 2WBJD 1WIOA 1MUJB 4ZYKB 1F90L 5EBMA 4PUBH 5FK9B 3O2DL 4WV1B 4ABWA 1YAIA 2VB5A 3L8QA 5AKTA 3RVTC 1DL7L 4HUUB 2FD6H 4FTVA 4AJYV 5AZEH 3WEMA 1UWXH 3QUXC 5GRUH 3DOSB 3MBED 2PYEB 3VRLF 3TGXA 4DK5A 4Z3HA 3SYCA 1S7WA 3ZDYE 3VW3H 4PJAB 4ZUTB 1GCYA 2WXKA 1ZOXA 3IDJA 3CZKA 5L2KA 4OF3A 4PBXA 4JHVA 2BNUB 3PWUA 3ECBA 5ICXB 1PTZA 2OCCB 2BVUA 5JMRA 3THMH 3QJUB 3Q2WA 5JHDE 3E9UA 2VZ1A 4DN3H 5MEND 3FQ1A 5SX4H 2MCG1 2HFEB 5C1MB 4L8DA 3SPVB 4TNGA 1PF3A 5I8CA 3KJ6L 4GKZA 2QPFA 1E7UA 5T1KA 4YHIB 1W72H 3VXUA 3LKOB 1VACA 4LSSH 3P3TA 3LMJL 4XCNA 1TJGH 5FYKH 1U95A 1E42A 4XI5C 1XO8A 4U4IA 5MEQA 2WBJB 3W11C 3Q2LA 3EJTA 4QRPD 3QRFM 2YA0A 3N44B 3HLKA 3QEHA 4ZODA 3RA7L 4J1UB 5E7FA