1HU8A

Crystal structure of the mouse p53 core dna-binding domain at 2.7a resolution
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
186
structure length
186
Chain Sequence
b'TYQGNYGFHLGFLQSGTAKSVMCTYSPPLNKLFCQLAKTCPVQLWVSATPPAGSRVRAMAIYKKSQHMTEVVRRCPHHERCSDGDGLAPPQHLIRVEGNLAPEYLEDRQTFRHSVVVPYEPPEAGSEYTTIHYKYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRDSFEVRVCACPGRDRRTEEE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CELLULAR TUMOR ANTIGEN P53
molecule tags Dna binding protein
source organism Mus musculus
publication title Crystal structure of the mouse p53 core DNA-binding domain at 2.7 A resolution.
pubmed doi rcsb
total genus 35
structure length 186
sequence length 186
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2001-01-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1hu8A00
4IBTA 1HU8A 1H9DA 2ADYA 1IO4C 4IBWA 5AOMA 1HJCA 4MZRA 3TS8A 2J1WA 2GEQA 1CO1A 1EAOA 2X0WA 2J1ZA 1TSRA 4KVPA 2IOIA 3D05A 3D08A 4HJEA 2BIMA 5G4MA 4LOFA 4QO1B 4IJTA 2WGXA 2BIPA 4MZIA 5LGYA 3WTSA 1TUPA 1YCSA 5BUAA 3EXJA 2PCXA 3VD2A 4GUQA 2VUKA 3D09A 3WTYA 3WU1A 3ZMEA 2AHIA 4IBVA 3D0AA 1T4WA 3EXLA 2MEJB 4LOEA 2X0UA 4AGNA 1GZHA 1UOLA 2RMNA 3IGKA 1GZHC 3D06A 3Q05A 4AGPA 2AC0A 5AOKA 3US0A 3IGLA 5ECGA 4A63A 1LJMA 3VD0A 2YBGA 5KBDA 5G4NA 3QYMA 3Q01A 3WTUA 4IBUA 5ABAA 4AGOA 1EANA 4AGMA 3D07A 2J1XA 4IBQA 3WTVA 2BINA 3VD1A 2XWRA 2J20A 4LO9A 2BIQA 2H1LM 2J1YA 2J6WA 2J21A 3WTTA 4G83A 3WTXA 4IBZA 1HJBC 5AOIA 4IBSA 2X0VA 4AGQA 5AB9A 4GUOA 5AOJA 3QYNA 4L18A 2FEJA 2P52A 2OCJA 1KZYA 1EAQA 1E50A 3US1A 1CMOA 5LAPA 2IOOA 4IBYA 4L0YA 4L0ZA 2BIOA 3KZ8A 5G4OA 4XR8C 5A7BA 4G82A 2ATAA 4AGLA 3Q06A 2XWCA 3KMDA 3WTWA 2IOMA 5AOLA
chains in the Genus database with same CATH superfamily
2CLRB 3ARGC 1X5HA 4ECNA 1DQLH 3RVTD 4C56D 4AH2A 4YHZH 2AJUL 1P7QD 1AO7B 4WFHD 1MPAL 5FAAA 3NJJA 4MDIA 1LXMA 1NIEA 3QGVA 4WNQB 5FDYA 4Q6IB 1JZ6A 4UAOC 4A7TA 2VLMD 3WKYA 2V8LA 2F53E 5GSRA 4YSCA 5KG9A 2JELL 2ZXBA 4B3EA 5J1AA 4PRHE 4NUJA 1RHHA 2EYTB 4GFXA 3ZHFA 3NCJL 4M8VA 4Z95H 1GGBH 5H4ZA 3WNPA 4HAKA 5F6HI 1WD8A 2AQRA 4OCNC 5ALCH 5I66A 4QD2E 5I0XA 2WHVA 4BH8A 2PNDA 1CGSH 2CIIB 4BQ9A 4D2NA 3MLSH 4IU2B 3CSYB 5FGBA 2AJSL 2FGWL 4PJXA 4YPGB 2BSTB 1IGTA 3L13A 3VGHA 5GGUA 1HHIA 4FERA 2CPCA 1WBYB 4LCIL 1MJ7L 1Q0XH 2NTFB 1KY6A 3KNBA 1OIOA 3FT1A 3DO4A 3SDDA 1FP5A 2AC0A 5G55A 3V4VL 2D4DA 1ZWIA 1PSKH 4QOKE 3MCKA 2FJHB 1VZIA 3DYPA 3EJRA 1ZLDA 3JV4B 3CHRA 4WEMB 3TEYA 5MEOB 1MIEH 4O2CA 5A6LA 1JMZA 5F97E 5FV1L 1RQ5A 3QJZA 4JREC 4FQJH 5A1AA 3I9PA 3ARDA 3TYGL 4DP4X 5DZLA 3SGJA 5CCJA 2JKTM 2OZ4L 4B97A 2R9HC 2XWBA 3GT6A 3UTTA 3VFMB 5EIVA 3A6CH 2P5WA 3Q2CA 5ADOL 3CFJB 2Y36L 3G9VA 3I6LD 1A6AA 1CZ8H 1NCUA 3F12A 1CLYH 2YPLB 5CBEB 4K4KA 4M8QB 4MQTB 3UYPB 3FT4A 3L4WA 2NY4D 4HU8A 4X9GA 3GMQB 1H5BB 1DVFD 3DVFA 2K7QA 2YSSB 3QNXA 1XR9B 2ZNXA 2X3AA 4JGMA 3CGTA 1WDAA 1QYGH 1UD4A 3TNMA 3VGFA 5KSVA 1NGPL 3OSVA 4ZUWA 4JG0H 5I8CA 1KIQB 4FOMA 4D9LL 4D8OA 5MEQA 2NY0D 4NKQB 4OF5A 2NNXA 1QVOA 4IGBD 5DS1A 2D0FA 2AS5M 4X4KA 4QJ4B 3EYSH 3MUGA 3LOWA 4CSTA 3MBED 4S0HA 1YUHB 3NFSH 5FW7A 5GS0H 2NY1C 1EFXD 4Y5XC 4KTDL 1A7OL 1KDJA 3RGVB 4P3DA 3MRDA 5AAWC 3IMVA 1RPQA 3BVTA 2DMCA 4XH2B 6FABL 2DBLL 4ZFGH 5EZOH 2VR5A 3B3BA 5DUPL 3BMVA 2BJML 5AW0B 3GZQA 3VG9C 3MHZA 4UV7L 1F4WL 2OK0L 2AI0L 4FX5A 4LSVL 3FO9A 2AERT 4HGWB 5ESQB 4JQIH 3JVFC 2BY3A 4PJAE 1KTJA 3C60B 1XAUA 1FFTB 3EGXB 3LRKA 3NZ8B 1CICB 3C2SA 4N5UA 3MA9H 3RTLA 1WAAE 4PRIB 2N59A 5JPNC 1U92A 1YYML 3X13A 5I1AA 5EWIH 2UXVA 1TZAA 3ILPA 1C8PA 2PWGA 1CXEA 4MJ6A 5FX3A 1NTDA 4OH2A 35C8H 3G04B 3H2QA 4XCCH 4RMBA 5KSAB 4XMZA 1CU4H 2MEJB 3QUXA 3WS6A 1HYSD 1XF3B 4YSOA 3MOAH 2WXKA 4AYBA 2JJUA 4BCZA 4G6KH 4YL9A 5EBWA 4N1EA 3NCBB 1QFUL 4AJVA 1AOZA 2EIBA 1CE6A 3PJSA 3WHE1 1CE1L 1JGVH 1F56A 1F4AA 3EYVB 4BFKA 4TTDD 4Z95L 1XIWD 1S7QA 4ZAKC 43CAA 4ALAL 4KKRA 3MACH 3LNDA 2IH1B 4EI6B 4J5VA 4MWFB 1T21B 4U1MA 5A6MA 1OP3H 3TO4C 3U4EA 5JZ7D 1P7HL 5K5YA 2ZUQB 4GI9A 2Q3AA 1TQSA 3OG4B 5T1KA 2HWZL 4I0PA 3FPXA 2AQQA 5BRQA 2LGNA 2VZ1A 1XIWA 1UTDA 1UD8A 2PPDA 3QULB 2IGLA 4ZI8A 5E8DL 3M8OH 3OAUH 2E76C 4W9DC 1JYVA 5BRZE 4KZEH 2IMMA 4ZAKA 3LIZA 1L9QA 3IDMA 5T1LA 4IRZH 2MNJB 5KZCD 1IKOP 4G83A 3KDMA 4KAQL 4R2GB 3S5ZA 3BH9A 2VM3A 2X89D 1E5YA 3MV8B 1N18A 1I3RA 3V8CA 4AE0A 4HEPG 2UZYA 3E7JA 3QDMA 4Z8FH 1NA8A 3TCLB 5FF6B 3LS5H 2N7BA 5DEZA 1MWOA 1NFAA 5EDSA 1MJJB 5BW7C 3EOBA 5KYUB 3LN9A 3LD8C 5DEFB 2RCSL 3HN3A 2G3NA 3ZKMD 5AW4B 5HGAB 4N0YL 5DRWA 3TBTA 3F7KA 4XP4H 4DKDC 3O3DB 2KDYA 4JRFA 4Y4FB 4A2DA 2VNCA 4RMQA 3KPQA 2H47C 5TK2A 4G5ZH 3JBG7 1C5BH 1MQ8A 5I74C 3WLWD 4OD3L 2EYRB 4JPIA 4TNWK 4XWGH 3VI4F 1W72A 1VB9A 3KWXA 1T4KB 2NZ1A 1U3YA 2EH8L 2CG9X 4LCCB 4IBWA 2H26B 1ACYH 3WO4B 1U8JB 5E6YA 4Q97A 1P6FA 5I8KL 5EWIL 1QSFB 3SD2A 9CGTA 5HD8C 4JL2A 1XGRA 3N43F 3DXAE 4R90H 2VDLL 1AD0B 4IGBA 4QRSA 2XACC 3N0PB 3RZCC 1ORSA 2LU5A 1FZOB 2OMUB 2PXYA 4GAJL 2M1KA 3C6LD 3P77B 1L7IL 2G5RA 2Z8WC 3Q1SH 5JW4N 3ILPB 2DQUL 5KVGH 4GXUN 3HG5A 4G6FD 4WV1C 2CJSA 2BWDA 1ODUA 2N3JA 4KVNH 1PMYA 1VJSA 3IDXH 4GG6B 2BRRL 2CALA 3CH8A 4KITB 4MJJA 3L9RB 2ESVB 3RZCA 5I19H 5BMFH 1VACB 4WHDA 3VQ1C 2ITCB 1R1CA 4PTUA 4KKNA 4GG6E 1SJXA 1UXSB 2GSGA 4XTRC 1DO5A 2RA1A 5I75B 1R3HA 2J12B 4PCTA 3A24A 3M17B 3GUTA 1KCRH 3JWOC 3RI5F 4G7YL 1X5KA 3QA3B 4JY5L 5D93C 4X8JA 3V95A 1N6QH 5B7FA 4H7VA 1Q0XL 5HTSA 5FLUA 1Z5HA 2DEYX 3LN5A 5DZNA 1QHPA 5HDBE 4N9OB 5DZ9A 2J1XA 5J6HA 2MPVA 3AROA 2J8HA 3WNOA 4YQXH 4PD4J 4LP8A 4NWUL 3QNXB 3LZFL 2QTEA 3QS2A 1MHCA 4S1SH 2MQ3A 5DK0B 3FQUA 3P0VL 4WI0B 1OTUC 1NBQA 3ZE1F 1WZ1H 2AQ2A 3HEIB 2Z34A 4PG2A 4YJZL 3RGBA 1RK0A 5JQ6H 1SQ2N 3IVKB 3ALWA 4MQ7A 2FZ3A 1RY7B 3NT0A 1PSKL 2TSBA 5FGCE 5D1QC 2IH1A 1DJSA 4A7QA 3SO5A 4M6NL 2VLKA 2ZCHH 2BO0A 3UTTB 5DJDA 5K9KA 2EEXA 4BJLA 2QBWA 2WVVB 4G9DB 3TP4A 5ID0B 4M62H 2VZUA 5FXCH 3TWYA 4P9HC 3UTOA 1AS7A 2NXZC 2ZYRA 3QUXB 4XR8C 1INDH 2QGDA 4A2FA 3UZVB 4AMKL 3M1CA 3OKMB 4G59C 2N1KA 3MFGB 4G1EA 2XWCA 4HUWA 4IKKA 2CKBA 1A22B 5SWSB 5T1MB 5IT2L 4X42A 4XNQA 4RMSA 1F45A 4IRJB 4EZKA 1ADQL 4Z77B 4M3JA 2CO2A 4UQIM 4Z78B 1XHHA 4HIHB 4NS0A 4KPHH 3H6AA 4X5XA 3QEGH 4UM8B 2MH4A 2B5IC 4HOXA 2BSTA 4DEUA 1A25A 3SDDD 5KOVC 2XV2A 2V7HA 3H9HB 4HWBA 1R46A 1QO3A 1ASPA 1U95B 2A1WL 3RUGF 4WCYH 2KYIA 2AV1A 4XNMA 3AWGA 4AM0A 1YQVH 4M7LT 1LE5B 5I16B 1F3JB 1HQRB 1K8DA 1MCPH 1FHGA 1XSIA 3IFLL 2FHCA 2Y1YA 3BJ91 1F86A 1MPAH 3BW9B 4XH2A 1MZYA 3MRPA 4DZ8B 3DUSA 1RL1A 3SQOH 3UTSD 2EYTA 1DUYB 2P5PA 3O3BB 1KCRL 1FVCB 5CEZD 4JUTA 1ZHKA 4XNXH 3LEYH 4PY7A 1AI1H 3PNWA 4NUGL 5DWUH 4OZIF 3FQWB 1A6UL 3D2TA 2PTUA 3ELQA 3RX9A 4GUCA 2H3NA 4OFDA 3V7AE 3GM0A 3T0XA 1H3PH 4PBXA 3V7MA 4K3DH 3O3AA 5EUOB 3QUYD 3S4SG 3E2HC 1SVZA 3NACH 5FUCC 4H8WC 4I18C 4AH2B 2CWRA 5JIPA 3GS0A 4OT1H 5FCSH 5HHQB 3BZ4A 3T4YB 2A9BA 4CSPA 4OI7A 2F9BT 2W0FB 3O6FC 3KL5A 5KVDL 4PGEB 3MRIA 3P4LA 1JPTH 5EF1A 3PWLB 3TJHD 1HAWA 4QXUH 4P07A 3ETSA 5JW4M 1S7XB 3TH4T 4WO4C 1CIDA 5DU7A 3HLAB 3SE8H 4I9XA 5IQ7L 4TUJA 1AIFB 4HC1L 2GI7A 1BQHG 3ARDB 2EIDA 2OMVA 4NENB 4CJ1A 5I5MA 3VFOB 1DJHA 2B4CH 2HKFL 5AW6B 4G71B 4ELMB 3U7YH 1H6EA 1CBVL 4Y9EA 1NUNB 1I4FB 1WVZA 2H6PA 4HA1A 3UJTH 2ZUSA 2H3XC 2X4NA 4MNQD 1KGCD 3D0LB 1X6NA 1A9EA 4XPGL 3WJMA 5LWYL 4PJAA 1IAOB 3IE4A 3FH5A 3I6KB 4FHJA 4Y7OC 3JYBA 1I1FB 3FCSA 1M9SA 2MJWA 2LQRA 1EZUA 1AP2B 2WLIA 4FRWA 3QUZD 1MN4A 1V8HA 4E9TA 4FQHA 5HYJB 4HZAA 5DMIL 3CCHB 5I18L 1GY2A 1USQA 4HIEB 4ZX5A 5HBBA 1FFOB 5LVEA 2EVGA 3V4PL 1ID5I 4QRUA 2F8IA 1B0GB 2QADC 3E1F1 5ES4B 3GF8A 3MJ7B 4BSVA 4Q9QL 1ED3A 1ITCA 5IWLA 1J5OL 2FQDA 3FU3A 4KKLC 3F5WB 3S35X 3FUIA 3PWNB 4JN1H 1NFDB 5KTEH 4WFGD 3Q6FA 5I1KH 1TFHA 1AXTH 3B2VH 2YXWA 3K5RA 5C7XH 3DX6B 3VI4A 4ADIA 4AKOA 4I3RH 2OX5B 1TO5A 5ICYB 3ERXA 3NESA 1E4JA 5C86A 4Q4IA 3NUKA 3O4LA 1DJGA 2Q87A 3MNDA 1XZWA 3T0BA 2X4SA 3RDTA 3TV3L 2VDLH 3JUZA 3SYOA 3GXNA 3QZBA 1MVUB 5I8EA 5IHBA 3U2JA 1JCKA 4ZMXA 1XR8A 3GPEA 3T2LA 3AB0C 1IEAA 3OKNB 4FLQA 3IDGA 4XN2A 2JI2A 3NTCH 5DURD 5LNEA 2ICCA 3OC5A 1XWVA 2VUYA 5AW1B 3D0AA 4JAMA 3IN2A 1V7ML 1YJDH 3UP1A 4P2OD 2JK5B 5MHSD 5AKSA 5IB5B 3ZUNC 1A0QL 3C5ZB 4U7SA 1HWHB 1QSVA 2CK2A 4C4KT 3VXSB 3M8OL 5CHNA 5SX5H 5I76B 4OF6A 3KHOA 4XMPL 2G9HA 1HDMA 4Z7UB 1P0SE 2XTSA 1A7PH 3PWPB 4O5LL 5AW3B 3TIEA 1J9SA 2AJYH 4K94L 2QKIB 1OAXL 2YPLE 3FSZA 4IJ3C 5FGBC 3BH8B 3NEOA 2ICWA 3LKOA 4OIIH 3BEVA 1JD7A 4I8DA 5LUMA 1QWUA 4AYID 1ZVNA 4JJ5A 4XMTA 1GIGL 1NWPA 2GB2A 4XRCA 3F3HA 2CK0L 2Q86A 1UEMA 2FBRA 2E9WA 2WIIA 3B8YA 3EH3B 4KNSA 1GH7A 2FQGA 4FHKA 4P4KC 3DXAB 4NZ8A 4F8OA 1NANI 2XTJD 2Y06H 2IPUG 3ULVD 4ZSOB 1FVDA 1YMMD 1Y6KR 5AB9A 5MENB 4KJPD 3WAJA 3EGDB 4F80A 4AW4A 1KF9B 4ZPVB 4JQVC 4X9FA 2NY3C 3L3GB 4DFHA 2IOOA 2ZCKL 4K23L 5I15L 1I3VA 3GI8H 2XYCA 4AVKA 1ZA6B 1I1YB 2EEBA 3HUJB 4FTVB 3C5XA 3L5JA 2UX7A 3CLFH 4XNMB 4LHJB 1Q4NX 3RVTC 4F9PC 1HZLA 4NZDA 5L2KA 3W0WA 2NCMA 4M93B 3VE0A 3RILA 3HC3L 4LVHC 1PL3A 2F74A 2OS7A 3UXFA 2LAAA 4HUMB 3ULSB 1QFOA 2VLKE 3BPCA 3IBOA 3SKNA 4M6NH 3MUY1 1IC5H 4JY5H 2HUHA 5GRZA 5IOKA 1JNHB 3K3QA 3ULUD 1FFPA 4LPWA 5IEKB 3PGFH 1BJ8A 3NRPA 4JAMB 2JQMA 5FCUL 1Q8MA 2W59A 3REVB 2ZOKA 5AWNL 3PAYA 1M6OA 2Y4SA 4WW2F 4RNRB 4OCSH 2ID5A 3D30A 3KPPA 5EEUA 5DJYA 2N7AA 3SDXA 2K4AA 4Y16A 4S1SL 1RZFH 4BZ1L 3S8GB 3B4NA 2Q8BL 4FQXA 4YXKH 4R4BB 3X3GH 3DGCR 2JKIS 4JQXA 3UMTA 2X9YA 4JKWA 4BUGA 1KUMA 1LK3H 3V6OC 4DVBB 1RV6X 4NJ9H 4A37A 4TV3A 5CBAA 4IKIA 1A3LH 1CK0H 5HY9B 2F54A 3O9WD 4P3CL 5I6XC 3LEXA 1KCKA 5DZJA 4TLUA 5AW8B 1C16A 1CBJA 3IGUA 2EYSB 2JH2A 3WHXA 4WUUE 1T04B 1KWGA 3QEQE 2DYPA 2EDXA 1CDGA 4XO3A 4HWZA 3B2DC 1JXKA 1DEDA 2MKLC 3FU7A 4E9SA 4F9LA 4EN3B 5IESL 1Q0YL 5EMYA 1F11B 5IMKB 5KSUA 3AT0A 4AGMA 1D9KB 4JPSA 3V9EA 4XXDB 2AVGA 5B8CA 1GKEA 2WVTA 6TAAA 3PGDA 4G6MH 1S7SA 3LXUX 4E9WA 1MFVA 2NSMA 3OWEA 1JWSA 3RA7H 1RULL 4CC4C 1KWKA 1N4XH 1OKEA 1I8IB 3PPSA 4ODUB 1BXAA 3CFMA 4FCHA 2LVCA 1BXXA 4PJGA 3TEUA 5MEPA 1KCSH 2FQEA 2Y2TA 2R4RL 2BSBA 4YHIA 3U4BH 2TSAA 3CSGA 5DI8A 4PJDB 3P40A 1DVSA 2EEAA 3CHQA 4JO3L 3QUZA 1FV1A 3RY6C 1I8KA 5D7JB 4POUB 4J39A 4HEME 3P4OB 1G5GA 1E6JL 1VEPA 1PW3A 4JE4B 3MRJA 3PGCB 5EEXA 3GMNB 3VD5A 3BKYH 3WGUB 3OMAB 4JHWH 1SMOA 3SE4A 2IGTA 4W9JC 1O6TA 1IJ9A 3BDYL 5BO1L 1JZ4A 2XT1B 4GRLA 3GJFK 4GI6A 4HXAH 4KROD 3I3BA 3RUGB 4FG6D 1XGQA 2NY1B 1GZQA 2XG5B 3ESNA 1KCLA 5GS0C 2YSTA 5J6GB 2IAMD 3L5WA 3RWDA 4IDLA 3IFPB 3VGBA 5JQHC 2XVKA 1UWEL 1GJIA 2J25A 1OCZB 1R75A 4N2LA 2XJKA 2XFXA 4Z76A 1IJNA 1LP9A 2AEQL 4D0DB 3OD3A 2Y2YA 5GIRB 2GPZA 3EJZD 4ANWA 1LQSR 1SZNA 3JWOH 1U8IA 4YUEL 2VE6B 1U8OA 2C9AA 4DP7X 4JG1H 4A68A 5E8PB 5AQ0A 4ZXBA 4XPHH 5C0BE 1AZUA 3MLRH 3O3BA 5A2FA 5D7EA 4ODVH 3IAGC 5A2KH 1BMZA 1BXUA 1N0LB 1EFQA 4EZJA 3D3VA 5E8NA 2DWXA 5H2BB 1LGVA 1ETA1 5EUKA 4JZNA 1G4MA 4KWUA 2AEPL 2UZYB 3VI4E 5FA3B 1UB6A 1I8KB 2PTTA 3EJPA 4FQ2H 5D7JA 4EZMA 5BO0D 2OYMA 5FO8B 5E6IC 2WOBA 4JGJA 4IDJH 4P4RA 3U0PA 1MFBH 1J1XL 1FG2B 2V33A 3F84A 3EJQA 2HB0A 1IGFL 5IV2B 1PX3A 2ZAGA 1SEBB 3UZEA 4AOFA 4AGPA 5F9WB 2NLJB 3DGGA 4UDTB 2J8UB 5M94B 3TFKD 4AZ8A 1BFTA 4BK5C 3MTRA 1QAWA 1J12A 1QW9A 4EI0A 3GK8L 4HWEH 3FO2B 5B8CB 3UTTD 1RFDL 4HKXB 1V54B 2EIEA 1PX4A 3K71A 4Y5VB 2IFGA 3H3PH 2W9EH 3HZKA 3MOQA 2R1XB 3ZK0A 1S7WB 3ZL4L 4OGYH 4O4YH 2DYPB 4U6YA 3TVMA 1ZANH 4FXGC 1KBVA 3F6IA 3MUJA 1T1YB 2Q2EB 5HHOB 4GXFA 2C5DC 4LQFL 4Z7VF 3LEXB 2YMTA 4MAYC 2DI7A 4FTDA 2J43A 3J8F7 2ICWJ 1SDDA 3VSTA 2R2HA 3FCGA 4M7KL 1OB1A 1QYGL 5D1QA 4GG6F 3SE8L 1NCOA 4CADB 4AQAB 3NJVA 2RGSA 2DL9A 3D51A 4CILA 4R4BA 2DDQL 2VC2L 1O9VA 2QELA 3U7YL 3IDYC 3NZ8A 3NZUA 5PCYA 3GHEH 4N85A 1OAYH 4GSRA 1RIUH 4FKEA 5D5MF 5EU4A 3WSQL 3AT9A 1KGWA 5CJXA 4CMMB 5EU6E 2UXFA 1FORH 3DYMA 1V7NL 3MCYA 3NQIA 2KLRA 1V3KA 4KXAA 1ODAA 3AQXA 3DJTA 3FBKA 4JM4H 4L1TA 4XAKE 3OVUB 1KENL 1SJEA 2VDKH 2P80A 3MBWB 2WQRA 4LLYB 4FULA 1SY6A 2DKMA 4N2OA 3F6JA 1MW3A 5EG6C 5T3XH 1ML0A 2YAOA 1F6AB 2YPKB 3ARRA 2W65B 2P45B 1BFVH 3IJEB 1UM6L 1DHKA 3I9IA 1MCDA 4N5EC 2ATPB 4NQCE 1CXLA 2RIKA 4G7VH 4LL9A 3PQYD 3UG3A 5I5JA 3W81A 4HJJH 4JFEA 2X6CA 3CX2A 2XIBA 2WGXA 1PY9A 1HOEA 2HKHL 3NH7H 5ESAA 1TLMA 2G5BB 4H1LA 4Q6YA 4PMFA 3D2UD 2J88L 1HYSC 5BW7A 1NMCC 1ZHBB 1I75A 4PJBA 2WKGA 3JWNH 3AG2B 2B4CC 4WV1A 4JRWA 1JYXA 1MIEL 3GXDA 3UL4A 3QG6A 1KFAL 2FECL 3GSOA 3R0MA 2WXGA 3MGOB 3TT1L 4OV6F 5T5NG 3MV7E 1BECA 4MD5A 1OGTB 4XVJH 3HRPA 3T2OA 2NY0C 1F6FB 3ZTJH 1WA0X 2BS71 4M5ZH 4NWTL 1FWXA 1OM3H 1L9OA 3CXHK 2WXFA 3X1BA 4I18A 3QJUB 2FX7H 3MX0B 5D93B 4MNGB 1W72B 1H0DA 4KHTL 3S48A 3KR3H 2A2QT 5JNYA 1I3GH 5KJRH 4DEPC 2FJGA 2O6FA 1A66A 1TETH 3G6JB 3RZWA 1CGSL 3MCKB 2ZP9A 1JZHA 5D1XB 3O3DA 4TSBH 4Y4FA 5IB2A 4WDIB 1SEQH 4KO7A 3S9DB 3EADA 3N44B 4WW2A 4POZC 3ZZSA 3P2BA 5CLWA 1N2RB 5KYUA 3PV6B 3Q1EA 4PJFE 2OI9B 3N6YA 3O41B 2NZ9C 1MVYA 3V4LA 1HX0A 3ZZ1A 4XGZB 1CS6A 3O2VL 1CL7I 4Q0XL 4APQB 2X0VA 1J48A 2A6JB 3TCXA 4PJFB 3QSKB 4D9RE 2ZSVA 5JIKA 4U1NA 4N0UE 5E6ID 4OBRA 3KCWA 3GLEA 1EGJL 1EX0A 1NMBL 5TF1H 4NKIL 5IJVB 4XC1H 3QULA 1AYRA 4YH6A 5E2UL 4YBLB 3H0TA 5GRXG 3T8XB 1FVEB 4Y89A 4MXQD 4C47A 2VMJA 4WJ5B 1AACA 5ESVA 3MO1A 1IE5A 3HMWL 4I13B 1KTKE 4M9OA 1A1OA 4PJHB 4WTWA 3DJZA 4NQSA 3GSXB 5EZOL 3V0AC 2VDLB 2F53B 3ZTNL 3FFDA 4R5TA 3UX9B 3BRDA 1JZEA 4F8LA 5I23A 5INDB 3HRZB 4TL5A 3X12B 3ECWA 5DVLA 3VM5A 3VCLA 1NC4B 2HG0A 4W9HC 1E28A 1U42A 3Q8EA 4KX8A 2JKRM 3PU7A 4XHJD 3DJ9A 2VWEE 4Y5XB 4GP4B 4NN7B 2BNQA 3MNZB 2CUIA 3E80A 3QAZC 1H8OA 2ZAIA 1UT1A 5HJGA 2WB7A 4NSKA 5AWNH 3NTCL 3PWPD 4EO5A 1UZ8A 3C9NA 4U6VH 1DYZA 1V10A 4N2AA 3QQXA 5BRZB 1QI4A 3L7FB 3CVHH 1GW0A 2WXPA 1WTLA 2J56A 3QWRA 4S2SA 4MA8L 4AWJC 4GAYA 3MRGA 1D5BB 1DTUA 1GS6X 3EYFA 5F88A 1DQVA 1CFQA 2OJZL 3I50L 4X5PA 4E41E 2E7LC 2HX7A 1ZTXL 4YZWA 4F5CE 2GJ6B 4ZPTA 1D6EA 1CPUA 3G08B 1LK3L 3H9SB 2ZP8A 5DJXA 4NN6C 2C1PA 3SKUD 2Y36H 2UUDK 3CZNA 1P5UA 3H9ZA 2WNXA 3CDGA 4FJ6A 1CD0A 2VN4A 5D6CB 5TFSH 3S36X 2H6UA 1MG3C 1YEKL 3AUWB 1YNKH 5E4AA 4BDVB 4LCWB 1O6VA 4YHPB 3B2XA 4JHVA 4FNLH 4PTTA 2JMRA 5LGHH 4A63A 4KK6D 3QEUB 4Q2ZA 1IBFA 5FHBL 1KJMB 3QO0A 3UPRA 3IJYA 2VDML 5HP5A 2BNQB 3MNZA 4GT7A 3VGEA 5I1EL 1M3IA 1CGWA 5DK2B 1MRDH 1RUAH 3ATFA 5C0DA 1BX2B 3TVMD 3GIVB 5EN2A 3ESVF 4G6AD 4P46C 2ZXQA 5IFHH 3IE9A 3X12A 1G7LA 1ACYL 3CN1A 1EJ6A 4BFIB 1Y0LA 2WBWB 5D2LB 5MEND 1W8EA 3LS4L 3DECA 4XVUC 3BUQA 3LX9A 5B4MD 5KVGE 4Y2DA 2X4QB 4FDWA 4OD3H 5DZVA 1G9NL 1DQTA 4M56A 3GO1L 1G6VK 4NZTH 4PRID 5DA4A 4B7LA 2ZKYA 1C5CL 4DVBA 2YPLA 2NYYD 3HFFA 3JTSA 5A6IA 3PQYE 1URZA 3GKZA 1BEYH 3MJ8A 3MNVB 1BYNA 3LKQA 2YXMA 3R1GL 2P3YA 1S78D 2AQPA 2WMPB 1K8IA 2OMXB 1ZS2A 4F15C 2D7QA 4RNRA 4LSTH 1HSBA 3EYOA 5BZWA 1RLBA 4KAQH 1EEZB 4NPYB 3T6QC 4H25B 2DI8A 3IJ9A 1CUOA 3VYPA 3IMUA 2NYZA 4L8CA 2FJHA 2A6JA 4FN0A 4PJ7B 3VB8A 1J05B 3MJ9H 1F0LA 2F18A 1U2CA 4JPQA 2UXGA 4UZGA 3W2DH 2Q5BA 1S3KH 1SOXA 3BCFA 5TDOA 1NDMB 3GXIA 2VRAA 3D6GA 4ZUTA 4PRBA 3HHSA 3QDGB 3A6BL 3BUDA 1S6NA 2QSTA 4C59B 4QXWA 2E56A 5EBMA 4PAZA 1X9QA 1KACB 1UOKA 1I53A 1F4HA 3FRUB 3H56A 1R3LB 3SQBA 3L3IA 5IB2B 2VIRA 1S9VA 3VGGA 1P7QB 4ZO9A 1B4LA 4NP4H 4LCYB 3CFTA 2R0LL 5FO7A 3Q5YA 2FBOJ 4KZCA 1NUGA 1H0DB 2AXFA 4JDZA 1N68A 4MHHI 2WLLB 3ZE2F 2YK1H 3V4UH 4ZYKB 1BG1A 1C08A 5DQ9B 3VYNA 5DMGD 1YEGH 4AKQA 1CLZL 2OMBA 3AB0B 4DT2A 5F7YC 2X6MA 4D3CH 3D2UA 3IN0A 4NXKA 4PJEF 2F68X 4WW2C 5IMMA 3SGDI 5FW8A 4NZFA 3PG2A 4C54A 4XC3H 4GXUM 3GJFA 1SXNA 3QQ4B 1S5HB 3B1TA 2O6EA 3VNZA 1BQSA 1QQDB 4LLVA 1J10A 1MF2L 1QFHA 2ZOOA 4U49A 4UOJA 2Q10A 2WIIB 4RIRA 4WV1B 2P5ED 2GK0B 1BFVL 3C5ZC 4ACTA 2AXGA 2L7JA 2IPKA 5DFTA 4RZKA 3OR7B 1G7LB 1IC4H 5B39G 4AE1A 4RFEA 1Z3GL 3VB9A 3HG4A 2YD8A 3WAKA 1RPUA 1LJMA 3HNSL 4JS7A 2GK2A 4I77L 2HJKB 3GSVA 1ZEAH 3LMJL 4LEBA 4MMZA 2IPTH 3MLPA 2HUEA 1IRAY 4F7KA 3IMBA 3IJEA 3FRPB 2O5XH 3INUL 4YHYB 4DPAX 4ZUVA 3SKOA 4J8RA 5F21B 2JWYA 4Z7OF 5SX4I 3O81A 5CHNB 1OOAA 4IHOB 2VXVL 2J1YA 2SODB 1ACXA 1RUKL 1AGEA 3VG0L 3DTXB 3NSCA 1M3JA 3KD4A 2VC2H 2DDQH 4JHAH 1UXSA 2EIJB 2E27H 2F2HA 4KKQA 4G42A 1H3WM 4GKOA 1UGNA 5E1IA 1G7MA 4PCYA 3C09B 4UDUB 2OV0A 2XXCB 4JKPL 1CQYA 3IU3B 1PZBA 4W4NA 1FZKB 3FUKA 5GRJL 3I6GA 4D0CB 1XGPA 1J5DA 1HYRC 3FB5B 3GWJA 4YEFA 4LAJH 4ALAC 4EBQH 4GKZA 4ISVB 4PWHA 1J9TA 1TEFA 2GFBA 3QARA 3CX5J 4UQ2B 4Z1PA 3X3FH 5C97A 5GRWA 1UCTA 2VDRH 4NSKB 4X7TA 3BZEA 2K45A 4CVXA 3GHEL 4KXBA 4Y5YA 4KMQA 1UACH 2UV3A 3GEFA 4M93C 3QUHA 4Y5XA 4PRAA 3LXCA 3CXDL 4PJ5B 3HS0B 4UQBA 5ANMA 2DKUA 5A2LH 3QPKA 2KDGA 3DX6A 4KRMB 3OR6A 4X7FC 2CXGA 1NC4A 3FN9A 4Z3IA 4XNYH 1PLAA 4TQEH 5I17A 5BZZA 3HB3C 2HTKD 3DX7A 3QPQD 5IHLB 1CDHA 3FTSA 4PJBF 3DSNA 2LU3A 4CUCA 4ZTPH 5SWZE 4ZUSB 3GSXA 1KIUA 2WKLA 3UEZA 3ZPDA 3ETBJ 1KIPA 2FYYB 1NMBH 3MO1B 2CRIA 4WJ5A 1L0PA 3A67L 3DHUA 2HFFA 5DJ8B 2I60L 3IXAB 5IJKC 2Y7SA 3K6DA 4FXKB 4ZNCD 2KLSA 1KCVH 1BFOA 1LLAA 3LY6A 3GTNA 1N3NA 3NACL 3GKWL 1KJ3L 2H5UA 4UOQA 1WJ3A 3M1BB 2A74A 3V0WH 2D7MA 4PJFA 5CJQL 2XOTA 3JVGC 5HDRA 4EN3C 2FWSA 3LKRB 3KPOA 5CN2A 5IZ7A 2VABB 1NEUA 1ZVSB 2GUYA 3HG1B 4BK5A 3FU5A 3GMRA 4P59H 2Y3NA 1OAXH 1AIFA 2N01B 5AYUH 4BSJA 3D1MC 3L3KA 3FCUB 4L3EA 5H35A 1NLDL 1BXVA 1TJGL 5DJ2B 2WOYA 1CFTA 3U4KA 3RHWF 4FS0A 1JK8A 2ERJC 3JZYA 4XC3L 4BHUI 4XVJL 4M4RA 4XZUA 3WTVA 2YGOA 2Z64C 2PN5A 4NO3B 1JWUB 4L8BA 1J8HB 4OGAD 5E8DH 5EIQA 5A3IC 1A7RH 4O2FA 4DP9X 2ICES 5HPMB 2C3WA 4F27A 2BVQA 3IRPX 5KYYB 1QLEH 4PJGE 3LNHA 2C7FA 3GSNB 5GS1C 1M53A 3ABLB 1DVTA 3MMEB 1TVDA 4PRDA 5DT1H 2GTZA 4PJ5A 2NUPB 2FSEB 3MLWL 3OX8B 4P5MB 3KCPB 2BNUA 4FFWC 3QUKB 4KY1L 5D4IA 1LO4H 3CTTA 1XL4A 4LCUB 3ZO0A 5C3LD 1A4JA 1JTPA 1SY6H 4EUPA 3CAFA 2XWTA 4ADJA 2WJ7A 5IVZA 4U1GB 5J12C 2EDHA 2E7MA 3EDFA 4FQLL 3ECBA 3WUWB 2VDKL 1UCBH 4HD5A 5I2IB 1E27A 1BD2A 1SLXA 3GFUA 1LYQA 1HU8A 2BOBB 3DX2A 3JQOB 5IQ9B 1SMDA 3ZE2B 4YHIB 5K33A 4J23A 4ENEC 3G5XB 4TRPH 4B0MM 1BMGA 4XOCA 3KWWB 5JR1L 5KJ4A 1A0QH 2YO3A 4IOSA 1B0RB 2DJ4A 4Y9CA 4ZX6A 1E4XH 2D3VA 4Y2OB 1ES0B 5HGHA 1EEUA 5DVKA 1SOSA 2OMNA 4LKCA 1OVZA 1RUPL 3BN9C 4HS3A 1QVOB 4R7DA 1AGBB 3B3IA 1MY5A 2Y5QA 5LN4A 5DJDB 2BFGA 1E5AA 3N2JA 3EDJA 5HHPA 3S3SA 2A9NL 2YQGA 1DCLA 3FB7B 1GGIL 1NPJA 3NRFA 5F9WC 4L8BB 4KZDL 2Y1AA 4JFPB 3WIHA 5F7NC 3RI5K 1UM4H 4WHTB 4HVBA 1N5AB 5B8CC 2JLPA 3RDTC 3GXPA 4N2GA 4PHXA 1NINA 5SX5K 2YPLD 3LZRA 5ITBL 4GMSL 4OCYH 1TQTA 1M1SA 4OVVA 4KI5C 5I1KL 2XWBB 3VFMA 1PZ5A 1TQBC 5HI4C 5IR1B 1RZGA 4MNGA 3STZA 3VD0A 4YDJB 3KYOB 3TEWA 1FYHB 5G5DB 3HZKB 3BO8B 3WKML 4LZKA 5DO8A 4Y5VC 3IF1B 3RP1A 3EH4B 1ES0A 3DBXA 1XAKA 4OGZA 4D8PB 3O45B 1P7QA 3CLFL 2YD9A 1AHWB 4NLHA 1FL5A 4FQJL 4IIZA 4B41A 3WKQA 3KWWA 2RACA 3FRUA 5FUOH 4D0BA 2V5SA 3C87A 4LPCA 4YAQB 1OGSA 2BC4A 5D7HA 1IGTB 3GRGA 4PJFF 2ESVE 3O6LH 4FXKA 3SCMD 3O6ML 3K72B 2QGEA 3AWFA 4NJAL 3GGWA 3P2DA 4MCYA 2EDQA 2CIIA 2R7EB 5CGYD 1G7JA 2PYEE 2WVSA 3QDJA 4YHKH 1J05A 4Z5RB 3GRBA 1KJ2L 1S9KC 5KVMC 1AQDA 4JY6A 4NFBA 5CD3A 1C5DA 1U3HB 5E2VH 4LVOC 4GW4A 3QIUB 1HEZA 3L3GA 1OQOA 1KV7A 3W3BA 4NUGH 4ZS6D 2OXGA 4EVNA 5HVGB 4ZRGA 5B4MC 5KAQG 1MW1A 5ANHA 2OTUA 4MX7A 5E8OB 1R3IH 3ZVVA 3FFCD 5K59F 4ZSOA 1H15A 3FZUC 4HWBL 3OLGA 5DC9B 3HZ3A 3S35H 3WLBB 3C6LC 1DUZA 2X4QA 3IM1A 4KI5E 2Y7QB 3I6LE 5GHWL 1VGKB 3U7AA 5F7BA 4XP1L 2EIKB 2GBVA 1P5VB 5J3HD 2H26A 2IV8A 3IFPA 3MYZA 2AAVA 4LHUD 1CGUA 1NMCB 4C56B 3U6RB 4LSSL 4H40A 3CV5A 3D08A 5B22A 2A9AA 4HX1A 1TZIA 1K9TA 3QEHA 1UT9A 2DJMA 2GSMB 2LT9A 1F6LL 2P8LA 1G6RL 1QWHA 4JHUA 4NZJA 3IFOA 4WI5A 4DGYL 4P4KA 4K73A 1AIZA 1CC3A 1WFJA 2GJJA 4Z7QB 1X5XA 1O9ZA 3S7GA 1MJJA 3SO3B 1PZAA 3MFFB 4XAKD 3T65A 3LPFA 1CF8L 1AZCA 3JWNC 3RIFK 5EZPA 1HINL 2KL6A 2K6WA 2OMZA 2FO8A 5KSBB 3RY4A 4GW5B 4D7PA 3NA9L 1EBPA 3NJHA 4JGNA 4RGMC 1XGUB 3G08A 1H6FA 1JXGA 3O3EA 3JZ7A 4YDIH 4JVWA 5IB3B 1HHJB 2P1YA 3MAWA 1D5MB 1BIIB 4UT9A 4J1UA 4KKCC 1Z9NA 5C0ND 2IPKB 5IBUB 3N1PC 4DGUA 4HUKB 4P9HH 3IT8D 1MWAH 2XI9A 3W39B 5KN5B 1G94A 1HCZA 3HHRB 4AENB 4CW1B 1LO2L 3MRQB 4W9EC 2HXAA 5I6XB 1QQDA 4LLVB 3P69A 3O4LB 1XEDA 4PJ8A 4EN3A 3ARFC 4BA0A 1DLFH 4APQC 4X7SL 2WW8A 3VD1A 2VO8A 1JPSH 1CD8A 3N44F 4XAWH 4KH9A 5D9SB 2NY5C 1EWHA 3QNYB 1EO5A 1CD9B 2IG2H 2ICEA 5GZND 4TPRL 2WD0A 3ARPA 1IZKA 4PD4K 3Q6GL 2X4UB 3EO0A 5JHLL 1G7IA 2DH3A 1KBWA 2JCCA 4UQ3A 2ENPA 3UACA 2IH3A 5KSAA 2G9KA 5E9NA 3EDDA 3ZIYA 2HJLB 3ZSTA 2IALA 1A6WH 2O1AA 4HQQL 4WHCA 2EXWD 2EINB 4OCLC 4JFFD 1D5XA 2Y3AA 1PY0A 5DO2D 3CX5K 5CWSA 3VXUB 1JZDC 4X99A 1WE5A 1V7NH 4TQEL 2BIOA 2VJXA 1QPPA 1UM4L 3GINA 5FYKD 5FYJH 4Z3FA 4HOMA 4PJAB 4OZGB 4EI5C 3KAAA 5JMRA 4V1DD 4B5EA 2ITFA 2XRAL 1Z9LA 5E6UB 1XGUA 5LO7A 4XPBL 3GM8A 4FYRA 4JM2B 4UQEA 3KPRB 3PQYA 5TE7L 5EIIA 5HHVH 4TKWA 2VLJA 4WNJA 3L08A 4EN3D 3PUCA 1VCAA 5I5IA 4U1HB 5I8OH 5CGTA 3H55A 4PJEE 2WQUA 2W0LA 2VDOB 2HFEA 3HZMB 5C0RH 3QUYA 3CZJA 2HT4C 3UTSB 4FHBD 2X4TB 3CN4A 1T1WB 3V52H 5DRNB 5I8CB 1R17A 2QV4A 1BQHA 4KQ4L 1I1YA 3ZZQA 5DRXB 5EU6B 3CXFA 2C8NA 1XR9A 1YPZB 3FQ2A 4UM9D 3QS3A 4LSUH 4ZMYA 5BUGA 3LQAC 3PREA 4K3GA 2G30A 2V17H 4MXWL 3DPBB 4W4OC 1BX2A 5D5MB 1OF0A 2ZOUA 4QEGA 4DERA 1FVDB 2XN0A 3EFFB 1OD9A 1EZVX 4NN6B 3B2PA 4N2BA 3OJVC 3CFKB 3ORJA 4ZXBD 5AFAA 3WG7B 5AB1A 4L4VA 1UH3A 1Z3RA 3FQWA 5DMJB 4MQSB 3MLRL 3VD9A 4P4KD 1JGLL 3M7OA 2Z8SA 2JCCE 1UA6L 2ZCKH 3NN8A 3QISA 2HFGH 3KLLA 2CM6A 4NX0A 2BSRB 4NFDA 4QUOA 4HIJB 4HPHA 3T77B 5DUBA 3NJXA 3ARBC 2ICWB 3WTUA 2MKWA 1NDGB 1JWMB 4UIKL 4EKXA 4JFTA 3X14A 5EOTB 2NPLX 3S34H 4YWGL 5BV7H 2R7EA 2IDUA 3OM3B 2ATPA 2E75C 5EO0B 5IHHA 1U8PA 3MPCA 1HEJC 4HHAB 1DBML 1YC7A 4XP6H 1BD2E 4HOWA 3U7WL 3NIFE 5L4FA 3L17A 4YSPA 2D7OA 3VWKB 5IP4A 1BF5A 3EFDL 2KPNA 4YUEH 5E6RB 1K85A 4W9GC 4Z78A 1IVLA 3NRQA 4CN4A 3DETC 4ZUTB 3GI9L 2HSIA 5F1IB 4PLJD 2HJLA 2HVJB 2DPKA 4WKZA 2E0PA 3MBXH 5AOIA 3FQ1A 2CKBB 5SWSA 2YXFA 4TL4A 3EOYG 3UTPD 4NRXA 5KWYC 1UOWA 1F3RB 3BPLB 1IFHL 4XO8A 3BO8A 3L1EA 2YIHA 4AIOA 3NAAL 3UGEA 1MCQA 2WAHA 5D1XE 4R3SA 3UZQB 2NY7H 3LN4A 5B1KA 1WA2X 5E7FA 5HVHB 1MJUH 1QFWH 1RI8A 1V3JA 4OCMC 3C08L 4OFIA 1OW0C 4ODVL 1S9WB 1FI8C 3DV4B 2J73A 2BS9A 4UM9B 4TTGA 4NHCL 4JBSA 4MDIB 2Z1KA 3IDIA 2WKOA 4PJ9C 4N3TA 1T7WA 4TUUA 2QVMA 4ZTOL 2V7NB 2WXNA 3RFZB 2H8PA 3A67H 4P23C 2V5RA 2WO3B 4LU5H 3TVMB 3CIQA 3F5WA 1KPVA 1ZOXA 3KHQA 3O3EB 4OF3A 3SGEH 2UYLB 3WOVA 4ABVA 1S7WA 1WH0A 2CE6A 3WJJA 3U30B 2VW6A 4XGZA 4AYFB 2IQ9H 1ZSHA 3AM8C 5LAXB 5KVEH 2ZCLL 2HKHH 5JYLA 4HKXA 1CFSA 3FQYA 2B0SH 4I5BB 3W39A 3WNNA 1MW0A 4J2QA 4DAGL 1RZPA 3TA3C 4BDVA 4JFQB 1V5JA 2UWEF 2OAAA 3FO1B 4BZ1H 4B9IA 4WW2B 4A7VA 3PDGA 4ZMNA 1FG2A 2DQHL 4P2RE 2ESVA 2E47A 3NIFB 1BD2B 1GOFA 3QIWB 4ES8A 4YHYC 3GBNL 1X5JA 3LB6C 3P9MA 2E5EA 1LE9A 1IT9L 4TOYL 5DFVD 3EJYC 3B37A 2KI6A 1F5WA 2B3IA 1VGKA 2C3VA 5HDLA 5CZVL 3R18A 3DK2A 1H6TA 2DIEA 4U2YA 4WO4D 4XCFH 1YEHL 3WLBA 2XZCH 4KJYA 2NXYC 1ORSB 4FEIA 5D96C 3ARYA 3I85A 2VXTL 3L1OH 2HRPL 1BG9A 3DUUB 1MFDL 4HX1B 4IBQA 4BIKA 4Z7NB 1E4HA 5FGCB 5AVYB 2E9BA 4XP5L 2NY7L 1KLFA 4AT6A 5ESAB 2VLRA 1TQCB 3QR0A 3KBFA 5B1AB 3HPLB 2WYTA 3TZVD 2Y7QA 4ETYA 1IQDA 4J3OG 3GRWL 3BKCH 4Q6KA 3U2IA 2TRYA 5JXAH 5ALBH 4YPJA 3PWPE 1LEIA 3ABZA 3GNMH 3I9GL 3KVQA 3MLXL 4TQHA 5A2CA 1FAIL 4APXB 2HTLD 3TPUB 2J6EH 1WBZB 1MG2C 3OJDA 3MLZH 1PAZA 2G2RB 1XGZA 4MYPA 2VRQA 5E0QA 2OXGB 5FDWB 2ED7A 2YGQA 4EVNB 5MI0C 1GYAA 1DBKL 3GYRA 4OZHB 4TULL 5IBTL 4WI3A 1JFQL 1EJ8A 3SBWA 3L3KB 4U0QB 1C5BL 3QWRD 5G4OA 1JZIA 2MRYA 32C2B 3WV0A 4NM4L 4XN5A 3UCQA 4ZJ9A 4Y16D 4X80L 5EU3A 3TCLA 4NKOA 3JWNG 4APQA 3OHMB 5CD5D 4A6YH 1G7JB 2QVFB 3QDJB 5JR1H 1KB3A 3T4AC 1J8KA 2ADYA 1SEQL 1P7KB 5F7KC 3WN5C 4BWWA 1IGFH 3HB3B 4PJDA 1NCBH 4HK3N 1JERA 1TQUA 1KB9J 3H9SE 4QY8B 3VYOA 4DPCX 1I8IA 5B1BB 1FGNH 1NCTA 3QZOA 1CURA 5D2NB 1R47A 2Z31C 1FBIL 2EIZA 3B2MA 3WEOA 1YSOA 3O2VH 4QHKJ 1AO7D 3DBXB 3VWJB 5BJTA 5I1DA 2DIBA 1L9PA 5DHEA 4DHLA 5KVEE 2YKKA 3QCUL 4U33A 4NBYB 5AW2B 1Z32X 1DQDL 1KTLA 5C6WH 2YUZA 1J0JA 4I89A 1I1AB 4MDRA 3QHZL 3PL6A 4N8VB 3WE6B 2NTSP 2VITB 5CSGA 2WLNA 2EDKA 4XX1E 3ESUF 3PL6B 1RZIB 3PRZA 3ROOB 2P5EB 4IBVA 5EBWB 4C56E 1TDQA 1NFIB 1G6RH 1WWCA 1JPGB 2FZ3B 3FF8A 2UUDH 1I7ZA 4AK1A 5GRUH 4K2UL 1G9MH 4PEEA 5F3BB 3MZTA 5FFGA 2CPUA 1BBJA 4QKXB 3RLSA 4U4IA 1JGDA 2G0LA 4YR6B 3D06A 2B1AL 2OQJA 2ZCHL 1FL3B 4OSUH 4QXTB 4BQBA 3WKNA 4NO0D 5EEZA 2RBLA 4MJ5A 3QYMA 3QJVB 4TNEA 3SDXB 3VNYA 2XVLA 4M7LL 2XJLA 5IJKA 4I0PD 2VDOH 3F7LA 3WENA 5LXGH 4GRMA 4HJ0D 4ZT1A 4OD1L 1P4BH 2DS4A 4L3CA 4N0UB 1QR1B 1X5FA 3L9EA 1P53A 3JXAA 1TIUA 3QEQD 3M86A 2OR8A 1MHPL 2XQYK 3A23A 4FL4C 3L5IA 2VL5A 3FW6A 4U1JA 4BWTA 4NZTL 5C0RL 4OGXL 4BWUA 4JPVH 4N2EA 3CFUA 2XA3A 2DQGL 3OKLB 4HD9A 4MJ2A 3P30L 4ELMF 2ZUXA 2VQ4A 3QYNA 4NFCA 3ZSSA 1EAQA 5TH2A 5AG8A 4MJ5B 1U33A 1S46A 2CRYA 2VSCA 2PWFA 3UJTL 4I1NB 2OLDA 2X41A 3D18B 4F37K 2OMTA 5ADPH 1J1PL 5C0JB 3V5HB 3SGKC 3BPNB 5K9OB 3ARDD 5JXAL 3CVHL 1IEBA 4ZTPL 4LCWD 4G8GE 4TS6A 3NP4A 2R0KH 2RTTA 2O72A 1VESA 4KJYB 5CBEA 3S3BB 4AL8H 1HE8A 4J8QA 5DHVA 3LKPB 1JOIA 5E56A 5HHVL 3TIDB 1CXKA 1JZGA 4X8CA 2CUMA 3F01A 3VFWA 3CE1A 4OW6A 1Y1DA 2VMDA 2NMSA 1N0XH 3N3EA 4O2FB 4QTHB 2XRAH 3GMNA 2PXYD 5I82A 1ZVSA 1HZHL 1FNSL 2XN9E 4KHXL 3DIFA 1RUAL 4HDIB 2DQCL 1T4KA 1HILA 3IU4H 2GC7C 3P11H 5AVTB 1I82A 5E2WH 4DKEH 4U1SA 3WXWL 3WJJC 4AXWA 3KM2A 4L5FL 3RPIA 2ZPKL 5MEPB 2NSXA 3T0VA 5DGRA 1H3VA 1MCBA 1MCKA 2FH6A 2GTWB 3U36B 1MEXH 4QOKA 3CH1A 4PV8B 4J3VA 1AHWA 3QORD 3DRTA 4JO1H 5D70H 4HCIA 5IHUH 3FUNA 5FF6A 3HHSB 1G9NC 3MQIA 3IXAA 4H0LC 5DJ8A 2DAVA 4ZTEA 4HJUA 2ZAHA 2AV7B 3QR2A 2UWEA 4NO0B 4NPKA 3V4PB 4QTHA 1PZ5B 3BH4A 3KPLB 4XNUL 1P1VA 5FW6A 1GS8A 4P2QE 1FNGB 5A40E 3L4TA 2DKSA 5KVEL 2I9LB 4JFUA 2X12A 1F4YL 5HHMD 3X11B 4QRRD 4E5XG 2PKDA 4I77H 1OCCB 5FGSA 4YEEA 1MAML 3D25A 4RFNB 4OUOA 4ZBJA 2E8YA 1X4XA 2CIKA 3O2WL 3QDAA 2W0PA 5D1ZD 25C8L 4QRRA 4LE8A 2K8QA 3FB7A 1X4ZA 1LP9B 1KIUB 2AK4B 43CAB 4ZW5A 1AXSA 2WVUA 4HLZH 4ISVA 4UQ2A 1GTFA 1VFUA 2BMKB 2CJTA 4AQZA 1X5IA 2X1QA 4I2XB 3V5DB 4LKCB 1CL7H 3MV9E 2R51A 2AJ3A 5J11B 1L6ZA 2P47B 1NCWL 1G7MB 1CLZH 1T83A 1T66C 4GYBA 3V0HA 2OBGA 4JFHD 3BKCL 2IANE 3U9UB 1KEGH 2H4EA 3BHBB 4X7TB 2HVKB 4H44C 5JXEA 1RERA 4U6HA 3OZ9L 2N4IA 2Q7YB 2AJXH 1EGJH 1MCOL 5TF1L 3UPAA 3RBGA 3QEQA 4U3HA 3VFTB 1QR1A 4N3UA 1OM9A 3MRFA 4N2MA 2XBTA 2CR0A 1JE6A 5FA4B 3CFCH 1E5ZA 1RULH 4MMZB 3Q9QA 3X14B 2DMGA 2C9VA 2J44A 3APFA 4JUSA 3T0DA 2I25N 4LNRB 4G42B 1Q90A 4QXTA 2HX9A 4ODSL 4LFHD 1S9YB 2F19L 2Y6TE 4UB0H 1R5VA 3PXJA 4F57H 5D2LF 3GHPA 4G70B 3NN8B 2N56A 3SO3C 1VENA 2FUQA 1QSFD 3KH4A 1CFSB 4I5BA 4KI1A 4XXDA 3VXRE 3CQQA 3FRPA 1AR1D 4IIQC 2GSIB 4KDWA 3FU7B 4HS8H 4PVMA 3AC0A 3KJ4C 3QUYC 2C3HA 2ZJSL 3MRIB 4RGMB 2KZBA 1XSKA 5JIMA 3V0VA 3P0YL 1HK6A 3KW8A 3G6AA 4XB3A 5KYWA 1F58L 4WK2B 3V10A 4XOBA 1YPZA 1IFRA 1PX8A 4JFSA 4FFVD 1G9NH 3WIFA 1FSKC 2ZQKA 1T89A 3CSBA 5IJDC 3NGBC 1A4CA 1ACCA 2OJEB 1GZHA 2VW7A 4N6RB 1LP9E 4UM9A 3SYAA 1QFWM 1JIBA 4W81A 5C3TA 3WEAA 5C0NC 1JGUL 2CDGA 2CLVA 2A4EA 5DJCB 4Z7UA 3L4CA 1DSYA 3S6CA 4QRFA 3T9WA 5IQNA 5IROA 4I2XE 5AOKA 4Z3GA 2BNQD 2OYPA 1YO4A 2CA4A 5IB5A 4EN2A 1I7UB 3SDXF 3EO1B 3PP3H 1Z5LB 4JRYE 2AXFB 3AQZA 2BVOA 2WUCH 5F93C 5D7LD 2XZCL 4HUVA 4FQLH 4LVNB 4KXDA 2CDEA 3IDGB 1IBYA 1WWWX 3RWFB 2RJMA 2DBJA 4FMKA 3TFBA 3WTTA 4G8EB 4OZHA 1XXFC 2VXQH 3BZDA 2P42B 4AGNA 3VXQA 3MRCA 4PRBB 2ERJB 2UVFA 4P2QB 3EZJB 3HPJB 3GIZH 5L2KB 2NR6A 4PJ8C 3Q0HA 1SXSA 2W9DH 3MRNA 4MTMA 1NDTA 1JZ7A 2WUBL 1FNHA 2JCCB 4IRSC 4JKNA 3GQFA 5DMKA 3QNFA 1EVTC 4ANUA 5DUBB 2OL3L 1HSBB 1BZQK 2ZWZA 3AXHA 1QOKA 1KLFB 4AT6B 3Q6FB 3P4NA 5EV7A 4CVZA 2XKUA 1MAJA 3PHQB 2E59A 4Y1AD 4NUJB 3W5MA 3AGVA 5A7BA 4G6JL 2H32H 1ED3B 3ZL4H 2FD6H 2FEEL 5HDWA 5I26A 3NZHH 4MNHB 4LLWA 4U05A 4MD5B 4P2RD 4L8SC 5JHAA 1I85A 2JJVA 1NUFA 4L4VB 4HUUA 3WUWG 5AOLA 3WXVL 1YHPA 2OTPA 5IB4B 4LHUA 3CCHA 3W57A 3OKKB 1PAMA 2R1YB 3DK0A 3LTVA 3P0YH 3MREA 4L2LA 4ERSH 3VG9B 1MH5B 4KUZH 4JJ5B 1NIBA 1G1YA 1KTDB 3WFDH 1BF8A 1MCOH 5JO5A 2J4WL 4N6QA 1T7XA 3LKOB 1SN5A 4KVPA 4M7LH 4N0FA 4UT6L 4DZBB 5T3ZD 4BBWA 3EG9B 4GW5A 3BFOA 3NJGA 3FPYA 5GJTL 1SBSH 2PR9A 5F88B 1LO4L 1LILA 4DGWC 3GSWB 5ISZB 1M7IB 2ZONA 4N2CA 2YAFA 4GP5B 3V4UL 3VXSA 1I7TA 3VD2A 3D09A 4LCWA 3NA9H 4OQTH 5DT1L 4IOFD 1M7IA 4J8RB 3N85L 4HG4K 3K2KA 3CDGB 4OF7A 5EORL 2WWMC 1WS7A 4HBCH 3PPEA 1WFTA 4NOFA 3PWLA 1IGIH 2B1HH 2EUZA 1R3JB 1G43A 5EDXA 5JTWA 4N1HB 3TH2T 3QQ9C 4UU9B 4DGVH 4PI0A 4OZGA 4B9YA 3RX5A 3RFZA 1Q9WB 1H3TA 4CSZA 1GGCL 3IFNH 3QUMB 4JG9A 4LAQL 2DIAA 12E8H 2GITB 1UZ8B 1FN4A 35C8L 1D5XB 2OXHB 4ZSOE 1WZKA 1PVHA 1X3DA 3SY6A 3V8OA 1CU4L 3NSFA 4Z3HA 5I1GH 1G0XA 3CXDH 5IB4A 4OTXH 4PGDB 2PXYB 1TZ8A 4OY9A 4XCNB 3PNWB 5E8OA 3LEVL 1UYWH 1P4LA 5IHZA 1CFNB 1QTSA 1UB5B 3DOIA 2YRLA 4X6DF 2IBGA 4WK0B 2OW6A 4JFEE 2D31B 2JKSA 3DUSB 4ALAH 1YEFL 1UVQA 3DNKA 1WITA 3GMMA 4PG9B 1KFAH 3DX9B 3BMWA 4KRPD 2F53A 1SFHA 3RX8A 2YEVB 4G6KL 2JTYA 4GRWF 3E9UA 1OGAA 5I16A 4E36A 3S97C 5F1OB 4BRVA 3G7TA 2XA8L 4Y4HC 4E0RA 2NW2B 2D3NA 5GGTA 3AAZB 4MZ3A 4ZMTA 4PCSA 3GGWB 3ZKXB 1WK0A 1XEUA 4N8UA 5BMFL 5I6LA 3SB3A 1RXLA 2R39A 1QLFA 5MERA 3GSNH 4LPYA 4TF4A 2O5YL 2MSPA 3N55A 5HVHC 4X6DE 3ZDZE 4KOCA 2ZTBA 5SV3A 4OCWL 1FIGL 2OJZH 1DQQA 2N1TE 4GO8A 2XNAA 3BWSA 3KPRD 3HN5A 2VDRL 4PVBA 1U3JA 5C09B 3GIZL 5FYKU 3U6XS 4OFYA 4C55A 4AXWB 2FJFB 5I6PA 4PBWD 4GG8A 2EE9A 4F33A 3BX7C 1PZDA 4M61A 3OF6D 3BISA 3NFNB 2R0ZL 4OZFA 1I7UA 1K8IB 2IWEA 2OZNA 2CMRL 4URKA 3BWUF 3NIGF 3OQ3B 1MNNA 4G3YL 1EERB 4MJIB 4YXLH 1INEH 4PB9L 4NWUH 3MJ8B 1G0DA 1VCBC 3HVDA 3IETA 5DJCA 5BNXD 3ZTDC 3ZRSA 4BELD 2V8MA 4H2AA 4FQQA 3ARXA 4Z7NF 1TPXC 2OJEA 3NP3A 4ZMPA 1N8OE 2R56L 5EUOE 5BUPA 1NC2D 4UILL 4G9FA 4TVPL 2AJSH 2E7LA 3DPBA 1IVTA 1DLFL 3F05A 1HNYA 1WWAX 4HK3J 1E7VA 4EI6A 1NCJA 2Z4QB 2WSKA 5IQOA 1BQ5A 2APVA 2B15A 3FRPG 2V2WB 5DHVH 3IMRA 4LQFH 1JPFB 1AMXA 3LQZA 2GSIA 4K5LA 4ZFZB 1NCWH 5L7XH 3UPRB 5E5RB 2WBJC 4XOAA 4FQIL 2A9ML 1N19A 2HFEB 4PRNA 3VFRA 2WBKA 2WNWA 4ZFOA 2QSCH 3HTLX 4PREB 4OGYL 3RKDC 3RUGA 2B7DT 5ETUB 4CKQA 5F6IB 4DH2A 1XCQB 5CR8A 2R1WA 1DJZA 3VSUA 3D85D 4MB5A 1E9QB 2DV6A 3BXNA 4FF9A 5D96B 4EMZA 4OFKA 3NZSA 2YPVA 4KROB 1NSNH 1ADQH 4UIMB 5ICUA 3BAWA 3CDFA 2GEEA 1PEZA 3O8XC 1FJ1B 1A9BB 2Z1PA 3A3YB 2FX8H 2J4WH 3DX3A 3HE7A 3MTXA 4X2UA 2IMNA 4GLRH 5CWSB 5IEHB 5A16B 3VWJD 4P5TD 1INDL 4X7CC 5L6YL 3HKFA 3PJLA 4EI5D 3K0YA 2AEPH 5EZIH 2CR3A 1FO0L 1B4JH 4PJIE 4ZFOB 4JRYA 4GINA 1TOXA 5LLIC 2EDOA 4ONFH 1YPZF 1C5CH 1KB5A 4YC2B 1COBA 4ODTL 3H53A 4HCGA 3D8MA 4JDTL 7TAAA 3C08H 1NFDE 2YK1L 3CN0A 4OGAC 3WN5B 5G5DA 2FGZA 3IRZA 1XGRB 1OSPH 3ILEA 3DX0A 5D72L 3S96B 3GMLA 3EOTL 3PWVB 4WWOA 4DGYH 1P2CA 1S2EA 4F7EB 3OKDA 3UG5A 4CADA 5ABZA 1U93B 4R2GD 2W91A 1AR2A 3VWJC 3CPLB 4M8QA 1FNSH 4KHXH 1IBGH 4UDTA 3TBTB 4APQD 2WB1A 2FATH 2FB4H 2SEBA 4UANA 3X11A 3IETB 4MXWH 4FQXB 4PGZA 3P02A 4XVTH 5E94B 5IB3A 1JNLL 1P84K 4FFZH 5C0FA 3KPLA 5IGXL 2ZSVB 4MCZA 4OZGF 1OTUD 2XETA 2VXUL 4KC3B 5HHXL 3UDWC 4B50A 3WEXB 4RX4A 2X2IA 4MVBC 4MS8D 1DL7L 1HT6A 3KPOB 3WFEL 2LOEA 4IJTA 2BM3A 1O5PA 2Y9RT 5DD1L 3I50H 3BP7A 2HFGL 4PW9A 4R96B 1NIDA 2VR6A 1JCVA 3CMGA 4GKSB 5EF0A 1PLGH 4MAUH 2NLJA 3DGGB 1NAML 3X1FA 1BD2D 1OAYL 1BLNB 3LDBB 5J57B 1B0IA 2HTLC 4KVNL 2XXGA 3HI1A 1XBDA 4Y9BA 1QWNA 4ZOAA 3ZKQD 4OCRH 5GGRB 1G9MC 4A6YA 4F2FA 5FA3A 3CZSA 4EUPG 1PZSA 2FYYA 4I18B 4QOKD 1DVXA 2OL3H 3NSDA 4M7KH 1SM3H 4LSUL 3IJ8A 5LCVL 2G2NA 1CTMA 3EYVA 4ODBD 1OLLA 1U3ZA 2VLRB 3JSSA 5AVXB 5L0QC 5KBDA 4K7PX 1UVQB 1BZDA 1VGEH 4HJIA 5HVFB 3HMXA 3T08A 4Y8AA 1T2QH 2ALAA 5C6TH 2IGFL 3MGOA 4AGOA 3DI3B 2GCYB 2J6EA 3BEWA 2NUPA 3QG7L 2GTZB 1Z1WA 3G04A 2PCFA 4HK0A 4KOBA 4Y5YB 4UAHA 1HXYA 1BF2A 3QFGA 3UJJH 4YDLB 1REIA 3QIBD 3QQ9D 4HCRH 3F58H 3QXDA 5CINH 3FZUD 3WEMA 1QLEB 1IKNC 3T3MB 3RGVD 3QUMA 2XV3A 3VG0H 3T0AA 2NCEA 3MRJB 3H42L 3R8QA 3K2MC 3APMA 1RJYB 4M4RB 2EYRA 4JPIB 4F24A 1ID2A 3HFMH 2GIYA 1F6AA 1CFMA 1LO2H 4IOIB 3TIEB 4QRQA 1XL6A 4F20A 4GT0A 1S5IL 1B9ZA 1YMMB 2IEPA 1PCXA 1W0YT 1V55B 3HW7A 5I8KH 4NT6A 4OU3A 1WPCA 4IYKA 3B43A 4RWYL 3DV6A 2VXUH 5DUMH 1BQLH 1XO8A 5TTRA 1GGUA 1MDAA 3AACA 3DIVA 4JFZH 4ONGL 3JTBA 3Q6GH 3ML9A 2HN7B 4Z7QE 1AS8A 1F42A 3D87B 2CRZA 1EJOH 3POCA 4G8GA 1FNEB 5EU4B 3FAWA 1S78C 4XB7A 2WLHA 5FM8A 4AL8C 3P54A 1WSST 3LIZL 4IK7A 4PJGF 4KKBD 4R0LA 3V6FA 3BUTA 3CBRA 5I24A 2APBA 2KMWA 3MJ6A 4F3FB 2HMIC 4LAQH 3LPPA 1MFAL 2DEXX 3QQDB 4YSUA 1MH5A 2ATKA 2H9GB 3BVWA 3CFEB 5CJOH 2DLIA 5JPNB 1MVUA 4GKNB 1XMWA 2IH9A 1EVUA 1GC1C 1T0MA 1JFHA 4OIIL 3ELAT 4HEPA 5J9PB 3HN8A 4F1SA 5IK3B 4ODXB 3NEEA 2P5EA 4MA1B 2PO6D 5JOPD 4MNHA 1TUPA 4PUBL 1UM5L 4R4ND 4IRSD 4S1QL 5B1JC 4HUXA 3H8NA 1AGBA 2WLZA 1KYOJ 3A22A 1PFOA 5DQ9A 2BSDA 1AGDA 5JZ7C 5I17B 5B38A 4XPFH 1GJUA 1F3DH 2BFVL 2JLLA 3U0TB 4UBDC 4Z7WE 1ZVYA 4O2CB 1IL1A 4BFNA 1XIWC 5DC2A 1Z66A 2ZG1A 4YK4C 2DEWX 2IDFA 3PFUA 5DTFA 3FC8A 4MKMA 3F7VB 3IGKA 2ZUQC 3KL0A 5FUCE 1QW8A 3EH1A 3SSGA 1I9IH 1YNLL 2C9PA 2WTRB 3UG4A 3BPCB 5A16A 4JGUA 4D9QD 1IAOA 4HJGA 3PFQA 1I3UA 2YLHA 3HJ0A 1EV2E 1IQWH 2VXTH 4N22A 4NEHB 4WY7H 3SJVD 1TG8A 2VMCA 2B2XL 1KJ3H 3ZR6A 1TTUA 4TXVB 5C0IB 4BHUA 4FQ1L 1P9MA 5EO9B 4F7TB 2CBOA 2OSYA 2VWEC 1BVLA 1EPFA 1D9KD 4OLZL 2X40A 1TMCB 2JI3A 2YHGA 1A4JB 1WHPA 4G3YH 4GRLC 1XCQA 3WN6A 1RVFL 4P99A 4RWYH 3FTWA 4YDNA 4YSQA 3KCPA 3NJFA 2VR8A 3E1ZA 2HCZX 5E8PA 1ZE3H 1NCNA 2J5LC 4LEXH 4P9ML 4FFVC 3O4OB 3N91A 1J8SA 2YR3A 3B7SA 4YE4L 1SJVA 1JPFA 3LQZB 4GQ9H 3MU3A 4ZFZA 3FUEA 1SF3A 1ZLSH 5E9DB 3MRMA 1QBLL 3CIAA 1PEWA 3F62A 2O5YH 1TF4A 1JP5A 4WNSA 2P5EE 5DRXA 3OB0K 3V0VB 5MENA 4RIRB 3APDA 4Q52A 1WUZA 3IJYB 3GSRB 3MV7B 4F9LC 4JPWH 5T8IA 3EO9H 4GEJA 5IFHL 3CFDA 3QEUA 2C3VB 3UAEA 3ROLA 1H19A 1WFIA 2KS0A 3K80A 4AVHA 4F2EA 1DUYA 3V6ZA 4GOSA 1KYUA 5GS2H 5LN8A 2LFGA 1H6UA 1SVCP 3A4FA 1MJ7H 3MSPA 4P5KB 4AM0Q 3BAEL 3QUZB 2XZAL 4B7IA 2LV4A 4ODHL 4BQ8A 5BV7B 1DP0A 4O9HH 4UZSA 3D50A 4LSPL 2W38A 4S1DC 2VDNB 5HHXH 3GK8H 2O5XL 4B27A 4D3CL 2NY5H 2QSQA 1YLBB 2G9HB 1ZPLA 2NY2D 3OMZA 1AGFA 2Z31B 4X99B 4RH4A 2WM0A 2Q7YA 5CLTA 5LG1A 1XVSA 5I75C 4LOEA 4KZDH 4N0CC 1E40A 2X2UA 3NVQA 4JHZA 4TRPL 5JIHA 1Z5YD 1VZHA 2PTVA 4KUCF 1I1AC 2NOYA 4H0IA 1NKOA 1QHOA 1G7IB 2X9ZA 4EQ3A 1IL1B 2R29L 3EYOB 1QSEB 1NBYB 2H1PH 2E3VA 2BP5M 3PL6C 3WFEH 1N67A 5GZNC 1A47A 3EOTH 3QDJD 5INDA 3CN3A 4NB7A 4NQQA 4RGND 1WP6A 4L4TA 3SCMA 3KWUA 2K70A 1RUPH 4CBZA 3HS0A 4PJHA 1A7QL 5J89A 3GB7A 3CUPA 3JTSB 5D7IA 5E51A 4KGLA 3QPQC 4F5CA 4UIKH 4WUUB 5FYKH 3CBKB 4FQCL 4N8CH 3EH5B 5TE6H 5KEZA 3MRQA 4IOSD 4W70A 3DV4A 1ASOA 1T0MB 2RR3A 2MCPL 3EJCA 4OGQC 3S5LG 1RP8A 3SPCA 4XPHL 1KB9K 3BSZH 2CGRL 2NY4C 5CILH 2AEQH 3IAQA 2HWZH 5CU9A 5IJVA 1MHCB 1HOCB 2PETA 2WNKA 3JWOL 5D72H 4X83A 4TNFA 2OMWB 5DEGA 4QRUB 3RVVD 4FLRA 2F5BH 5LNGA 2DMBA 1TO4A 3MLYL 4POZD 1S7VA 4Y4KA 5DRZA 2D8KA 1A3QA 3K2UH 3QB7C 3QT2A 4FL4B 3MFFA 1G5AA 1NAMB 1UZ6F 2EEFA 2OMVB 2QJDA 3T65B 3CU1A 4Y7MA 2VAAB 4O02A 4JFED 1K5NA 2Q20A 1G9ML 3S37H 3I75B 4KY1H 1IC7H 5AVZB 4R7LA 3ENEA 3IWUA 1IZJA 1P5UB 3LPWA 1DVQA 4JRXD 3SDCD 3GBLA 5F1NA 2GVYA 2XWDA 3HLKA 1DQML 3RJOA 1BCIA 4QI3A 3DMMC 1IAIM 2GJ6A 2XG4B 1AZNA 3TV3H 4G8FA 1IAKA 4LRIA 1H8NA 4HDIA 1TNMA 1FF5A 1VFAA 1V3LA 1XDTT 3V5KA 3ZLQC 1EAOA 1YA5A 4NUQA 1YECL 2X0WA 3B9AA 4UTBH 5I9QB 5E4IA 4QPEA 4LFHG 3C8DA 3GXMA 1IAIH 4C83A 2VLJD 3CVHB 4LSSH 4HJEA 4JDVA 4NQCD 5C0CB 3ZE2E 1HE7A 4KKPA 3GSRA 1KXQE 2DICA 3CFKA 3TGXA 4P05A 3L7EB 2JCCF 3L6FA 4W6YB 4J4PC 2HX8A 2OTUB 4RGOL 2EDJA 2Q86B 1WD9A 4PJHE 2MPAL 3PAUA 1JHKL 7FABH 5I1IL 5KS9A 1WA1X 4P59L 4DZ8A 2WLLA 2CHWA 2OMTB 3MV11 4F91B 4ZDHA 4ZODA 5BVJA 3QWOB 1U8JA 1YEEL 3VXSD 4HPYL 2CXKA 5CR1A 2H3NB 2V2XB 3H9HA 3HNTL 3OKLA 1BWWA 3BLBA 1QRKA 5DD3L 5EU5A 3VQLA 1HNGA 1TT6A 4UM8A 4XN9A 1ROWA 3LCYA 4G8EA 1FGVL 1N0XL 1EJFA 4HJ0C 5J0BA 1ZD6A 4LKXA 2G75B 1KG0A 3FOMA 3UBXB 3ETTA 1A4KA 1CDJA 4GKSA 3B9DA 2ZNWA 4ZW3A 2PXYC 1XT5A 4FNTA 2X42A 5CJ8A 1QATA 2W60A 3ZRFC 3F7YA 3DVGA 4KY2A 3IF1A 4KMTH 4TSCL 2YD0A 1RCYA 2YD6A 4JG5A 4WO0A 5HI4D 1IGCL 1T2QL 3K6FA 2DBLH 4ZFGL 3BWUC 2O5NA 3PV6A 5JIDA 4PJ9A 4XMKL 4ZAKB 3F85A 4HIHA 4U3SB 5D1ZI 4KV5E 4MQXC 4DW2H 1II4E 3SDAD 2A77H 3RQ3A 3BWZA 3INOA 2YOAA 4Q8BA 4AGQA 2O6DA 2WQAA 3N0AA 1CYWA 1SYSA 3ARZA 3ZU8A 1VPOL 4DCQB 3OB8A 3LH8A 2FH8A 1A5FH 5FYLD 3U1PA 2WP3T 4BQ6A 4HS8L 3TBCA 2EDYA 2EKSA 3L9BA 1PPIA 2IAMC 3ILQD 3AITA 4LARL 4LPVA 3GSQA 2V3FA 2WXHA 2VGLM 4TNGA 4BV1A 5D9SA 1TTCA 3WE6A 3THMH 1MFNA 3GLAA 4FG0A 1DE4A 2CCWA 2VQ1A 2CA3A 1OT4A 4GKLA 4QJ3B 4R90L 5K9QI 1R34A 1ICTA 3F7RA 1GC1L 4B9PA 1ZJAA 3GUTB 1KGYE 2IWFA 3WY2A 2BDNL 3CFEA 5ILTL 1KCBA 4H2CA 4UOW1 4W9IC 1RZQA 4HOZA 2VXSH 5DK0A 5K39B 5D6CA 2WLKA 2X05A 3D0LA 4HSCX 2IOIA 4QY8A 5CD5C 1J0ZA 4RRPM 5J6HB 2H6PB 2NY6B 3N1QC 4WZ9A 5BV7L 1L6XA 1MNUL 1U0QA 4KPHL 2G60L 4G8GB 4NC2B 3ARBA 1W0VA 3B6SB 2ENQA 4X8JB 2F1EA 5AZ2H 4OZHE 3DTUB 5I0WA 4NENA 1E65A 1E9QA 2G2PA 3BXNB 3H2WA 4HBCL 5K69A 2F7IA 3RWIA 1CICD 3MROA 5BRZA 3HLAA 2K6ZA 5JHDE 5GGSA 4HGKC 2PW1A 5HI5D 3HZVB 5L4IA 1K6QH 1BJMA 2EDBA 2Y6SC 3CFQA 5L8JB 1IAIL 4WRLA 3TBSA 3VFRB 3WD5L 1GGCH 3RZCB 2NY0B 4IU3A 3QDME 4G8IB 1U8MB 1KBPA 3ASOB 2AK1H 1BM3L 2Q2LA 4O02H 2M8XA 4GG6A 4UOZA 3RTQD 5KJ7E 3HPLA 4LEOA 2YBGA 5GQBA 3SE4C 1A6VL 3VX1A 1M05B 3MV9B 1U8QA 2AABH 2DLFL 5ABAA 4OZIA 1J8HA 1OF2B 3P73A 3MA7B 3SDAC 1HXYB 4KROC 1U41A 2TRHA 1O9WA 3RL1A 3STBA 2QPDB 1YYLH 1ILUA 3B9EA 1WC7A 1BJ1J 3IAPA 4YO0B 3T8XA 1JK8B 4YNYA 3H42H 3L95A 1ONQB 1DBMH 1EHNA 1LEKB 1L5GB 3U48A 3L4UA 3TL5A 3Q5TA 1GR7A 1IGML 4GQRA 4YFEA 2OL3A 2ETWA 3UAJA 5F0PB 3V4PA 4UNUA 4NERA 3MLTB 4WW1A 1SYVA 5C0GB 3KVPA 1I8MA 4GUOA 3RIAF 1R3IL 1NM4A 3B6SA 1SHMA 1HEHC 3BGFB 1GC1H 4F33B 5FLVA 4OAWA 3FO2A 2EIMB 4X4XA 3VXSE 1OP4A 3PP4H 4DPRA 4K3JL 5SWSD 2A74B 4YAQA 1LHZA 1Q1PA 4PV8A 4JW3A 4NQEE 5T1DL 5TE6L 2QGBA 3RAJL 4PS7A 1T1ZA 4JN2B 1ZGLB 3QWQB 2WTOA 5F7UA 4JFQA 1FL5B 3G5VB 4XPGH 4YPGA 3GEWB 3RB7A 1D9KA 2BHFA 1GJWA 2PTTB 1IIKA 1VPOH 5FO9B 4AG4H 5I1LB 3MX0A 4AL8L 1N7MH 3HRZC 4TUOB 2IF7A 3KYOA 4MWFA 4GFTB 1MRDL 3FUHA 4OIFA 3SGDH 1T5WB 3E3QE 3JT0A 3GSQB 3V52L 5AB2A 1FL6A 3HB3D 4JM4L 1ZTXH 1ZLEA 1CR9L 3IEAA 5EU7E 2D7TL 3REWB 1RHHB 3QK0A 2YN5A 4M00A 3GSOB 4KJQD 3THML 3FQTA 3QG6B 1CFNA 1W8OA 4JPWL 4XO9A 4L4JA 4BFBD 2PYEA 3QDJE 5DWUL 1J8HE 1A3ZA 1OSEA 5E2UH 3V5HA 3P73B 2YAHA 3VFGH 4U3SA 1TZHA 3N42F 4X0KA 1DN2A 1NCAH 2WXJA 3LPGA 1ZXKA 4LEOB 5DA0B 2P48B 3JV5A 2XBZA 3EXLA 2HT2D 1MCFA 2Y69B 4OT1L 4UU9A 3I6GB 2RCSH 3ABGA 4RA0C 1U8MA 1D3CA 1KB5H 1UD3A 4NQUA 2W65A 4TMPA 4N0RA 1MCIA 3S5YA 4U6VL 1QI5A 1EHLL 1AE6L 1A4KB 1RH8A 2NUTA 5D5ME 1R3HB 3C6EA 5E8EB 2WQVA 3NCCB 5AENA 5AUMB 4J3WA 1TTBA 4PRIA 4YHMH 4AC4A 2WBJD 1A9BA 2F74B 1JNNL 4JRXA 5F96L 3SDCA 1JZFA 1UYWL 1RVFH 2V2XA 3E8UL 3NFPA 4Y4HD 3QWNA 4P23D 3WUWA 5J8OA 4TQ8A 2V9RA 5EZIL 3UTTE 4GMTL 1TQWA 3MC0A 3RU8L 1QA9B 2E86A 4NKMA 1TTAA 3NJKA 1ND0B 4YE4H 3BQUC 3IFNL 3K6IA 1CF8H 5E4EB 1TMQA 1I9RH 4PREA 4M1CD 4XNXL 1NCCH 1QRNB 4KQ3L 3WY4A 1SF5A 3B2UD 5L88H 2GABA 5F7HA 3V9FA 5LAPA 4LP5A 4F15B 2FYVA 3ROOA 4WI8A 1OD7A 3LRMA 4OBSA 1IM9D 1HH9A 4GUPA 2CSPA 4WCYL 1I1AA 1ERNA 5F0MB 3ZUCA 4PLJC 2FEDC 2I5YL 1N9PA 4Z9KB 4UZUA 2AAAA 4PBDA 1IV8A 3UPCA 1MJUL 1QFWL 1WT5C 3IMWA 5DRNA 2GJRA 1FYTB 2XU9A 1HJCA 2MQ0A 1NEPA 3B9KA 4Z7IA 5D2NA 3PWPA 1ESOA 3HC0A 1HQ4A 4NNXB 3MR9A 4NC1C 1HHIB 4U1HA 1A7BA 1AH1A 3ZN6A 4IU2A 3QJFA 1MLBA 3NCFB 5CEZH 1NKGA 2VDRB 2FJFA 1A6PA 2LR4A 2QFPA 1OSZB 1DFBH 4DETA 4JY4B 3TA4D 4AYGA 3A6BH 4Y4KD 2DF3A 3VU1A 4HKJB 5I1CL 2EXWC 5E6IB 4LOUD 4M5ZL 4NWTH 2BHZA 3VXPB 4J3SA 2OMXA 3O0RH 4Z7VB 5GZOC 3KYNA 3MJGX 3VI3F 5IKCB 3IKKA 4TSAL 3L3OA 2LLGA 5D4QA 1A6TA 1XIWB 3SYQA 1G1CA 1B4TA 4YXHL 3TPUA 3T6XA 2X4SB 3RWGA 3OAYH 3ARSA 3MJ9A 3IDUA 2WUBH 4BH8B 1WF5A 3PF2A 1Z9OA 5TDPA 4LB8A 3SQRA 1I9JL 2IH3B 4Y8DC 2P8MB 4ODWA 1M6UA 2LU7A 4UCFA 3I3DA 1HCYA 4X4YA 5I1JL 4L4TB 4UTAH 1Y0LB 2DMKA 4KTEL 4H0HB 3CDZB 3LJ3A 4FQCH 4N8CL 3UBXI 3VFNA 4ZO8A 7PAZA 2BERA 4LHUG 3OC8A 5EN2B 3L5WB 2YRZA 3SPIA 3F58L 3BVNA 1HC1A 5CINL 2GTQA 4AG4L 3S3CB 1MRFL 2E7DA 3ZYIA 2GAZA 2IPTL 3HNVL 4HKBB 2BINA 2A6KA 4PJ8D 1FFOA 4NM8H 4PGDA 3ZY7A 1E8YA 5CJBA 4PS4H 1UWFA 4CN1A 5ICZB 1CT8B 5DHYB 1RLWA 2D7TH 1U92B 3B9KD 4RBPK 1DBBH 4IBZA 4XRCB 1FUNA 5CSZB 1HJBC 2V5YA 2E27L 2XVGA 3QVAA 1VFAB 2J5LB 1BIIA 1ZE3C 4G5AA 3T2NL 2JIXB 3BKML 2DQDL 3CSPA 2FQFA 3U2SA 1T80A 4L18A 5M95B 2BLFA 3H1ZA 1L3NA 4FZEL 4V2CB 5KSBA 2QLVB 4Y2DD 1CG9A 3HMXH 4ZQKA 4BFGA 2X3CA 3GC3A 2XTJB 3O2DH 4BD4A 4J2XA 3FDWA 4NQCB 5C0CD 4H20L 4AYMC 4YFLF 4BZYA 3B7UX 4OCSL 3SGJC 4FABH 3TX4A 2QLYA 5TQ0H 1U36A 1K4CA 2YFOA 4BSVB 2WYHA 3FU9A 4L23A 5AVSB 1OK0A 4AYFA 5BOPA 5HYJD 2A9NH 5AOMA 3IFOB 4ZTOH 1TYJA 5BV7C 1E3XA 4RMUA 1CGVA 3UYRL 4N2NA 4OJYA 3BIBX 2ZOTA 4MNGE 3BFQG 3UYOD 3VXME 2APXA 3ZJAA 2CK0H 2MHAA 3MN8A 2EDEA 4HP5A 3VWKD 4QYAA 1LL1A 2R1YA 4YHZL 3MRLA 3RIKA 4RMTA 4X9HA 1ZSDB 3MLUL 43C9A 3WD5H 4KO6A 1SJMA 1IFHH 1XZ0A 2Y25A 4GRLD 2ILLA 1ZJBA 4LVHB 3MLWH 4JPKH 1JVKA 1KLGA 2QR0A 4PRPE 2ZXDA 4XCEB 2AJYL 4ZYKA 4AC2A 2A9CA 2NT0A 2X9WA 1PFCA 3P4NB 3PWNA 3QJHB 4PJDF 1JN6A 4XE0A 4Y4KC 1DJIA 2XWEA 5IQMA 1OGAD 4PWIA 1AQDB 3EFDH 4JY6B 1B0GA 2IDTA 5HJ3B 5C0AB 1T03L 3EBHA 3WNJA 4L29A 3ME0B 3ULVE 4K9EL 1EEYA 3HPJA 5C09D 1SLWA 1MCNA 2FATL 5FFLA 2ITDA 3MBEB 4ANVA 3PUUA 5HHOE 2AGJL 2N0KA 2NQDA 4JCMA 4ZW8A 2QZ5A 1HSAB 3GHBH 2C9RA 4HHAA 3FOLA 1A7OH 1DBAH 3OKOA 1KXVC 2ZF9A 5C07D 4Y2DC 5HYEA 4LBAA 1RZJC 1I7RA 4OFYD 2O93L 5EOCL 4E68A 4M48L 5GS1B 1OAUH 2WZ0A 3LZOA 2W80C 2VERN 4GUPB 3VXTA 2QR0B 4DP8X 2Y5TA 2Y7OA 2YPVH 5IG7B 1CCZA 4V1DE 4D94A 1RZKH 3B5GA 5H94A 1NGYB 4R26H 2O4EA 1CN4A 5C0BB 5F96H 5F8RC 3QUML 1JNJA 3I6SA 5HHQA 4I0KA 3MYJB 5EULV 1BQLL 1OT1A 1VADA 3BZFA 4TQPA 1EHAA 1WAEA 5C7ZA 2CLRA 3KBHE 2X7LB 4NP9A 3SCMC 2VDKB 4MFHA 4HMDA 2UZIL 1EO7A 4HHWA 4HS3B 2HRHA 4YX2H 1KZQA 4PGBA 4NQXB 2ZYSA 5JW3H 2E9IA 1K4CB 4AQEB 1HDMB 3QA3A 1A14L