1HU8A

Crystal structure of the mouse p53 core dna-binding domain at 2.7a resolution
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
186
structure length
186
Chain Sequence
TYQGNYGFHLGFLQSGTAKSVMCTYSPPLNKLFCQLAKTCPVQLWVSATPPAGSRVRAMAIYKKSQHMTEVVRRCPHHERCSDGDGLAPPQHLIRVEGNLAPEYLEDRQTFRHSVVVPYEPPEAGSEYTTIHYKYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRDSFEVRVCACPGRDRRTEEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CELLULAR TUMOR ANTIGEN P53
publication title Crystal structure of the mouse p53 core DNA-binding domain at 2.7 A resolution.
pubmed doi rcsb
source organism Mus musculus
molecule tags Dna binding protein
total genus 35
structure length 186
sequence length 186
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2001-01-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1hu8A00
2J6WA 3WTXA 3US1A 2X0VA 3ZMEA 5AOIA 1T4WA 2WGXA 1HJCA 2MEJB 4IBUA 4AGLA 4AGMA 4G83A 3KMDA 4AGOA 3D05A 4GUOA 3QYNA 1HU8A 4IBTA 1KZYA 3WTYA 5AOKA 4IBWA 3WTSA 4IBVA 2ADYA 3D0AA 3EXLA 4GUQA 3IGKA 5AOLA 4MZRA 2BIQA 4IJTA 2J21A 5AOMA 3WTVA 3US0A 4G82A 2GEQA 3D09A 3Q06A 1HJBC 4L18A 2XWCA 5ECGA 5AOJA 2BIPA 2P52A 4QO1B 4L0ZA 2AC0A 1CO1A 2X0UA 3D06A 4IBZA 3VD1A 1EANA 5ABAA 3D07A 2VUKA 4LO9A 5KBDA 3D08A 3WTWA 4LOFA 1LJMA 4IBQA 3KZ8A 5LAPA 3EXJA 3Q01A 2IOIA 4AGQA 2J1YA 1GZHC 3WU1A 3IGLA 5G4MA 1EAOA 4AGNA 4IBYA 2BIOA 4XR8C 2OCJA 1EAQA 2RMNA 4A63A 4HJEA 2BIMA 1IO4C 5G4NA 4AGPA 2BINA 2J1WA 2ATAA 4KVPA 5AB9A 3TS8A 1GZHA 2H1LM 2X0WA 1YCSA 1E50A 2J1XA 2J20A 3WTUA 1TUPA 4L0YA 3QYMA 2IOMA 5LGYA 3Q05A 2YBGA 2J1ZA 3VD2A 4MZIA 3VD0A 1H9DA 4IBSA 4LOEA 3WTTA 2XWRA 1UOLA 2IOOA 1TSRA 1CMOA 2FEJA 5G4OA 5BUAA 5A7BA 2PCXA 2AHIA
chains in the Genus database with same CATH superfamily
1BX2B 5ESQA 3MACL 2A9NH 3MRPA 3CIQA 3GSNA 1D5IH 5KG9B 5I0YA 4IBUA 4WEBL 2ARJA 4NN6C 1DBAH 1HEZA 1S6NA 2X40A 4UINL 4YSSA 3L08A 4XN2A 3VNZA 2HT3D 5I0VA 3L16A 5I6OA 4NZFA 3RG1C 2F9BT 3BZ4A 3CFCL 3LEVL 2Q5BA 2AXFA 4W9GC 1GVIA 2M83A 3V6FA 2FO8A 3H2WA 3PDOB 4YDJA 2CIKB 3KWWB 4DVBA 5I30H 1T2JA 5EBLA 4EMZA 5GISL 5DVLA 2AVFA 4K71C 2VAJA 3CZFB 4JZNB 5F7MC 2V2TB 1RP8A 3O0LA 5BQ7B 4IMLB 2VR7A 2YS4A 4M7ZB 1BFTA 1FYTE 4L4VD 4KHXL 2IV8A 3CVBA 2BP3A 5F7EH 4AITA 3FRPA 3NH7H 3QIBC 4NQUA 1WISA 2VL4A 5FUCC 4B9JA 3ZE1B 3ZK0A 1JDCA 4DKEH 4LPCA 5SX5K 2OMVA 4N8VA 3S5LG 4JM4H 4KRLB 2OMXB 3TT3H 2GTWB 3SD5A 1M1SA 2YBRB 5J6GB 3OR7B 5HVHB 4DFIA 2VXUL 4V1DA 5KSUB 2J25A 3ATEA 5DYOB 2NCMA 2K6WA 1KCKA 2ARWA 3EJUA 1U93B 4YSCA 4B9CA 3FUHA 2C7FA 3DUHA 3DGGB 1EZLA 4JFXB 5BS0D 4ZPTA 3QNXA 1J8HD 4ODVH 5SWZA 3MLXH 1X9UA 2WN2A 3QFJE 1TJMA 4J3TA 1EHAA 3DSNA 1HZHH 1IC0A 2Y7QA 1DL7L 2BC4A 2IMNA 5AZ2H 3KWUA 1SF5A 3ZGHA 3ZTJH 5KJRH 4JZJA 5I1JH 3RU8L 3R4DA 1HWGB 3TO4B 1EAJA 4H0LC 5INDA 3A5VA 3GKWL 1P1ZA 2IH3B 2GQHA 4W9ZA 2IOMA 4U6TA 5IB2B 2WB1A 4MXWL 1QFWL 4KHTH 2E27H 3CFBA 5MP6H 2E7LA 3FU7A 1AD9B 3TNMB 3DJSA 2ITEA 4HEPA 4PJGF 1Q1PA 2BSSA 1P6FA 2DLFL 4PTUB 5IP4A 2XFXA 2DQEH 2JKTM 2FVNA 1T83A 3ZQXA 3ZSSA 4YHPA 4WUKH 2PCYA 3MA9H 4OLYL 3WS6C 1D5MB 1IC7L 5I0XA 4Z18A 4WU5A 4KX8A 4F7MA 3QPQC 5TDNA 2KZWA 4Y7OC 5DEGB 2FATL 4Y5YB 1NGZB 3SYAA 4G83A 4PJCA 2P5EA 4E9XA 3FQXB 3LHPH 3T08A 2B1HL 4AGOA 3CH1B 4H88L 1YVLA 1R47A 2OJZL 2F8XC 1K5NB 2DQGH 4HXBH 3CC5B 1IGTA 3PHQB 4LCUA 4N9OB 1P4BH 1IM9D 1KTLA 2F53D 1DVTA 3D0AA 3VI4F 5EMYA 1U3JA 4H13C 4AQ8C 2VKXA 3IDJA 4CVXB 3VQLA 5AOMA 4YDIH 4HWNA 4HA1A 3MLUL 4R7VA 3ARGA 1SYSB 4K23H 3WKYA 3SPIA 1GW0A 4G1MA 5SWQB 5C0GA 4LE8A 4DGIL 2H41A 4LIQE 3U6RB 3FAXA 1OSZB 3PIQA 2FIKB 2MNUA 3GO1L 4LQFL 1FORH 4M5ZL 5IROA 3LRHA 1RZ7H 4DGYH 2AXJA 1J9SA 2DQCL 1DQVA 3NCBB 5L8LB 4GKSB 2Y36L 2V9UA 1PZ2A 4G8EA 2ZUWA 4G8GD 2KMWA 1RZJL 4NPJA 1MDAA 3FQNA 4XC3L 5IOPA 2VZ3A 3WIAA 1N0LB 3LZOA 1ROCA 4DJMA 5ACZB 2NDGA 4L9LB 1B4JL 2DS4A 4EQ3A 3B5GA 1LNUA 5IBTL 4JO3H 1OOWA 3Q9QA 3CN0A 4PYGA 5H2BA 1B0IA 3SKNB 3NPSB 1RK0B 2D7NA 4GRWH 1NFKA 4FFTA 3JWDH 4PVBA 1VEMA 1ASOA 4LVHC 4S11A 1FGNL 2B20A 5DK0B 1YC7A 1K3ZA 4FABL 4XRCA 5HDQL 5J3HD 1RCYA 5KBLA 1DJZA 1JWSA 3L9RB 4JQIL 4KXBA 5DUML 5JO5B 5T1KB 3S37L 2MJWA 3STZB 3LD8B 2XN9D 1N9PA 4U3SA 5AB9A 2QLVB 4H1LA 1U9KA 2D7TL 5T33H 1BOYA 4FMFA 3A0OA 3S36X 4BZYA 3VDCA 5AAWC 4NRXA 1VGKB 4JQXC 1OHZA 3HUJB 4PWIA 2EDWA 3RWDB 2V7HB 2R4RH 4KFMA 1LP9B 3PGFL 4DVRL 3VB8A 4YBLC 4LIQL 4IIQB 1XCQA 2IBBA 4Z5RA 3O6ML 4M1DL 3T6QC 1HDMB 4JANB 3O6FD 1D9KA 4FNTA 5IEHA 2K1MA 2EVIA 3RVVD 1UWEL 4KXZH 5C3TA 4AK2A 3Q6FA 3BH8B 4I0KA 3P2DA 5IJVB 4K9EL 1VFAA 4I8DA 4WY7L 3I9IA 3FO2A 5GS2D 3ESNA 3PWPD 4N2NA 4DFHA 4ABVA 43C9A 2CO4A 3SDXE 5IVXA 4L8DA 1KN2H 1UKTA 3QEHA 3QZLA 2QVKA 4QTHB 3ECVA 2C5DC 5I5IA 3N85H 3BOVA 3P9MB 1GYUA 5IVNA 1KV7A 3L4TA 1CXHA 1MPAH 4OFKA 5BW7A 1M6OA 4YDZA 3BIAX 3O45B 3WTYA 3N9GH 3DURA 2EVHA 1ZJAA 1HEJC 2VOTA 4PEEA 5KVFE 1FPTL 1PYWA 3QQ9D 2X3CA 2MPVA 3S35L 1BLIA 1JTOA 2GABA 2B4CC 4OKDA 1J11A 2GG1A 5DD1H 1R75A 5E9DE 3ESOA 4Z7UA 5I19L 3IJ9A 5CR8A 5JW4M 1F90L 2YR3A 4S1RL 2K3HA 1A3LL 4JL2A 1KPUA 2Q8AH 4YK4B 5C6TL 1U6AL 4QRRD 4LRNL 1IFGA 2CA4A 2P9RA 4Y4KB 3BKJH 1IAOB 5D1XA 4ZOEA 5JUEH 3GI8H 3HPLA 3ILQD 4EBQL 1J5IA 3MRHA 5E6UB 2XTLA 4TLTA 4WHYG 4D8PB 1P5UA 4HPYH 2NR6D 4BZ2L 4OV5A 5CINH 4ZYKB 1ET8A 4XCFL 1FA4A 3SE9H 3JT2A 1XSJA 4TQIA 1HXMB 2NY0D 1CF8H 1ITBB 1NGWA 1T20B 4E42B 2J5WA 3RDTA 4N0RA 4QGYA 1W0YT 2XIDA 4CNIB 4LKCA 1OP3K 4KQ4H 5FV1L 4RETB 1PZUB 1GJIA 4MHHI 2AJSL 3TN0B 3AG4B 4L1SA 3MR9B 4XNQB 2XZCL 3BT2H 1JCVA 2MPAL 1HYRC 2Y6SC 5EEYA 1U8LA 2DEYX 3D18A 3ISWA 5ESQB 4B95C 2BINA 1CT8A 3OXSA 5TPWL 4F80A 3HS8A 3F6IA 4FFWC 5KVFL 3MRPB 1QO3A 2X0WA 3LPOA 4FHBD 4LSVH 3W81A 3HZKA 3MV01 4FFVD 1KC5H 1OPGL 3B1UA 5IB4A 2ARJB 5I8KL 1HEZB 1TKWA 4J4PA 3WUWA 2P80A 2KPWA 5TF1H 3QYMA 4TQEH 3BZ4B 1UQSA 2WO4A 2VWEE 4RRPM 1PKQA 1H15B 4PS4L 2AXFB 1NDTA 4S1QL 3RTQA 3U82B 1WH0A 3V6FB 2XFGB 4GBXA 4X4MA 4QWWC 3MOAH 3OVUB 4YDJB 4AQAA 2WP3O 4DVBB 5EBLB 2O1AA 4HOZA 1UOLA 4HLZH 3QXWA 4MNQA 4IGBC 1CGUA 1RZPA 2G2NA 3R8BB 5CLZA 4F58L 5BRZE 3MUJA 2Q87A 3TJEH 2DIJA 5JOPE 4PVMA 1N0XH 4JHWH 5HPMA 3FRPB 4PRAA 3HG1D 4Z6AT 2YMXL 4N26A 1ZE3C 1E5CA 1GXEA 1NSNH 1IC4H 5F3HA 1HOCA 3O9WC 3CZKA 1Y1UA 2OMVB 4H8UA 3VX1A 4N8VB 4C55A 1TNMA 3MA7A 2OW6A 4U0RB 2FBOJ 3KD4A 6FABL 3VG9C 3ZT7A 1KTKE 5K5YA 2X70A 4V1DB 4MCMA 2M2DA 4N87A 3HMWL 3NA4A 3RX5A 1CU4L 3M8OL 4I0PC 3TCLA 5FUZL 5IHWA 3WN5C 3V0IA 4ZPTB 3FQRA 3QNXB 4XMXA 4AEHL 5SWZB 2FBJL 4ZMVA 1B9ZA 3DSNB 1SOSA 1G1KA 1BVKA 2Y7QB 2BC4B 1ET5A 1ROWA 5DLLA 5JOEA 4JZJB 1Q9OA 2V5TA 4PJDF 2DB8A 3MRMA 5D5ME 3NEXA 1CXLA 4F2FA 2JWYA 2A4CA 3BP4A 3HZYA 3QNYA 4KX9A 5DGQA 1ZLWK 3RY6A 3T09A 4C54A 5JQIB 2XPYA 2AF2A 2CJUH 4RRPA 3W9DA 1SJVA 5INDB 3NIFB 3O4OB 1P1ZB 3ME0A 4QOKE 4R0LC 2WHVA 4M5YL 4XAKE 2YD8A 1G1CA 2EEAA 3MO1A 2WZ6A 3PXLA 4H8QA 1BAGA 1QBAA 1A0QH 2OMYA 3QAQA 3CFBB 5FYLE 2GSGA 5KS9A 1AH1A 2VL5A 1GMEA 1IBYA 1URZA 3FU7B 4JG0L 5LDUA 2GT9A 2O5YH 1OE3A 3DOSA 5FGCE 4FKHA 1BVOA 1A4BA 1SM3H 1UOWA 4YE4L 1OM9A 1L9QA 2BSSB 1I8IA 3GXPA 2WINA 3EIFA 1BOGA 2BWQA 5CZXC 4DK3A 4YHPB 1O6VA 1ZKAA 2VXQA 5GJSH 3MKKA 3WFCL 3AG2B 4WU5B 4F7MB 5TDNB 5DO2D 3TCTA 2XBTA 1J5OH 3Q5TA 5L0QC 2Q8BL 2RIKA 3ZE2F 3ARBC 4PJCB 2P5EB 4W9FC 1MFAL 4NO2A 4Q6IC 2XN2A 2Z3FA 2ZWNA 1QI5A 2VLME 4FQJH 4AZ8A 1IGTB 2W9EL 1RJCA 3QGVA 1PD6A 4LCUB 1KTLB 2DMBA 2DH2A 4PJ7A 4UT9L 3W1ZA 1AYRA 4F7PA 3F04A 3IDJB 2VLLA 2HUEA 4HZLA 1JWMA 4PJIE 4RGOH 3ARGB 4BDVA 3EYUH 1OK8A 1OTTC 4G1MB 4PI0A 5C0GB 4C4KT 2L7JA 2LFGA 5FYKL 5EU7E 3PIQB 1OANA 4AIZA 4M1CD 3FOMA 1E6OH 4OI9A 3D2UA 2BM3A 3SGEH 3H53A 3ZTJG 3ULVE 5E4EC 2BERA 4G8EB 1UXSA 3BUIA 4NIKB 4I87A 3FQNB 1TYEB 5IOPB 3UZEA 4Z7QE 3WG7B 3W38A 1CGTA 3GXFA 1G6RL 1BMGA 1LNUB 4PJEE 5FYJE 2OMBA 5H2BB 4TVPH 3LIUA 4KRMB 2R0WH 4OLZH 3FFCE 1JVOA 5GS1A 5EOQL 5CZVL 4YUEH 3REWA 3FCGA 4X8GA 4H26A 1EFXA 4ZMTA 2XRAH 4XRCB 2LLLA 5F1OB 4PGJA 4OBRA 1JWSB 2XT1B 5E2UH 4P2QE 3QNFA 3MV9D 4U3SB 4GXVL 4H1LB 4Z7VE 5DEZA 5IREA 4KKRA 4A66A 1XH1A 1W91A 2J57A 1I8MA 4NZTL 4OGXL 2PWEA 4WI9A 5E8DL 4XWOD 2OAAA 1P7KB 2ADJA 5E56A 4NRXB 4KTEL 1NPNA 3GRWA 4NUJA 3AY4A 4KKNA 3WDHA 5IGXL 2LU7A 1QI3A 1YDPA 1BMZA 3HPJA 3QXUA 2R56H 3WD5H 1XCQB 2ENPA 3ZKQD 4Z5RB 2X4PA 3HRZC 4OM1H 5AZEH 1D9KB 5EB9A 5IEHB 1KGIA 5EIQA 5E6RB 5JA8B 3Q6FB 3ULVL 1AIZA 4I18A 1MW2A 1BXXA 2QQQA 3R4RA 1VFAB 3EBIA 5DEJA 4TSAL 3FO2B 4KK9D 2CCWA 3WIIL 4G7VL 3NIGF 3PP3H 3ZQ9A 1NJ9A 1OZTG 4AE1A 43C9B 5IVXB 4L8DB 3QEHB 1LWHA 3MLWH 1USZA 2PP7A 2R51A 3FT3A 1UWXH 2WLZA 4YXKH 2E47A 3TYGL 1M6OB 1S5HA 2IGTA 3UG5A 1CFNA 4JJ5A 3DURB 4L1BA 2TRYA 3Q05A 2F58H 4M8UA 1PYWB 3UPAA 4K3GA 4HZ1A 2J1ZA 4P3WA 2BMKA 1LEKA 1H9DA 3WFEL 1AXTL 3EGSB 1XF2A 3IMUA 4Z7UB 4BE6A 1AZNA 2NNFA 4I9WE 1KPUB 3X11A 5CEYA 5D2NE 4NZDA 3E7JA 5GRJL 4N2HA 3O2DL 5CSGA 4CRPA 3ZX1A 5D1XB 4KNQA 4LASH 3CVIL 1WZ1L 4CA4A 2J56A 3HPLB 4PJCF 3FH8A 4JFSA 3MRHB 4YC2C 4GAJH 1P5UB 5B1BB 4OV5B 4J3OD 4NZRL 4ZX5A 3ESUF 1B2YA 3GLAA 4LSPL 4P9MH 4QTIH 4PWEA 1XF3A 3D12B 2HMIC 4HOMA 1NGWB 1T5XA 2VSDA 4G80A 1NANI 5CKAA 3VSTA 3C75A 2XV3A 3AROA 1T0PB 3U4KA 3RDTB 1NBCA 5CFAA 3VH8A 1IM3A 4LKCB 3RWIA 3CCHA 2WLJA 1IQWH 3FU8A 1PGRB 3B2UC 4X4XA 4FI8A 4EQ2A 2BNQE 1HJBC 2BS71 4ZXBC 3L3OA 1ZGLP 1RUQH 2BDNL 5B7EA 1H19A 3D18B 4YHZH 1CT8B 2BO0A 1NC2A 3OXSB 1URIA 2R2HA 2I60H 4XHJC 1QO3B 3BUQA 1KCUH 3GYRA 3QZWG 5DS1A 3HZKB 4H20H 4NBZB 4W1TA 3T3PF 2DQ6A 4RGNB 3D30A 1TKWB 2D03L 3MJ7A 4OI8A 3WUWB 2FHFA 5I76A 1X5LA 3PUCA 3WY4A 3NJIA 4AGQA 1UQSB 2A9DA 3LIZH 1NMAH 1PKQB 4Z7NF 5CZRA 3EJPA 1MHEA 1UA3A 1WGVA 2WLIA 4KKQA 1DN0A 4GBXB 3U6XA 3DUUA 4NO0D 4AQAB 1ZK9A 2ED8A 3JWNE 1YYMH 2KERA 3AXLA 5HDLA 5C7ZA 43CAA 5B3NA 4MNQB 1E67A 4JO1L 1RERA 3QDJD 4HKZA 3HB3D 4TNFA 5HHMB 3FQ1A 1I4FA 5HPMB 2X09A 4PRAB 1MI5D 4G6AD 4N0CD 1WS8A 4HLJA 1MHHA 4KH9A 1AG6A 1HYSC 5F3HB 1HOCB 2RA1A 1CD8A 4XTRD 2CMRL 3IB4A 3MA7B 2X42A 3NJVA 1GW6A 1MH5A 3DROA 4ORZC 4YGVA 2BP5M 2X70B 2PCFA 4LVOB 1SVZA 4HGWA 1ACYH 4MZIA 2OMTA 3TCLB 3NVQA 2A1WH 3WKNA 3L54A 1UURA 3LEYH 3SGJA 3F6LA 1N6QH 1YN7A 3GS7A 3FQRB 3PU7A 4XNBA 5C6WH 3RY4A 5C9KA 4EI5A 1AQKH 2G5UA 2SODB 3Q1SH 5CJQL 1EHLL 1QW8A 1BVKB 2C9UA 3BPNC 5K1VA 2YN3A 1Q9OB 1WV7T 4WJKB 5I6XC 1E6JL 3MRMB 1DVSA 3BP4B 3S7GA 1MJ7L 2JH2A 3QNYB 2NY3C 1IIIA 2DYSB 4JG1H 3W9DB 1XDTT 1Y1DA 3ME0B 1ETA1 2EAEA 2E56A 4QLWA 5A2FA 3MO1B 4JGNA 1MUJA 4JFFA 3EZJB 3U30B 2OMYB 3V6OA 3D69A 3DVNA 2GSGB 2J88L 2WSPA 5KS9B 2VL5B 2QADC 5ALCH 2ZD0A 4G6FB 2GT9B 2CLRA 3DOSB 5FUOH 3EGDA 1LLAA 3TWYA 1CTNA 4GUPB 1I8IB 1XGRA 2BX5A 2WINB 1BECA 3MYZA 4LEXH 4WFFE 1BOGB 3T0WA 3C5SA 5DJ2A 4AQ1C 1GPOL 3VGDA 4MMXA 2B1OA 4HBQA 4FULA 5EOCH 2Y06H 2WYHA 2VXVH 2R9HC 3A4EA 2Z8SA 3KPRA 3B4NA 4WWKA 4M5TA 5JHLA 1D5XA 1T7WA 3DVFA 3QUYC 4I13B 4ZMAT 3R8QA 1E9PA 2XC8A 4NO2B 3CPLA 4P2YA 2VDPH 3LNFA 2RGSA 1IKFL 1U8KA 4TLKA 4AZ8B 1TO5A 2CCLA 5SV4A 2DBLL 1Z5YD 1HX0A 2VSCA 4S0SD 5FKAA 1LDPL 1EO5A 3B83A 2BVOA 3NUKA 4JL1A 4LP5A 4PJ7B 2X7LA 4PU2A 4ZFGH 1WHPA 1MJUL 3F05A 3W2DL 3O41A 4F7PB 2K9UA 2VLLB 3NRPA 4HH8A 1JWMB 1GYCA 5FO9A 5CBEA 3VD5A 3KPSE 4X6FA 4BDVB 2X4UA 3RIFF 4UILL 5DUPH 1T04A 4IRZA 4UDUA 4TULH 1MRDL 4QUOA 2N7AA 2IDFA 1G9ML 4AIZB 2EE6A 2ZAGA 3FOMB 1U8QA 3ES6B 4O58L 5ANMA 4FE9A 3D2UB 4HAFA 4E9QA 3SKJL 2AJXL 5E6SB 5CN3A 2YFNA 1V55B 2HJFA 3QI9A 3WSQL 4OCYL 1L9TA 1UHVA 1UXSB 4LPWA 3IDUA 4ODSL 4JFEA 2FH6A 2X10A 1TTGA 3WEOA 3ZE0B 1KY7A 1MFEH 1OO2A 1RPKA 2ZX6A 5C0RL 3VQ2C 3MV8D 4FJZA 1U3HA 2IQ9H 2JKXA 1TZOA 2WIMA 3I6LE 5DLMH 3HTLX 3CFNA 4A37A 4UTBA 1FIEA 3NABH 1GYVA 1RJZA 5GS1B 5EF2A 2QZ5A 2ERJB 1OGPA 2NYZA 1FN4A 4EOWL 1A6VL 3L9EA 3REWB 2E3VA 4MS8C 2XIIA 4H26B 3MNZA 5B8CA 1EFXB 4EZMA 2DRUA 2Y4SA 1PZCA 3AW5A 1M4KA 4EDWH 1KV3A 2E7CA 1I9RL 1QRKA 1N5AA 2WUBL 5F9DC 4P2OC 1I8MB 2EZ0C 1BFSA 1VFBA 3OZLA 3ROOB 1YZZA 2ADJB 3U46A 4M62H 1U2YA 1FZMA 4O4YL 4OD2A 4AQEB 5HI5C 4NUJB 2VRKA 3VVVA 2P46B 5E8PA 3POCA 1NCAH 5TH2A 2NQ3A 4AC2A 1TPXC 3P0GB 1YDPB 3HPJB 4XN9A 4OJEH 5DYFA 3UAJC 4PN6A 3Q6GH 4FMKA 3QORC 2X4PB 5DVOA 1CFMA 4Z7WA 4DGVL 4KZDL 2OPCA 1WFJA 1OK0A 2DJ4A 4IJTA 4XP4L 3CFDA 1D5ZA 3GXMA 3MUGA 4PP1C 4QCIA 5LKNA 15C8H 1DEDA 4I18B 1EJOH 1W8NA 1FYHB 4WTWA 3NSJA 3NCJL 1TJXA 4QRTA 1R33A 4JX0A 3VGAB 3GSQA 1NJ9B 3OAZH 1HHGA 1NIAA 2XX0A 1F6FB 4UAOB 5TK2A 1NEPA 1EGJH 3ULUC 2IPUG 1HXKA 3V0JA 1EEUA 3Q8BA 5AVUB 3MX0A 3FT3B 4KJPC 1P4IL 4FFYH 3BSZL 5F1KC 1S5HB 2R1XA 2BS8A 5B3SB 1CFNB 5FHAH 3KLHC 2FD6L 2OSWA 4DEPC 3HG0A 1LEKB 2BMKB 2PXYA 4JHUA 1YEWA 3SYOA 2EKSA 4I2XA 4OCLC 3VXUE 1R34A 4BXSV 5EN2A 3PAUA 1P6WA 2XI9A 3K2KA 5G5DA 3QDMA 4QT5A 1DQLH 4ODHH 4HXAH 4JFZH 3JSSA 2BIMA 3FUEA 1HL5A 1K4CA 4TUKH 5CEYB 3X11B 3GHBH 5GS0D 1K72A 4YX2L 3HCVA 4OZFA 4XBPA 5EU7C 5AW9B 4HUWA 3VFWA 1ZLSL 4J5VA 2XOTA 3IFNH 2VDMH 3RWGA 4OBSA 2VM9A 4AY0A 1CD0A 2CG9X 5JNYA 3D7PA 3TBSA 3OKNA 3T2LA 1FLRH 3EYFA 4IU2B 4RNRA 3K3QA 1JFQH 1ZE3H 2XN0A 3QEQD 1E2ZA 1N4XL 1DFBH 5EEVA 4WVRA 4PJ7F 1ICTA 1XF3B 1FAIH 2DQHL 1T5XB 3FKUS 4KDTA 4G80B 3SZ6A 2YIHA 2V9TA 3VH8B 1IM3B 3RWIB 3CCHB 4IRSC 4X4XB 5I8EA 1L0XA 3RZCD 1IFHH 2AK4A 2EXWC 3DMMC 3L3OB 5I8OH 4PW9A 1HCYA 5D7JD 5D6DA 3AFLA 3T0ED 5FFGA 1F13A 1DSWA 4GKLA 2KZKA 1NC2B 5D4QA 5DWUL 2R2HB 5DRWB 2VMFA 1AJ7L 1VDGA 3QWNA 1UH2A 5DHVA 5H37H 1CVRA 3ARDA 2I7SA 1XHHA 3LEVH 1RIHL 1MWOA 3KJ4B 5LQBH 3BEVA 2X89D 3GTNA 2FYVA 3LDBC 2FH8A 2FEDC 3MJ7B 2VQTA 2PPEA 5I76B 1Z9LA 2VN5A 4XPFH 2BJMH 2WQXA 2VR8A 3O3AA 1L7TH 5AYUL 5KZCB 2ADYA 1OGAD 1MHEB 2WLIB 1PFCA 4NQED 4W4OA 1DN0B 5KWYC 3DUUB 3D39A 1CGSH 3E3QC 3H3BC 5TE4H 43CAB 2ODIA 4EKXA 1KCWA 3EYOA 3TTSA 3O8XA 4PJ5A 4CC4A 4HKZB 1Q0XH 3NQIA 5TE6H 4Q9RL 2GPZA 5JPMA 4G9FD 1I4FB 2HLAA 4C57C 4GAFB 1MHHB 3LRSA 1WO2A 1FRGL 1QNIA 5F72S 3QUXD 2E74C 4MRBA 3ZDZE 5L6YH 2GJ6E 4AV4A 2YO3A 4U3XA 3DROB 1MH5B 2X53A 3QIUD 5E4OA 1PFOA 3RKPA 4YGVB 2JJTC 3V95A 2PCFB 4OZIA 1UACH 2PW2A 4HGWB 2YSSA 4HJIA 4YDLB 5JHDE 3IVKA 2X28A 1KCLA 4RIRA 2OMTB 1BXAA 4AVJA 2DV6A 4KAQL 3QUZD 4MJHA 4NNPL 4XOEA 1TQBC 2Y5QA 4BK5C 3FU0A 5FGBA 3LRGA 1PNCA 4M6AA 2EEFA 2E9BA 1L9OA 3I2CL 1NAKL 4AKOA 3SO5A 5HVHC 1FG2A 2C7UA 3WXVL 3PWVB 4GSQA 3T2OA 4EI5B 5JIQA 5CIPH 5D1QA 4AYGA 5FLVA 4LCWB 3GJEA 1ZEAH 3N91A 2XWDA 3NJHA 3O81A 2APWA 3QO0A 4KK6C 4WAFA 4AI7A 1MJ8L 4N28A 1DVXA 3FL7A 2JB6A 2BXZA 3GDBA 4MYPA 1F5WA 3C2AH 3AT8A 1P84J 5IQLA 5CEZD 1MUJB 4JFFB 1A6WL 3SE8L 3X12A 2O72A 3D69B 2YD9A 3DVNB 3X3FL 5BV7L 3FAWA 3TO4C 4KZCA 1L3WA 5DHEA 2CLRB 4PV9A 4DETA 1YA5A 3EGDB 1MXDA 3OX8A 2Q3XA 5EOTB 1XGRB 3BE1H 4IBVA 1JZGA 5I1GL 3FCBA 4YDMA 3C5SB 4NP4H 5DJ2B 4DN3H 1JZ7A 2DMKA 4APQA 2X4SB 1COBA 1DLFL 4MMXB 4QRBA 4J7RA 4PY8I 1AI1L 5DJYA 3ZZ1A 4IEFA 3ZPDA 3VDBA 2A83A 1SN2A 1Z9SA 4P5KA 3KPTA 5B1KA 4XC1H 3AS3A 1XAUA 5C0AE 3KPRB 4WWKB 5H4ZA 2QQLH 1D5XB 3LMJH 3QJXA 5MENA 3BGMA 1E9PB 5BO0D 3CPLB 1YQVL 1KIQA 2VRQA 5LBVA 1U8KB 5EDSA 1FE8H 4MYWB 3AS2A 5C0CE 4MBRA 5FKAB 4DP9X 2BVOB 4Y89A 3QQ4A 4M3KB 3OLEA 3LKSA 3NJMA 2X7LB 4Y5YC 2UX7A 3CIAA 2PYEA 4KO5A 3EF4A 1UD4A 3O41B 4HCRL 2NSQA 2WNKA 1OAYH 5CBEB 5FO9B 4PGCA 4X6FB 2X4UB 5IESH 2ICWI 1T04B 1TCMA 2LLNA 2TSBA 2AZUA 2VDOB 3LEXA 4UDUB 4PGEA 3CSTA 4W9CC 4LLYA 3TH2T 2X9WA 4F7CA 2BW5A 1S7WA 3OQRA 1U8QB 1KEML 2BS9A 5ANMB 1EEYA 2NW3A 4RH4A 3IMWA 3QR1A 3WXWH 1WTGT 1QAWA 2HJFB 3QI9B 1KWKA 3NA9H 3TA3D 4X83A 4GPVA 4KTYA 3LQMA 2KQMA 4JQVA 3FZUC 4JFEB 4KVNH 4BA0A 4PJBE 3NQKA 1H6TA 3BQUD 4NI3A 5HHQA 5D1XE 1KUMA 2EECA 3UAFA 1RIVH 4NQCA 1CD9B 2YA1A 2ROXA 2WZPD 1U3HB 2H32A 2JIXA 2BVQA 3AG3B 4M00A 4WK2B 4HUXA 2WJ7A 4NKOA 1KB9K 5GZND 2ZXEB 1RJZB 3LKRA 1FN4B 1NCGA 1A7QL 3SQOH 1RMFH 3MNZB 5B8CB 2C3GA 4L9LC 4F92B 4W9JC 4IDJH 3RGVA 4MNGA 1LMIA 4X9YA 2X1QA 2B39A 1N5AB 2FT7A 2ZZUT 3QUYD 5JHAA 4F7KA 2Q7NA 2Q20A 4MKMA 2QSCH 1UM5H 3V0EA 1ZANH 2IPUK 1VFBB 2H7WA 2HX8A 1EHKB 2IO5A 3L2MA 5E5UB 3H9HA 3TVMC 3JVGA 2WLYA 2NPLX 1FZMB 4LSQH 4OD2B 2FLMA 4HPHA 3LNIA 4JHAL 5E8PB 3K1KC 5TH2B 1QBML 3LD8C 3O6KL 4B7LA 3NRQA 1CI5A 1F86A 1Z9NA 1DVYA 1CICD 1T22A 3DHMA 4Z7WB 5E08H 3NSCA 2VDQB 5IB5A 3CFDB 5ABZA 5K1NA 1D5ZB 1A4AA 3MUGB 4QCIB 3BC9A 3US9A 3TZVB 4WFED 5C92A 3Q7JA 4IIQC 2J2ZA 3L7EA 3Q8AA 3W0WE 3UO1L 4GO9A 4A04A 4QRTB 3GSQB 3UTPE 1HHGB 4KKLD 3H9YA 2ZWYA 2OTUA 1E4XL 4DEUA 3EYSH 2BP0A 2LR4A 1WZMA 5D7SL 2IFFL 1BEXA 3P3RA 4A6YH 4XXCA 3MX0B 3X1EA 2C9AA 1FHGA 3R06A 4AG4H 3L4CA 1BQHB 3VXNA 4U49A 2CPUA 2R1XB 4PRHE 4W9HC 1WFNA 4DPAX 5FA3A 5MHSD 4NQVA 3U4EA 5BO1H 2AJ3B 5EH1A 1S7SA 4QRFA 3SOTA 2LTQB 2DIBA 4XMTA 4W4NA 4WO4C 2EKSB 4ONHA 4I2XB 5I82A 1AFVH 2VAAA 5DMJB 5EN2B 4LRNH 5F0PB 1KYAA 2Q1EA 2WWOA 2IANE 3QDMB 3BGFB 4QT5B 2PO6D 3A21A 4FG6D 5H8DA 2BNRA 4IKNA 1MCOL 1ODUA 2F8IA 3J27A 1K4CB 1CVSC 2ZJSH 1T6WA 1YEKL 3HCVB 4OZFB 2NYKA 4XBPB 2R2CA 3APMA 4HUWB 4WFHE 3VFWB 1XZWA 2NT0A 2OTPA 3LQZA 2K7QA 3DARA 4R26H 2Z7WA 3RWGB 3QXDA 3L1GA 1EAPB 5JNYB 4JNXA 3TBSB 3OKNB 5BMFH 1JI1A 4YK4C 4CJ1A 2ZOKA 3EYFB 4RNRB 3Q01A 2IOIA 3GJFA 4N2AA 2DQIL 4RA0C 4Y4KC 2QPEB 4YHMH 3GHEH 4PP1D 1UWXK 2H5UA 2AJSH 5G4MA 1MCLA 4WRLA 5C07A 1T89C 1KBGL 4YHYB 2OI9C 1O6SA 5KOMC 3R7QA 1JJUA 4PRNA 2YUXA 3BDYL 4PUBH 4YFDB 4LCIH 5I8EB 5JQ6L 3TONA 1A25A 2AK4B 1M57B 2YQ2A 1CDBA 1T03L 2NY1D 4WSGA 1YMMD 3FUKA 3NTCL 3WLBA 3V4PL 2VQ4A 1QLEL 3HLKA 5F7KC 3V5KA 5EORL 5F7UA 3ARDB 3TN0C 3WTUA 1FV1A 4WHDA 2MRYA 4TQHA 5D5MF 4PS4H 3BEVB 1SUHA 1ZS8A 3INUH 5E94A 2DQJL 2EJ1A 4NFCA 3BP7A 5L4FA 1T4KA 4XVUD 3O3AB 3QC5X 1KXQA 2ISDA 1J10A 3U0WH 1UZ6E 3D39B 4EEEA 1JPTH 1J87A 1O75A 4P06A 4KTDL 3NCXA 2UY7A 3DYPA 3EYOB 4JDTH 5AW1B 3HEIB 3O8XB 4PJ5B 2FO4A 1AKJA 5ITFA 2HTLD 3V5DA 3NFSL 1MVYA 5JPMB 5L4JA 2VERN 4NUGL 12E8H 2HLAB 4D3CL 3HE6D 4WKZA 5GGRA 1HJCA 6FABH 2WQRA 1ZVSA 1OF0A 3LRSB 4AGLA 4KZEL 4XVJH 5HGGS 2Y1VA 4PLKC 1CLZH 1M6UA 1ZPLA 3EG9A 5H4YA 5T1LA 5AWNL 1I82A 4B9YA 4KKZA 3BZDA 1MCDA 5IT2H 1O9ZA 3CE1A 3V5HA 4OZIB 4JCLA 2HVBA 2R7EA 2PW2B 3DTUB 4YDKL 3RTLA 4B9IA 4AEHH 4MZRA 3IVKB 4AYMC 3MCYA 1DJIA 3FUNA 4RIRB 1W80A 1YY9D 5CJOH 5KSBA 2R2BA 1HZLA 3O3DA 3V4LA 1Z5LA 4WTXA 1JXDA 2BPBA 1JRHH 1UADC 1IT9H 1EDHA 4U0RC 4AKPA 1MZYA 4Q89A 2VXQL 4UB0L 1FG2B 4ZW3A 2C7UB 2V6HA 3GBLA 2EACA 1NMBH 3TIDA 3QUMH 2X1PA 3D3VD 5D1QB 3B2VL 1A6TB 4U1JA 1LE5A 3H4HA 3GJEB 5F9AC 5KVDE 3QO0B 4OLWL 1ML0A 2HRGA 4PG2A 2F7QA 2R0KL 5H37G 2JB6B 3ULVF 2CA3A 3P4NB 1XMWA 4ESKA 1N12A 4JZJC 3FFDA 3X12B 1X7QA 1BQSA 3KH3A 4I3GA 2K9FB 3BKCL 4Z7QF 1NIEA 1I8UA 2Z31C 4PV9B 4P2RE 5AW7B 3D87B 3SDAD 4PJEF 1E2WA 2PWGA 3O4OC 4BQ6A 3P4MA 3Q0HA 3OX8B 5J89A 2X05A 2E7LC 1ZCRA 4APQB 5SWSE 2GSMB 2H1LM 3LZRA 2ESVD 2KL6A 4IEFB 5DJYB 3ULSA 2A83B 4NQTA 3UTTA 1Z9SB 3EFFA 3LQAL 4CVZA 5ADPL 5D7KD 2J1XA 4Z7VF 1QVOA 4K94L 5MENB 3BGMB 1U8IA 1T83C 4PJ9A 1GZPA 4WGWB 3IAGC 4PI2A 4P46A 2AEWA 2J8HA 1KIQB 3EHBB 4W93A 5KJ4A 3VDAA 2D9CA 3LYRA 3QQ4B 4NQDD 3DPBA 3LKSB 3VXPA 4FA8A 2PYEB 3VG0H 4FNPA 4GQPH 1OTSD 3BCFA 4AC4A 2D73A 2RJMA 5JIPA 4PCSA 5KVDL 4ALAH 4PGCB 3S36L 4C83A 1CBJA 3REVA 3OJDA 3LEXB 4PGEB 2WXFA 4GP5B 4KROD 4UYPA 3DOHA 4LLYB 4NI6A 4F7CB 1S7WB 4EZJA 2NW3B 1EEYB 3UMTA 1HH9A 3BUBA 4M4RA 4HWBA 3ARGC 4Y4HA 1NCBH 3CX5J 3GC3A 4FTVD 2N56A 2PYFA 4FQIL 1LHZA 4BQBA 1N6UA 5T1MA 4YBHA 1WIOA 5HHQB 1A5FH 4PJ8A 3ULUH 5IHUL 3S8FB 1M7DA 3NIDB 5IROC 4NQCB 1NLDH 2CSPA 2HVKA 1Q9KA 2H32B 2BVQB 2JIXB 1AAJA 4RSYA 2ID5A 4GKNA 2JE8A 2DQUL 3CVHL 4HUXB 4KGJA 2HVJA 4NKOB 1NBYA 4ZX6A 2ALAA 3LKRB 4YNYA 3JV4A 3D09A 4NDMB 1JUFA 1RLWA 2HJLA 1GHFH 3HI5L 4N6QA 1QWHA 4QXUL 2VLJA 4L23A 3RGVB 4MNGB 4LL9A 5E8DH 3TESA 3MRGA 2P52A 3B9VA 4JO2H 1KBWA 5JDSA 1AY1L 1JZIA 1I8AA 4HT1H 2BNUA 3HC4H 1WWBX 1UGNA 1T5WA 3AM8A 4KK5D 1OP5K 1KGCE 3H9HB 3WTWA 4GY4A 1ZOXA 5EZOH 4XNAA 1Z3GL 2Q2EB 4NP9A 3A67L 3ARYA 1CPUA 4FERA 3DX8A 1EPFA 2AK1L 2IDTA 1T22B 3EYVA 5MEOA 3B9EA 3H2QA 3BAYA 3G3LA 3WN6A 4ZX4A 3NCYS 4MAUH 4LSSL 3WI9A 5IB5B 4XP6H 2X9ZA 1BPVA 3GD1C 4LK4A 4Q9CA 2QPDB 2EICA 1LEGA 1ZRUA 3H0TA 5EU6D 5HYSG 3L7EB 4ATTA 4L8SA 4XN8A 3CG8A 1UENA 3FB6A 1D9KC 3WKPA 2KLSA 3L3KA 4PGDA 3D0VA 2NUTA 2BW4A 3B7SA 2OTUB 3EDKA 3V2AR 3PLYA 2BP0B 1C5CH 4XVOA 4XVSH 4DGUA 1AZZC 4ODTL 3R06B 4HX1B 3DBXA 4QKTA 5F70A 2Q2LA 3VXNB 1VLXA 2FCBA 2VLRD 2XTJE 5FA3B 3D34A 4NQVB 5L9DL 3FMGH 4HUUA 4QRPD 4UIMA 3U4EB 4DTGH 1AGDA 2YAEA 2UY6A 3P4OA 4ONHB 1B2WH 2VAAB 2H3XC 4WFGD 2Z64C 4XMKL 5BW7C 5F7LB 1JZ4A 3U83A 2DWXA 2XUWA 2BNRB 4L4VA 2APBA 1LD9A 2C4FT 1EJFA 4M6ML 1MREH 1SDYA 2Y07L 2OCFD 5CD5D 2MNJB 4FYQA 3LQZB 3APCA 3QXDB 1Z5HA 2BZ7A 1MNUL 2OW7A 1F4YH 1KYUA 4L1LA 3TGXA 5MI0C 4U7SA 2ZOKB 4G7YH 3GJFB 1LO2H 1BG9A 1BV8A 1DO5A 1TETH 4LCWE 3S4SG 2R0LH 4D0CA 4R6UA 1AACA 2I26N 3K4AA 5C07B 5BS0A 1O6SB 5ISZE 1OQOA 4PRNB 1XD0A 2WVVA 1J8HA 1P5UC 2L3BA 4H0GA 4GMTH 2ICWA 3EAKA 2ICES 3BW9A 1QRND 3MCKA 4BRJA 1KPVA 2AEQH 4IKJA 1JVLA 4MJID 3CU1A 4XZ4A 5CUSL 4R2GD 1PZAA 2QHLA 5F3BA 3WLBB 1CIDA 2F5AL 3GSOA 3V5KB 4G71B 5E2WH 9CGTA 1BVNT 1FV1B 4WI4A 4N85A 2IGFH 2G5RA 2NQCA 4KK8C 5AAMA 3SBQA 4P4KD 4EDXA 1ZS8B 3PY9A 5E94B 2M8XA 3KR3L 3UTOA 4FQLL 4QEGA 4WO4D 4Z0BH 3BP7B 2F18A 3U48A 1P0SE 1T4KB 4MKTA 2DKUA 3KPRE 5IW3A 1YNKH 1RZFL 4RBPH 3SYPA 5I18L 3ILDA 3FDWA 1CG9B 2VDLB 4FQ2L 4RGNC 4QPEA 4Z9KB 3ZLQC 1D6VH 3U7YH 4J4PC 4CVWA 3KPPA 4MA8H 2UY7B 3KPMA 5DZLA 5EHFA 5L2KE 1GJUA 2BVPA 2FO4B 1AKJB 1FL6A 5ITFB 3RTQC 3KL3A 5A6IA 2N0KA 4GBXC 2PR4H 2C8NA 1HT6A 3CK0H 3LZFL 4WKZB 5GGRB 1FDLL 1W0VA 7CGTA 5LCVA 3FTUA 4QXVA 5D7HA 2HX7A 4AXWA 1OCWH 2G60H 5C86A 4Y19D 3S8GB 3UXFA 2N3JA 3EG9B 5T1LB 1MFDL 1IM9A 1BYPA 1FFNA 2R8SL 2A73A 2RHEA 2F53A 3FO9A 5F0MB 4MXVE 5B38G 3V5HB 1CXEA 1JGIA 2R7EB 3RYMA 4DN4L 2P48B 3NCCB 4PWJA 3M45A 1OARL 4P5RA 5KSBB 2R2BB 3O3DB 1VPOL 5DFVC 1JV2A 3MRLA 3MBXL 2B15A 3WELA 4YEFA 1I7ZA 4RMSA 4JDZA 2ZX7A 2J6WA 4OLXL 1BREA 2BOBA 5DMGD 4LVOC 3TIDB 1PZ3A 4WEEA 5AVRB 1T4WA 5JHLL 4U1JB 3GSUB 1LE5B 3L4ZA 2ZTBA 5DQ9A 2FX9L 2QQKH 4G8GA 3SODB 4LMQI 5ICXA 1G9NC 2WNXA 4XNXL 2ED6A 2HG0A 1KYDA 3MLSL 2CD0A 5J4MA 5I6MA 4KWUA 3BWSA 4HJUA 1MFVA 3SOBH 2CKBA 3RDJA 2HT2D 4RMQA 7FABH 2PW1A 2NY7H 1X7QB 2Y1YA 3FFDB 3MRIA 5ENWA 3FQ2A 1DBJH 3KAAA 4AL8H 3W37A 3ZDXE 3RY6C 4PRIA 2NRDA 3VYPA 4H25A 3UCRA 3P4MB 5JZ7C 3IYLW 4WUUD 2FUTA 2XXCB 1E4HA 1BW8A 3U30C 3I9GL 4YFEA 4ZFOA 2XN9A 4BWWA 3WFDH 2A6IA 2K6YA 3L7FA 1FC2D 3ZMNA 4MBOA 4CVUA 3ULSB 4PLKD 3UTTB 4BZ1L 3EFFB 4HP5A 3EFDH 1KCSH 4CVZB 2ZUQB 3DXAE 1I1FA 3NCEB 4FMVA 1QVOB 3FQ4A 3D9AL 3BYYA 2YGPA 1NIFA 4Y9EA 4PJ9B 1GZPB 3FYEB 3EXJA 2MQ3A 1XGYL 3HZVA 2EXSA 4P46B 1CURA 4RWYL 2Z34A 3NSDA 4Y16D 3UJTH 3O6FA 1G7JA 5IMMA 4HUKB 3V8CA 3CU7A 3EJZD 5I0ZA 3F7PC 3OTTA 4UTAL 3DPBB 5IFHL 1CYXA 3EGXA 3L5WA 3VXPB 2ZUXA 3D6GA 2XKUA 3WO4B 5AVYB 1KCRH 2MOGA 5E95B 4Y9GA 2OYKA 4O9HH 2AAVA 3NK4A 5GGVH 1BZDA 2PMZA 1IEAA 1FFTB 4ZTPL 4C83B 3REVB 3OJDB 3PWPA 4YEEA 2AJVL 5T3ZH 1UD3A 3IM1A 1IGML 5C1MB 3D85D 3FH5A 5ACLA 3QIWB 2HA1A 5IR1A 4RFOL 1J5HA 1HH9B 4MDIA 4FZ8H 2P8MA 3CXDH 1NEUA 4M4RB 5E2TH 3RGBA 3ZTNH 3SPHA 4Y4HB 1HQRA 5C0RH 1EFQA 1H6UA 1RH8A 4RAVA 2PYFB 2J5LB 5JXEA 5C7XH 1TQUA 4DKFL 5T1MB 2O26U 4PJ8B 2Z31D 1M7DB 2O6FA 4KKCD 1GAFH 5EUKA 4POZC 4BXVA 3HJ0A 2E7HA 4MQXC 2HVKB 1Q9KB 4AKQA 4GKNB 2NY2D 1EQWA 3OKLA 1JHKL 2HVJB 2F5BH 4NO3A 1ZAGA 1KCVL 1L7IH 1NBYB 1YEEL 3FUIA 3CZUB 3K8MA 3PJLA 4YNYB 4AENA 3JV4B 3QRLA 2HRPL 4K94C 2AQNA 2VR4A 1JUFB 4AV0A 3VAEA 4QRRA 3UZEC 2HJLB 4XI5C 5DJ6A 3HN3A 4OSUL 2VLJB 5EFIA 1JL8A 2WXNA 3FSAA 2KLRA 3G6AA 4LGPB 5H94A 2YOAA 2VT0A 3CLFH 1Y6NR 3MRGB 5I75C 3LJ3A 4ZNEA 4J2XA 5LBSL 1FWXA 5JDSB 2CGRH 5GS1C 2ERJC 2BNUB 1JZEA 3LZPA 1ID2A 4PW4A 1W6WA 2NR6A 2C4XA 4WU7A 1T5WB 3VXRE 4FA6A 3P30L 1HCZA 5AW2B 5IB1A 2DWEA 4R83A 4FLHA 3SY0A 5HYJE 5I1CL 1OAKL 3DTDA 1NDGA 5DJAA 3DX8B 4BKTC 1PDKA 1TLMA 1CDJA 5GXBB 2HN7A 3EYVB 4NS0A 2VZTA 4NM8L 3VU1A 5MEOB 1BWWA 1D7BA 1JK9A 1S2EA 4UNVA 4HQQL 5ABDE 4P5MA 1F3DH 2ZNXA 1AGCB 1LEGB 3IJEA 4ZD3L 4TN9A 3S3JA 3H0TB 5IHZA 2Q7YA 4L8SB 3NFNA 3D39E 3FB6B 2EKJA 3K91A 3UO8B 3L3KB 2GVYA 4PGDB 5HDWA 3D0VB 2NUTB 5FM5M 4FZEH 4GRWB 2BZDA 2YOCA 4I18C 5EA0L 1BMWA 1JS4A 4QY8A 2BFVL 3A6BL 3DBXB 4BFIA 3VGAC 5L7XL 1ITCA 3VFPB 4Q58C 3BKMH 4HUUB 4UIMB 1CE1L 3UCQA 5KSVA 5HY9A 4GIPD 1AGDB 1E4WH 4FQHA 4TNGA 2X41A 2FNWA 2UY6B 3P4OB 3NAAH 3CFTA 3MI6A 2YD6A 2GKIA 3WHE1 5IEKA 3RX9A 3QAZB 1T0OA 3GSNH 2KH2B 3IK2A 1E3XA 4KQ3H 5HTSA 4L4VB 1XSKA 3FSOA 4HS8L 3LPGA 1LD9B 1J9CT 1QOKA 3CHRA 3HG1A 3RKDD 2FR4A 1T1XA 4E9RA 2F8OA 1E0OB 5I23A 4HYTB 1DQDL 2J71A 2AQ1A 4K3JL 4AVKA 2Y22A 4L5FH 4OFYD 2L04A 5CM1A 4DO6A 3KBFA 4UDTA 5GGQH 3NZSA 4JRYE 4D0CB 4TNWF 4OQTL 2VXSH 3ZDZF 3K6SA 1DQIA 1J1XL 1O7DE 5CCGE 1BFOA 2Z92A 4MRCA 2WVVB 1J8HB 5FLUA 1FIGL 3HC0A 4LP8A 4JCWA 3BW9B 1XR8A 3B8SA 3F7YA 3L5XL 1KPVB 1YG9A 1JNNL 1HHHA 1UKQA 2CHDA 3GBMH 1BZEA 5F3BB 5DU7A 3SPGA 3GSOB 1RUAL 3CFQA 2XQYK 4Q9QH 4YVNA 2QDVA 2HKHL 5JXAL 4KMTL 4QHKI 4KJWC 4G6KL 4EDXB 4DP5X 4TOYL 2YK1L 3ZY7A 4ZK8A 4GLRI 1OM3L 4CAGA 1MIML 2I27N 3U7WH 3DK2A 3S3CB 3PE9A 3BAWA 2O5ZL 4N5EC 4PFEA 3NZUA 3KJ4C 1WK0A 3RNQA 3NJNA 2E4TA 3KPPB 2DJSA 4M93B 4BKLA 1S7RA 3KPMB 3V0FA 4PHXA 2LQRA 2BVPB 2VCOA 1FL6B 1L9SA 1THCA 1FQ9C 1ONQA 1T7XA 2Z6FA 3ZKNC 1HNFA 2XA3A 4G1EA 4M6NH 4A7TA 3AC0A 5F2FA 1ASPA 5AFAA 1W0VB 1NOLA 2XWXA 1BQKA 4K2UH 2J6EH 3KYNA 1G84A 1SMAA 4ELMA 4UMSA 4OLUL 3K5RA 4XNUH 4AXWB 1SHWA 2WTRA 4WV1A 1IM9B 1FFNB 5F1SA 2A73B 4NNPH 2JKLA 2F53B 3FO9B 2DTML 4FXLA 2EE9A 4N90E 5FM4A 3OAUL 2FECI 4P3CH 1G0DA 4ZFQA 3WEXA 1JV2B 3MRLB 1N67A 4XPHH 4A55A 3NIDE 1I7ZB 4H40A 4JDZB 4WWNA 3LIZA 2BOBB 3EBAA 4YDLC 3ML8A 1NPJA 3CHQA 2XWZA 2OYLA 3SGJC 4BBWA 5DQ9B 3QZMA 3FT0A 4G8GB 1PX4A 1RUPH 5ICXB 3V0GA 5A2IH 1QHQA 4N1HB 3VD4A 1UM4H 4EI5C 2A6JA 3HC3H 3FF7A 3TPKA 1JFHA 2CKBB 3I74A 4RAUA 4ETQA 1RUKL 8PAZA 4PJBF 1MG2C 1NFDA 2OTWA 3MRIB 5ENWB 2Q7AA 1UYWL 4B3EA 4NO5A 3GEFA 1N68A 2A2QT 4KO9A 4PRIB 4YPJA 4H25B 3WS6A 4WEUD 2P45B 3CFUA 3E8UL 1IJ9A 1ZMYA 3V6OC 1JYXA 4ZFOB 3MV9A 2XN9B 2DLGA 3U4BH 1LL1A 1PF3A 2V3EA 5A2JH 4N0UA 4ONGH 5IVZA 2A6IB 5K9QI 1PSKH 5GZOD 3L7FB 5EOCJ 3GNMH 3VRLE 1RZKL 2MFNA 3QCVH 3QPXH 2JJSC 3VSVA 1I3UA 1YEIH 1A9BA 2JQAA 5T3XH 1F45A 1BBJA 1I1FB 2DD8L 4GUOA 4UOW1 1SJXA 5IFAH 3S97C 2VR6A 1CLVA 4O02L 3HZVB 2J8UA 4MMXC 5D70L 3U1QA 4MNHA 2CO3A 3FUDA 3O6FB 1G7JB 4MA7H 5IMMB 2DQFA 4KI5C 5HYEA 4N0YL 1KTJA 2WC7A 3EGXB 3L5WB 4WWKC 2D31A 2GSIA 1P2CB 2IALA 1PQZA 4IM8A 3H9SD 2EDHA 2WNGA 4J6IA 1JZ3A 2R4SL 4G82A 4H1LH 4HEMA 1IBGH 4N22A 5DVPA 5AVTB 1IEAB 2WK2A 2EADA 2QFPA 3PWPB 1MAKA 3ARRA 4YHOL 4KZ0A 2HP4A 4PS7A 1VCAA 3MNWA 5IR1B 2P5WE 2ZAHA 4MDIB 3N1PC 1Y07A 2P8MB 4OZHA 3MV7E 2BNRE 1MFCL 4MZ3A 4ZO7A 1HQRB 3S48A 4RAVB 3VACA 1LJMA 4QDGA 3FN0H 3OL2A 5DJDA 3APDA 4YHIA 2BVTA 4GRLD 4YSQA 5EUKB 3B9KD 4P9HL 4ZFFA 1EEZA 3GZQA 4RDBA 4D9LL 4Q9BA 1HIMH 1HL9A 5GIRA 3OKLB 1G7LA 3QI9C 2CHNA 4DAGL 1KN4H 4NO3B 1INEH 3VGHA 5L2JA 2EDOA 2JKWA 4AENB 4PRDA 4HBCH 2G2PA 4UT7L 4QRRB 2G75A 5DJ6B 2ZWLT 5EFIB 3NJLA 1U3HC 3G6AB 5H94B 3ET9F 2VN4A 3RBGA 2YPVL 3QHZH 3TURA 4JHBA 3JYCA 3QCUH 4WU7B 3SJVE 3OMAB 4N5UA 5B8CC 4O51A 3V0WL 4Y88A 2QTVA 2C1PA 5IB1B 1FYTD 2DWEB 3SY0B 2NY0B 5IIEA 3AT9A 3OHXA 3DKHA 1T2QL 1X4YA 1NDGB 5DJAB 4WSJA 1DBBH 1PDKB 1G7QA 5FF6A 4A39A 3ZW3A 1ZT4A 1Q72H 3FCTA 3EYQD 2HN7B 4DIXA 1I9JH 3RWFA 4HULB 5E70A 1JK9B 1WFMA 4OB5H 5D96B 4P5MB 2IAMD 3QJVB 2FX7L 2PCXA 3CBJB 4J1UA 3IJEB 1E4XH 2CDEA 1PLCA 2E9WA 5IHZB 2FWUA 2IPTL 2Q7YB 3NFNB 5CBAA 1W72A 3CZEA 3TOPA 3F7KA 4PD4K 3CC1A 4MB4A 1DQMH 3JWOL 1YECH 2YWYA 1WVZA 5C08D 1RFDH 1V7NH 2YUWA 1ZJBA 4QY8B 3CDZA 3QFJD 1OIOA 2QQNH 3O2VL 2HFEA 2JCCE 3ETTA 3QCTL 3NGBB 4GQ9H 1OALA 5KSVB 1HXYA 4NO0A 5HY9B 2CH8A 5KVGH 3VFGH 4PMFA 1UZGA 2EDLA 4JO4L 4FQHB 1TITA 1MSPA 2JSFA 5AW0B 5IEKB 1UZ6F 3QDJA 4NB7A 1PG7X 3HKZA 5TGBA 3CV5A 1IGJA 3AQYA 4ILDA 4LAQH 3BRGC 5C9JA 4M6OL 4Y1SA 4RISH 5F8RC 1J0JA 3HG1B 2FR4B 1MI5A 4L0ZA 1T1XB 2LTQC 1XF1A 2PXYC 4UIKL 4AWJC 1HS6A 5IW6A 4XPBH 3VYOA 1NMCB 2A77H 3BGFC 4P57A 2JNZA 2NY4D 2ZONA 3ISRA 1XL6A 5F7NC 4UDTB 4ZTOL 1GTNA 1MVUA 1BM3L 3VSUA 3MXVH 2YD3A 2PPAA 3K6SB 2CK2A 1NAMA 4X6DF 1BFOB 4NFDA 2Z92B 5GPRA 2L4OA 4JPIA 4G6MH 2ITCA 3HC0B 4FFYA 4OCSH 1BBDL 1XR8B 2D0FA 5AKTA 3ZTCC 3F7YB 3JVFC 4KDTC 4WW2A 1HHHB 4YHYC 5E51A 1UJTA 3GUTA 2Z65C 5IUSA 1CTMA 2E9IA 3MN8A 2WGNB 4LLQA 3GIZH 4R97B 2A9NL 5D6DC 2DYRB 1TJGH 2DTSA 3UTTE 2FHBA 1G9NH 1D5IL 2APTA 5KAQF 1D7FA 3AG1B 2BY0A 4IBLT 1JHTA 1OB0A 4KMQA 5LBGA 1DBAL 1SGKA 3ARDC 4OU3A 4IOFC 1CFVH 5LN8A 1AC0A 3OC8A 3NFSH 2Y24A 3RNQB 2EVFA 5E24E 3GFUA 4WLCA 2EDMA 1S7RB 3MROA 3RNKA 5EZJA 4WI7A 4YSOA 1YQ2A 1N5YH 3FNKA 3PUUA 5DMIH 1BZQK 3SKMA 1ONQB 2VJXA 1J12A 2F0CA 3K6DA 4G6JH 3N41B 4K3DH 3K6IA 1CGYA 3NFPA 3ZDYB 1N6VA 3KYNB 3O8XC 4CC4C 1DVQA 1IAII 5F7EL 1MVFA 3NH7L 5JPMC 2WTRB 4WV1B 2I9TA 2O5XH 1FAKT 4LVNB 3PGCA 4PVNA 1YYCA 4D0DA 4DKEL 4Q4IA 4HJGA 3HN8A 4MCYA 5H37A 3VM5A 5EZIH 1A4KA 1WIUA 4JM4L 3IPFA 3TT3L 4HUCA 1A47A 3WEXB 3AU1A 3HN5A 1EX0A 4GEJA 1DVZA 1W8OA 1JNLH 2Z4TA 7PAZA 3ASWA 1KLUA 4HJ0C 1IKOP 3FRPG 4NJAH 1BAWA 3LN9A 1HSBA 2HLEB 5FM8A 4R0LA 3SE3A 2DQDH 4KJWD 5CN2A 1ASQA 1NA8A 4N8VG 2XJKA 2OSXA 4ODVL 1FNLA 3MLXL 5FGBC 1XGQA 3U36A 4BSJA 3UTQB 2VLJE 3K74B 4LOFA 1HZHL 5AZ2L 1JD7A 5KJRL 1W9XA 2A6JB 3ZUNC 3MV8A 4JDEA 2JKJA 4KKAD 5D1QC 1T21A 4PGZA 3T0AA 5I1JL 5IJDC 2VIRA 4RAUB 2WIIA 3T8XA 4ETQB 1HAUA 3IGLA 1F58H 1NFDB 2E7MA 2OTWB 4LLUA 5C2UB 4NO5B 5HDBB 5GRVL 2CNYA 4LEOA 2WZ0A 4UOW0 1MCWM 4KXZI 4Y9CA 4KHTL 2E27L 5MP6L 3RUGE 3UYPA 1JMZA 5IUCA 5ADPH 3JUZA 1NCUA 1NZRA 4N0UB 2VDRB 4K94H 1QSEE 3DIFA 5IVZB 3AS1A 5E9DD 1A9BB 2WO3B 4ZW8A 2DQEL 1FBIH 2IPKA 1BBJB 2OR9H 3HHMA 4RESB 5FCUH 4WUKL 3HZMA 3MA9L 4N2OA 4WCYH 1UG9A 3V4VA 4APQC 5JIDA 2J8UB 5IQ7H 2GTZA 2WKOF 4PJXA 1ZLUH 4MNHB 3N44F 4GRWE 4X98B 3DDFA 3VGEA 2DQFB 4HEPG 1EMTL 4YHLH 4ZUSA 4KV5F 5DT1H 3LHPL 2D31B 2FEEL 2GSIB 2IALB 1PCSA 2DQGL 3FN3A 4HXBL 3U79A 3BESR 4U4BA 4R5VA 1XB8A 1R3JA 4D8OA 3EHBC 4YOKA 1MAMH 1RHFA 2Q9OA 1P4BL 1Z2KA 2E5EA 3MNMA 3E38A 3WTXA 3MUHL 1I7UA 4KH2A 3LS5H 4LBEA 3GRWH 4WSKA 2X2IA 4JEGB 4OR1A 1TQTA 1I8KA 2LW3A 3T8MA 1S7TA 4YDIL 3MNWB 2GTQA 4K23L 5IHUH 4OZHB 3R1GH 1M9WA 2GYSA 3ETBF 3MREA 1R19A 1JZ2A 3LAFA 5HI4D 1KSRA 1X5HA 5DJDB 3N6YA 1FORL 4YHIB 2CDFA 2ZXGA 3JXAA 1RZ7L 4DGYL 1AQHA 5EO9A 1TZGH 4ZO9A 5K33A 1NFIB 4LVHB 5CLXA 4ZFFB 1EEZB 4N2DA 4YSRA 4J3VA 2D3VA 5GIRB 3HI5H 1G7LB 1GIGH 4LQ1A 4TUJA 5L2JB 1BHGA 3LXBA 4PRDB 3ARPA 3CX2A 3BN9C 4JQVC 1RL1A 3PL6D 1KXTA 2YN5A 5TTRA 4F2MA 1A66A 3F7VA 2G75B 5D2LF 4ICXA 2BIHA 3S88H 1E5AA 1G4RA 4HHWA 2PPDA 4JO3L 4MJ6A 2FQEA 2R27A 1Q38A 4LPVA 3JWDL 3UBXI 1RAMA 2VITA 4BCZA 4ELMF 5CJXA 5B1AB 4TPRH 3BRFA 4O51B 3QEQA 2C1PB 3ATFA 5IIEB 5JOPD 1J9QA 3OHXB 3QT2A 3CTTA 3ERXA 3CLEH 3CBRA 5D1ZD 5FF6B 1G7QB 1XB3A 3GMPA 4HSAC 4HK3N 1ZT4B 5T33L 3FCTB 3GRGA 4YH6A 3RWFB 5A16A 4K8RD 1V05A 4MJ4A 1EAQA 3RZCA 1CE6A 2R4RL 3OF6D 2ZKHH 4GRMA 2VXTH 1JTTA 5D7JA 5AVQB 4J1UB 3T0EA 1P7HL 1F42A 4U1HA 4BYHA 4Y1AE 3BO8A 2CDEB 1ZD6A 3BLKA 4H1LG 1LVEA 4L3EE 5CBAB 1W72B 3KXFD 1KBKA 4AVIA 2FTAA 2VO5A 2QPFA 2BHFA 1MCCA 5ITBH 1KIUA 2X89A 4DOHB 1GY2A 1KT2A 4ATWA 3KHQA 2YKKA 4NWUH 4AM0Q 1MCWW 3CDZB 2ZYIA 4N4YB 2HFEB 1KN2L 4CJ0A 5FX3A 5IMLA 1OGAA 1E7UA 4NQEA 3K5SA 3N85L 1G7MA 1HXYB 3FT1A 4X9GA 5HDBF 2FLBT 2CQVA 3SBRA 1MPAL 3FT9A 3W39A 4XXCC 2KT6A 4QOKD 3BD3A 4XAKD 4HPOH 2WQ8A 3N9GL 3AU0A 4M48H 3QDJB 1QZ1A 5TGBB 3HB3B 2CGYA 2QV4A 1IGJB 4PV1C 5FYLD 4G9FA 2VERA 4JLRA 3UJJH 5C9JB 3F62A 1IGCH 3UP6A 3DOIA 5DD1L 3UC0H 2GK0A 5BOJA 1MI5B 4V2BA 5IW6B 4J3XA 3INOA 4P57B 1JGDA 2UXGA 3QUXA 2Q8AL 3TJHD 4Z8FH 3BWUF 3QDAA 3VFMA 4HGMA 3QIUA 1E43A 3KHOA 4XP1H 3BKJL 1UFGA 3WDIA 4JFQA 5LN4A 1JTPA 3RB5A 1MVUB 4Y9BA 1TNNA 5JUEL 1E3ZA 3GI8L 3BAEH 4K7PX 5CCKH 1NCIA 4NKDA 4R7LA 3QUZA 2YFOA 1NAMB 4MXVF 4HPYL 2V5RA 5CINL 1JXFA 4JPIB 3SE9L 2ITCB 2VLMD 1CF8L 4UYQA 2KKQA 2OYPA 4LPTA 3PV6A 3GSVB 4WW2B 3VUAA 1ZSHA 3FQYA 4HWEH 4PRIE 4KQ4L 2UXTA 3RI5F 3TBVA 3GUTB 3KWXA 1K9TA 4ENED 1NKRA 3QJSB 3BT2L 4LLQB 4NKMA 3KLKA 1ECZA 2XN9E 3EADA 1QR1A 2V4LA 2X6AA 2XYCA 4MX7A 1OT4A 4LSVL 1VJSA 2QGEA 1KC5L 1UT9A 4FEIA 1JHTB 1X5MA 2LHAA 3ULVD 2HUHA 5KTEH 4GKOA 5J13B 2ZXWB 4S1DD 5TF1L 5DGRA 4HJSA 3ZDXF 5TQ0H 4ODUA 4TQEL 4TM9A 3QZNA 1U8PA 3EJCA 4IIZA 3MROB 3RNKB 2GJPA 4OJDH 5EZJB 1F97A 5ESAA 2C3WA 2YLHA 5HJGA 3MOAL 1S9YA 3SKMB 5FYJD 1RURH 3KL5A 4OUUA 3FFCD 5E1HB 2CO2A 1E50A 3NFPB 3WUWG 4ZSOA 3CHXA 7PCYA 3TJEL 3GLZA 1SPDA 4CC1A 1N0XL 3K2UH 4JHWL 2YGOA 4P2QD 3WN5B 3TH4T 2I9TB 3T6VA 4JGJA 3PGCB 1NSNL 1IC4L 3K0WA 4D0DB 4HJGB 4NIYE 4LF3A 4MCYB 1A4KB 3AU1B 4I1NB 1E2VA 4E41E 3EDJA 1SNRA 4BGLA 1QLFA 4MQ7A 1KLUB 2IBZX 4Z7OE 4GS7B 4JE0A 3F58H 1AGFA 5T5FA 5ICZA 2H6OA 1HSBB 4R0LB 1WHOA 2P24A 2HT4C 4K8RH 2YUVA 3FJTA 3TA3A 5DCCA 1FNHA 1M42A 2UZIL 3TFBA 1XGQB 4UQEA 3U36B 5FS5A 4OD1H 2V0AA 3BQUA 1JV5A 5INCB 4F5CE 3ZU8A 5FHBH 4ZNEE 5K9JH 1QUNA 3MV8B 4JDEB 2WZPA 3NJFA 3HR6A 1T21B 3Q2CA 3MCG1 1FO0A 1SHSA 2WIIB 2VIRB 3T8XB 5L88H 4LLUB 5GZNA 3SDCD 2VDOH 4IRZH 2H0EA 2CJUL 2IH9A 3NT0A 1AYOA 3RVTC 3T3MF 2JKNA 1QSFE 3QJOA 4LEOB 4PG2C 1ZHBA 1UJ3C 2VDNB 4G7SB 3P69A 5LG1A 1A0QL 4XPAH 1DSYA 1F18A 2AJZA 2XWCA 3UYPB 3VI3E 3QUYA 3S34H 2O5YL 1E5BA 1FNEA 2WLLA 3U6XS 4JS7A 1SM3L 3D9AH 4GOSA 2EQDA 4XCNA 2ZX8A 3BSHA 4RRPG 1JK8A 1BIHA 3RL1A 4BWUA 1MY7A 2OV0A 3P11H 2BVYA 2IPKB 3P3YA 3QQDA 4I9WD 4BK4A 3HZMB 3ZJAA 4UTBH 3QBTB 5GJSL 1FNSH 2JB5H 3V4VB 5FYLH 4S10A 4TVPE 1BQUA 2GTZB 3H7BA 4GFXA 3QUMA 1CICA 4MVBD 4PJXB 3TV3H 2B08A 4GW1A 1IAIM 1KJMA 1J5OL 1CN4A 5DEFA 4QHNA 4ZUSB 2ZUQC 4LSTH 1TENA 4UQ3A 4BD4A 1AKPA 2VH5H 3Q2WA 3G5WA 4J23A 4FQJL 4PJ9C 4YAQA 4P46C 1R3JB 3L81A 4DUWA 2C9XA 1A22B 5DRZA 3IT8D 1J5CA 1SOKA 4WW2F 4FHKA 4TNWK 3S9DB 4L9DA 5CGMA 1I7UB 4U2YA 1GGCH 4QF1A 4LBEB 3GKZA 2ZUTA 4CN6A 5J1TC 1KLFA 1NIDA 1I8KB 3MGAA 4K5LA 2MCG1 4RMUA 2FWSA 1S7TB 5LXVA 2WW8A 4RGOL 3EYUL 3I6SA 3T0BA 3UYRH 2BNQD 4QXGH 2HJKA 3QEUA 1II4E 3MREB 2VDQH 2UYLB 3GBNH 3HG1E 1EBPA 4OZGA 5HGAA 1IBBA 1N64L 2EXYD 1QSVA 2CDFB 2V5MA 5I1DA 5EO9B 1MQKH 3GI9H 1C1EH 1BVNP 4FXKA 3UP1A 2OBGA 4KY1H 1H8NA 4Y4HC 1FL3A 1L4IA 4TUJB 4Y8DC 1T7VA 2J5LC 3MTRA 2PO6A 2Z0BA 3G5YA 4F2MB 1ED3A 1MCKA 1KXTB 3JV0A 4TV3A 5I15H 2IH1B 3O2WL 4PJ8C 4YE0A 1U2CA 2EIKB 3F7VB 3BAIA 3IJ7A 1LO3H 2Q6WA 2H6PA 5HBBA 2XXMB 3UZQA 4TVPL 4MJ6B 2GEEA 1X7SA 2R0WL 4OLZL 4R8WH 1S4IA 3ZQWA 2VITB 5FCSH 3BI9X 2WKLA 4YUEL 3M7OA 4BFEA 1L6ZA 2BSTA 2XRAL 5EDXA 5E6ZA 3SGKA 3R0MA 1PLAA 3HRZB 2XLLA 5EU4A 4XB7A 1MCHA 3C5ZD 3QEQB 5D7LE 3F8UB 4GP8B 1MZZA 1RQ5A 4JO8A 5FYJH 1U0QA 2YAOA 4L8CA 1J05A 1MCBA 2J7LA 2N1KA 3EJJX 3GMPB 4MFHA 3MHZA 4QLRA 3MBWA 4AIOA 5J56B 3APNA 5A16B 4OZFH 1NPUA 1QEWA 3RZCB 1CE6B 2B9AA 5DUBA 4GRMB 1ZHKA 2MKWA 1OY3B 2PCPA 3MJWA 2R56L 5D7JB 3T0EB 3WD5L 4FXTA 3GXIA 4PHZA 1UD6A 2WO2B 1YMMA 3BO8B 4OM1L 5D4IA 5AZEL 4ZMZA 3FN9A 4GG6F 4XX5A 1T1YA 4JREB 2QMJA 2X44D 1CO1A 3B6SA 5A3ID 5FUCE 3QDGE 4PP2A 1KIUB 1DSFH 3OHMB 4M02A 1KT2B 4AH2A 3FRUA 1UGKA 2Y25A 2DJMA 4Q2ZA 1E5ZA 4L8SC 4H7VA 4LLWA 3MLWL 5IMLB 1OGAB 4NQEB 2P8PA 1G7MB 4RLDA 4FADA 3BN9D 4JPKH 1KJ2H 3JWDC 3ZDYE 3GF8A 4MJ2A 1A7BA 4PRPE 4YXKL 4LDOB 4XX1G 4ZO8A 5GS3A 2LLGA 3W39B 1A1OA 1Q0EA 4HWZA 5DHVH 3TO2A 4IQHA 2F58L 2YGQA 2BY2A 3DYMA 5HDRA 4PJGA 1X5XA 2GW5A 4G9FB 4JLRB 4KX7A 4L4TE 2IADA 4K3JH 2GK0B 3HE6A 3HE7D 4NKQB 4X7EC 4BINA 2YD1A 2QVFB 1NCHA 2C3XA 4WJ5A 5K59E 2H1PH 5LHDA 4WFFD 1JGDB 3QUXB 1F0LA 1S3KH 2YUZA 3UROR 3VFMB 5JW3H 2AEIT 1RY7B 3QIUB 3N0PB 3SCMD 3JYBA 3U9PH 4JFQB 4PJXF 2AS5M 4LASL 3L2NA 1TTUA 5DZVA 3GZPA 1YEHH 4IKLA 4NKDB 1SMDA 3G6JE 4LOEA 2E8YA 1HEHC 4OF7A 1Z0MA 1M7UA 4GAJL 1XXFC 1B9KA 2Y7OA 1A7OH 2VN3A 2KDGA 3VI4A 5DC0A 1XD1A 4WIQA 4P9ML 4QTIL 2PTTA 1I3VA 4FLSA 1NFDE 3HAEA 3PV6B 2NY5H 3D3VA 1Q9LA 4PJFE 2Z8VC 1SXCA 3C5XA 3WIHA 5FGSA 1PLGH 4BM7A 1IQWL 3TBVB 1KPRA 2D0HA 4DWHA 2WYTA 4ZW7A 3KPSD 5F1IA 2WVSA 4NKMB 2DWDA 2UWEE 3BIKA 1RUQL 1QR1B 1CD1A 4LKXA 4YHZL 4RGMB 4CN1A 3I6KB 4MX7B 2I60L 3FO0H 3OXRA 5A40E 1KCUL 1SOQA 2R29A 3E1F1 4H20L 2WYZA 5F6IB 3VH8G 3SDAA 4UZUA 1KYOJ 3FTWA 5KYYB 4PR5A 4HC1A 1JF5A 5AAMC 2J8UE 3Q48A 2YC1A 5B38B 3TP4A 4ODUB 1HOEA 1NICA 3LIZL 1M53A 1NMAL 3CZNA 3TU6A 4HSCX 5ESAB 2ESVA 3I6LD 1HCVA 5E99H 1S9YB 3UBXA 4ELDA 4HCGA 1YYML 4OUUB 1I8LA 4WW1A 4CKVX 4OLUH 1I3RA 1MCIA 1OHQA 1SFDA 3VD9A 2VUKA 4DPBX 4M93C 4ZSOB 1MKFA 1AD0A 1Q90A 1REIA 3TBYA 4ZMPA 5DO8A 1WFUA 5M94B 1YLBB 3MCLH 2XWJA 1UVQA 4NQDA 1G0XA 3UBHA 3CZJA 5D6CB 3JWNH 3ZUCA 4MSWA 4LF3B 3LB6D 1WZAA 3V9EA 1IKNA 3PWUA 4MB1A 4X99A 4P5TD 4ZS7H 4TMPA 2HXAA 4NENA 3TPUA 4MQ7B 2CBTA 3AADB 4WNJA 4XZUA 1ACYL 3V9FA 1AGFB 2A1WL 5ICZB 3COOA 4PJHE 3LEYL 1N6QL 2P24B 4HU8A 1NANH 4FTVA 2PP8A 3HG2A 3L48A 2ENQA 4XOCA 4TKWA 4Z1PA 3BQUB 2A74A 3Q1SL 2NXYD 3D25A 1R6VA 1QUNB 1VFMA 5J6SA 3MRQA 1ACXA 3DO4A 2J12B 3U0PA 2WSKA 4GH7B 4AQ1B 4JG1L 1PCXA 4NX0A 5EV7A 3FS9A 1OTUD 4U3CA 5M7QA 4GEIA 3GBDA 4H2CA 1ZHBB 2VZ1A 4CMHB 5AW8B 2V7NA 4TUOA 2BH0A 2AJZB 4HK0B 4UBDC 2AMUA 1MWAH 1QW9A 1PEWA 1G94A 2WCPA 3QUYB 4JKMA 2FQFA 1FNEB 2WLLB 4M3JA 5FUOL 3A4AA 1BA9A 2V2XA 4DP7X 1FC1A 2YAMA 3VXUD 4NQQA 4UANA 2PPCA 1JK8B 3RL1B 1EIBA 4LEXL 5J3HC 1VFOA 1AHMA 3C8KA 1BD2E 2H32H 1T66D 3QQDB 4AVHA 2YPLE 1QQDA 4ZAKD 1C7TA 1WPCA 2NYYD 1WICA 5EOCL 4YSAA 3C6LD 4NJ9H 1JD9A 2QPUA 1U91A 3H7BB 3QUMB 1CICB 2Y06L 1A8ZA 2VXVL 4UT6H 4GW1B 3WMSA 1KJMB 2R4SH 3U1SH 4HOXA 5IMOA 5DEFB 1H0DA 4QHNB 5DURD 4LSRH 1PAZA 2JF1A 4UQ3B 4DP1X 2VDPL 3ECBA 4YAQB 4JFDE 2DY2A 5EU6A 4EVNA 1MCEA 5BNXD 4ZMWA 5DRZB 2EIZA 3O6FC 4ZFGL 2A38A 3OLGA 2B1AH 4QF1B 5EIVA 3RVVC 5CLWA 1KLFB 1I1RA 1L0PA 5TDPA 3K8KA 4DZBA 2D7MA 3MRCA 4BQCA 4DHLA 2ALWA 5DUPL 4X5XA 1R3HA 2HJKB 4TULL 3QEUB 4J3WA 1AZUA 2GFBA 2VLRA 4OZGB 5HGAB 3RBSA 4DPRA 4ORGA 4QRPA 5D7EA 4A67A 3WU1A 5I1DB 25C8H 4ZODA 4MHHG 4FXKB 2JCCF 5TF0A 2F54E 5DVKA 1FL3B 2PO6B 1MCPH 4R7DA 3G5YB 2F19H 4X5LA 1MFEL 1ED3B 4HKXA 2RMNA 3EO9H 2IDQA 4Y2DD 2Y7MA 1JHLH 4DKAA 3QQ9C 2IQ9L 4L29B 5DI8A 2Q6WB 2H6PB 5DLML 3UZQB 1XEDA 3NABL 4XXDA 4DGWC 3DLQR 4N2MA 1PZSA 1IZJA 2CJTA 5IJKC 4KDVA 3DX9A 1V10A 1BP3B 1FVCA 2BSTB 1RZGA 3IU4H 2WWKT 1V3KA 1CR9H 1FFOA 3QORB 3KBPA 5EU4B 2A99A 4OH2A 4EDWL 1OD9A 4KQ0A 3ARED 4AMXA 4K5MA 1MEXH 3ILQC 4L8CB 4YQXH 1J05B 5DZJA 1YNTF 5CGBA 5B3JE 3MBWB 4M62L 2NR6C 2QSVA 1SRDA 1QEWB 2IPTH 1NCAL 4R7XA 1FF5A 1QRNA 1F3DJ 3EJRA 1F3RB 4UZGA 2FX8H 5DUBB 2IEPA 1ZHKB 2NY0C 2GJ6D 4X5PA 5F7AA 2NY1B 2PCPB 1WE5A 4MJIA 3Q6GL 4IHBA 4B9ZA 5CJ5A 3O4LE 1LMKA 1YMMB 5C2BH 3VWJD 3QUKA 3ZMEA 5JHDD 4QAWA 1BEYH 2ZOTA 1T1YB 5D8JH 4JGMA 4EF3A 3GJFH 15C8L 3S5YA 4HZAA 3B6SB 4F33A 3D33A 1BIIA 5D96C 4PP2B 1EJOL 1QG3A 4P4KA 1AE6H 4IBTA 4PJDA 4AH2B 4DEPB 3FRUB 2ZSWB 5FK9A 4WO4A 3ZL2A 4Q2ZB 2VSMB 1K5WA 4LLWB 3LRLA 1EGJL 2GBUA 3BYTA 4PJAA 4QHLA 3WEAA 5I8CA 2P8PB 4OY9A 5AOLA 3AMLA 2NY6D 1NM4A 3MZGB 1B3JA 5F7FA 1EDQA 4FFYL 2OMWA 1A1OB 1SLWA 1M3JA 2Z4QA 3KE0A 4HWZB 5FHAL 3TO2B 4M7KH 3BVUA 3NGBC 3D48R 4PJGB 2IADB 3HE6B 3F84A 1GYAA 4WJ5B 1M7XA 4FQCH 3FQUA 1DQLL 4ODHL 2IG2H 2QVTA 4HXAL 4JFZL 2VLKE 2ZKMX 1YUKB 2WLNA 4MXQD 4Y19A 4F8OA 1Z9PA 3GHBL 3BKYH 4PLOB 2J73A 2VDLH 1UWGH 2CGZA 1K6QH 2ZX9A 4QNPE 1BJMA 3NDYE 4YHNA 3IFNL 2VDML 4ABWA 4WEMB 1KACB 5C0AD 5F0JB 3X3GH 2ZCKH 2X88A 1G9HA 2W5PA 1MHPH 1FLRL 3IBEA 1E3FA 3DNKA 1JFQL 5FDWA 1XGTA 3VI4B 3NYKA 1DFBL 3VVWA 2VM3A 3IMRA 4I1RA 1FAIL 2Z93A 2PTTB 2ZP9A 2ZYRA 3MLTA 3HAEB 4KUZH 4OZFG 5C0CD 5KYXA 3D3VB 2YAFA 4UV4H 5AOZA 1Q9LB 1F3JA 3LDBB 3WEMA 4NNYA 1FL5A 4XOAA 1MNNA 4FFZA 1WWCA 1KPRB 3OM3B 1IFHL 4ANKA 2WXRA 5F1IB 3LKNA 5C09E 5DJXA 1SN0A 2DWDB 2VSKB 3BIKB 3CJJA 5J12C 5I8OL 4GO8A 4OZGF 4UV7H 1CD1B 4LKXB 4JR9H 3H2PA 4BH8A 3OXRB 3EFOA 3K80A 1SEBA 3GT6A 4N6RA 1V7MH 3SDAB 4UWQB 1WS7A 5LQBL 1KJVA 4PR5B 4WUUA 2D3LA 5I1HH 2HPOA 3BDXA 4R97C 4XPFL 5CZKA 2YC1B 5A7BA 2BJML 3CDYA 3DJ9A 5F96H 5BXFA 5HHPA 5F9JA 1DO6A 1L7TL 5B7MA 4YLBA 2ESVB 1QASA 1CGSL 1QYGH 2Y2YA 3UBXB 4G2AA 1ZDSA 3G5ZA 4QYAA 5TE4L 1GGYA 3WKMH 4GSDH 4WW1B 2HRHA 3B56A 1JWUA 2Z9TA 4Q8BA 1I3RB 5C0EA 3ARFD 3IGFA 5C0BE 2BRQA 5C0JA 1E5UI 3FBQA 1Q0XL 2V8LA 5TE6L 3TBYB 2VW6A 1E5YA 4Y16A 4Y5VC 4YXHH 4I3SH 2NSMA 4X0NA 4M9OA 1TQBB 4M7JH 2XWJB 1UVQB 3NP3A 4NQDB 5DO2C 4FHJA 1H3WM 3BGAA 1OP9A 4JHVA 4GT0A 1R1CA 1ADQA 4MSWB 1J8KA 5JORA 1R3IH 2WXIA 2Y6TE 3PWUB 4GQQA 5L6YL 2C9QA 1NCWH 4X99B 4DP0X 1QTPA 5CJ8A 3BFOA 4WV1C 2O93L 4NENB 4KROB 2GJZA 4LVNC 1UACL 5D71H 3TPUB 3UL4A 4JFVA 4XZUB 4Q52A 3D85A 3OGCA 2C34A 5AKRA 1Y0LA 5JMRA 3KEHA 3DC0A 3CFKA 4N20A 5A2CA 1OE2A 4CDHA 4UOQA 4TLUA 4FTVB 1Z3RA 4NAQA 3ZZSA 3WY1A 2WZAA 4MASA 1KXHA 3WJJA 1X6NA 4FNUA 2A74B 2YD5A 5FOBA 1S78D 2Z31A 3W0WD 4M1CC 2JI3A 3D25B 2E46A 2ZIDA 3CHSA 4FDWA 3UTPD 2Q86B 3G04A 3MRQB 1ZEAL 5AW5B 3ZL4H 5HGBA 1GGIH 3O6LH 3U0PB 2C9PA 2WKGA 1E4KA 3UTZA 3D0LA 3FOLB 2BIOA 2F61A 4KJYA 2J6EA 3C2AL 4OCXH 4DESA 3DIVA 3Q2NA 4HJEA 2I69A 4PRHD 4FNQA 3T0VA 3W57A 1IO4C 3WNIA 2V7NB 3QISA 4TUOB 3DRQA 2GUOA 4HWBH 3MNDA 3PWJA 3VX0A 4LNRA 4JM2D 5JIKA 4S1SH 1A65A 5BVPH 3UIZA 4R3SA 2E86A 3IE4A 2LE9A 3KCPA 2V2XB 4FQXD 1I1CA 3JBG7 3QO1A 4N2GA 3EH4B 5CGYD 2IAND 3BE1L 3C8KB 4NP4L 4DN3L 2P1YA 4F7TA 3OB8A 1PD0A 1P7BA 1QQDB 1EMTH 4JY4A 3E9UA 4ZMYA 1U91B 2XN1A 1O0VA 1FNAA 4WFHD 4XC1L 3FTZA 4YBQD 4C56E 1ESOA 1UCBH 2HFGH 2PR9A 2QQLL 3LMJL 4UNUA 4XWOC 5IMOB 1IVTA 1H0DB 3WTTA 1TEFA 1J86A 3QFDA 4WZ9A 1X44A 5JW4R 3DSFH 2KI6A 3ECBB 1ETZA 3BWUC 3RVXD 1FE8L 1PNDA 2AHIA 5EU6B 4EVNB 1DQJA 4U4IA 3F12B 3K6NA 4W9IC 3T4AA 2EIZB 2I32A 1IB5A 4GMSH 4P2CG 3KPLA 2GB2A 3AWFA 4NUPA 3PREA 5TDPB 2D9QB 4DZBB 2DPKA 3ARSA 1OAYL 3MRCB 4PIBA 1UM6H 5ICUA 3D05A 1BPLB 4PCYA 5DZ9A 5IESL 4X5XB 1R3HB 4KK9C 4G9FE 3EBHA 3QC6X 4TF4A 2GFBB 2VLRB 4FF9A 1VFUA 4Z7IA 1WAEA 3FHEA 4ORGB 3PDGA 4QRPB 3BVXA 2VB5A 1U92A 1DCLA 3RI5K 2BCMA 3WXWL 3ALWA 1KYFA 1X7TA 3NA9L 3OAWA 2ZXAA 4P5SA 1X5KA 1GS6X 4KVNL