1HUQA

1.8a crystal structure of the monomeric gtpase rab5c (mouse)
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
164
structure length
164
Chain Sequence
ICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNTDTFARAKNWVKELQRQASPNIVIALAGNKADLASKRAVEFQEAQAYADDNSLLFMETSAKTAMNVNEIFMAIAKKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural plasticity of an invariant hydrophobic triad in the switch regions of Rab GTPases is a determinant of effector recognition.
pubmed rcsb
source organism Mus musculus
molecule tags Protein transport
molecule keywords RAB5C
total genus 55
structure length 164
sequence length 164
ec nomenclature
pdb deposition date 2001-01-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1huqA00
3EZ6A 1P62B 5FOWA 4JLJA 3L82B 3SU8A 1XBTA 1KI7A 4AK9A 4MYHA 4D80A 5J5CA 4IEIA 1ELOA 4DDTA 4JJKA 3OIUA 2W0MA 5H70A 4S35A 4WZ6A 4PSAA 1CRPA 2C04A 4YDSA 2RGXA 3A1TA 2R62A 4H1UA 3R9IA 1GZSA 5TXGA 3BRWD 1ESMA 1SVMA 3EASA 5EUMA 4D0NA 3KX2A 2QRZA 2WWFA 1DO2A 2ZIAA 5FUWA 3THXB 3CIOA 1L2TA 1G3IA 3FHCB 4PQFA 4ERNA 5JS8A 3K70C 1LVGA 2HJVA 2J0UB 4AG5A 4A6XA 1DAKA 2E1RA 4O0MA 3T1VA 4V0KA 4ZDWA 5KSZA 2DB3A 4PHTA 1SHZA 3OAAD 2G77B 4OJKA 2FX3A 2FFAA 2AX4A 2QPOA 4F38A 3QBVA 3BB3A 2ONKA 2ZITA 3U44B 1W36D 1DADA 3EC2A 4JKYA 3X1YA 1DEKA 4GPTA 4F4IA 3K9HA 3SNHA 2J7PD 2OSBA 2C2HA 5GJWC 5ANRB 1NMXA 3K70B 4OYHA 3MGCA 3ADDA 1Z0JA 3RC3A 3HU2A 4D0GA 4WZAE 3W90A 4A92A 5C18A 2EU8A 2XXAA 2FSFA 1SULA 1ZNXA 2V55B 4L4UA 2AXPA 2IS4A 2ODNA 4WW0A 1E9SA 2GBLC 3PR1A 4BUJA 4DDVA 1Z6YA 4YMVA 4XTRA 1MH1A 5FI1B 5JEEA 2WBLC 1IY1A 3GLFA 1KAGA 1W0KA 3BIFA 3IBYA 4TTPA 3AM1A 5EXPA 3C8UA 2O8EA 5B57C 2YWEA 1IXRC 2VP9A 5EXTA 2O0KA 5HPYB 3KJHA 1P2VA 3WRYC 1YRBA 3X1XA 3ASZA 1D9XA 3HWSA 3KJIA 3A4NA 3C5HA 2CCJA 2QE7A 5JJKA 2RKOA 3ZVRA 1TTTA 4QBHA 2OG2A 3GMTA 3HU3A 2QP9X 1MT0A 1YZGA 2VO1A 5IK2A 3V00A 3ZZTA 1YR9A 1N5LA 4BRWA 4Y0VA 3T15A 1NN1A 2GXQA 5E7MA 2ATVA 2AWNA 1XD2B 4EPYA 2WM9B 5AK0A 4DCVA 1DARA 1LY1A 1JQJC 1GUAA 1N5JA 1Z0KA 3WHKA 5CLLA 1SQ5A 4MITA 2R8RA 1OFHA 2VEDA 4QGFA 1AZSC 3CRQA 4XJXA 5HE9A 4ZIRA 1KIMA 2HEIA 4Q5IA 2GWHA 1U8ZA 4LHYA 2V3CC 1VPLA 4KFSA 3QKRB 1UBFA 3D31A 4LYFA 1T4GA 5FBVB 4WIAA 1X8KA 3RS5A 4MKGA 3ADBA 2MMCA 3QOFA 1NP6A 2EVWX 1HQYE 4M1MA 3R9XA 1KJZA 1W1WA 5FPTA 2ORWA 3DMDA 3E1SA 5LB4A 4EIWA 3VKGA 1SGWA 2CL6X 3GEIA 1NNEA 4IOLA 3R9WA 5DI9A 1UDWA 2QROA 5EUQB 4BFTA 2XGJA 4DSNA 3PEWA 3AKEA 5D3MA 4Q9IA 3ZDQA 4LBVA 5HCNA 3TUZC 1G4AE 2AKYA 3OE7A 2JLVA 1Z5ZA 3FMFA 3A1WA 1MO3A 4TSFD 5KDLA 3T61A 5EE3A 1E9DA 3WHLA 2JEOA 3ND9A 3DMNA 1OHHA 4C0BA 2SHKA 1Z0FA 4BFWA 2ZSFA 4KFTA 2PCLA 3ZZ0A 1Z6GA 1E1RD 4ZDKA 1UKEA 2ZVPX 2QT0A 4HLCA 4TL9A 4XOIA 3SYLA 1NVVQ 3P4XA 1G9XA 4V03A 4V0ME 4C0JA 4AI6A 4DB2A 2GZDA 421PA 4TMVA 2J0UA 5JFGA 4LPKA 1E0SA 4Q1FA 1K5DA 2QQ0A 1NJGA 3ETLA 3I3SR 2FSIA 1AGRA 3K1JA 4LHXA 4OKSA 2GZAA 3VR3A 5JCPA 4CEJA 1KK1A 2WKQA 2OO7A 2HF8A 4Q4JB 1Z6XA 1ESNA 2IWRA 4B44A 1SZPA 2QT1A 4Q4AB 4A4DA 2FPLA 4D4MA 2IUSA 2GF0A 4UJ5A 2O8FA 2O8BA 2ZI3A 1RKBA 3ICEA 2ZUCA 3O8BA 4XD7D 3WP0A 2NPIA 1JAHA 3AVPA 3EA0A 3E70C 5J4KA 1QHSA 2EFEB 4P33A 3GLIA 2NZJA 4GMDA 1TADA 4P0TA 1T3LA 8OHMA 3PG5A 1HY3A 1RW4A 3FVQA 3Q5EA 2Q3HA 2WWXA 1TQ6A 4UNSA 1E2LA 3AB3A 2ZJYA 4B74A 5DN6D 4CEJB 4W5JA 2C98A 5EE0A 5JSZA 2GZHA 1E2HA 5H8WA 4KBFA 3Q7PA 1Z6TA 4IDHA 2QTFA 3GJ5A 3FKSD 1FL9A 2OZEA 2G0NA 2LWIA 1JXOA 2ZAMA 2D3WA 4AKGA 4PHHA 2P6NA 4TMKA 4D26A 4HUQB 1MRSA 4EFMA 2WIBA 3DHWC 5BN3A 1Z06A 5JRZA 4FWTA 1Z6AA 1N6PA 4B6FA 2IYYA 4Q7LA 2IYZA 3U7GA 1E96A 3W6OA 2JA1A 4DWJA 4PHGA 1G16A 1ZVQA 2FPKA 2OBMA 2OFWA 3CX7A 5EQTA 5TARA 4E03A 4AWXA 4ACBA 4FW9A 2YYZA 5TB5A 3A37A 4M53A 5LB2A 2BMDA 5CDFE 4N0DA 1ZM2A 3ZIAA 3FYHA 2BKUA 1T8TA 3IQXA 1HURA 2N1BA 3IIJA 2ZRDA 3KKMA 5KYKA 2YOFA 1S9HA 1US8B 5KSPA 2ZE5A 4IEEA 4IDPA 4QNMA 2DFKB 3ZQ6A 1LS6A 3I92A 1OXTA 2QUZA 2WWIA 3QPUA 4GI7A 3MG9A 4MRPA 3RRZA 4Z51A 2GCOA 1G3MA 5L3SA 3TBKA 4LGMA 4Q4HA 2P67A 1P9RA 3K09C 3IIMA 4GMXA 1XDBA 4BLOA 2JJ1D 1GWNA 2PLFA 2JLWA 3Q7QA 4MQBA 2TMKA 1QHIA 4MYTA 5C1BA 4URWR 4JVLA 4C3ZA 1VCIA 1ZU4A 1ZM9A 4Z8XA 1RJ9A 4A8JB 1ZYUA 3DEFA 4TWZA 1E9CA 4ESHA 1TQDA 3UMSA 1G8PA 1O87A 2HYIC 3RC8A 4PO8A 1FW6A 3O47A 2DWQA 2JLXA 4TL6A 4C7OA 2Z83A 3FDIA 2GXAA 4KYUA 3LVRE 4QJ5A 3KXKA 4R9UC 1HH4A 2H17A 3I72A 5DISB 4K46A 3KUDA 2XTNA 3RRNA 3MJHA 3WNBA 4B3DA 1KY2A 4A0FA 5FTNA 1W5SA 3CF2A 1EFTA 2PX3A 3C15C 3GLHA 2GAAA 4RKFA 2BKEA 4RFVA 3BJIC 1S1MA 4P32A 1M7GA 1I2MA 2WWYA 3R8FA 3T5DA 2O8BB 3B1WA 3BBPA 3QIAA 2ZANA 1GVNB 2MSCB 2ZRNA 1RIFA 1YQTA 1GFIA 5HZHA 3CWZA 2FEOA 3VHXA 3T1OA 2XNDD 2AD1A 4Q48A 4NH0A 1AS2A 2DWOA 3WP1B 1RE0A 2D2FA 5BWMA 5TDHA 1XP8A 2XJ9A 3AF4A 3T1QA 2BOVA 2OEPA 3SEAA 2RGCA 3C41J 3IEVA 3SQWA 4M9ZA 4G5OA 2CVFA 1JR6A 2ERYA 4ZO4A 1GNRA 2OCYC 3K0EA 2Y8EA 2WWHA 5G40A 2YKGA 2QSYA 1P2TA 4O25A 1A2KC 1GKUB 5CLQA 1LB1B 2RHMA 3GLIB 4P4TA 4Q9JA 1E3MA 1VECA 5DI3A 2OCPA 4Q03A 2W00A 3QXSA 4LI0A 4AYXA 3WMEA 1CRQA 2JJ2D 3W3AA 2ZREA 3SFZA 1FTNA 3IO5A 3NIBA 4J0QA 3PENA 4Z54A 4I99A 3B13B 4BGDA 1G8YA 3UMRA 1MO5A 4OK5A 4ASUA 4RKEA 1SXJC 1G5RA 2C96A 3QXXA 1VYVA 3EXAA 3PV0A 2CL7X 3ZGXA 3DOEA 3UIEA 3LW8A 2CHGA 1W2GA 1W4RA 1DTSA 2OBNA 4JL5A 4BZXA 4B43A 4Q1CA 1TEXA 1YKSA 1SKYE 1AS0A 3ZJYA 1WF3A 1LF5A 4DLZA 5B64A 4U02A 1TU3A 3WMGA 5JI3E 2QAGB 4TZ0A 1Z07A 1S9DA 2QGZA 3JVVA 3Q3JB 5FOUA 3KFVA 1EFCA 2VP0A 5HKKA 2A5DA 4JBXA 3AVVA 4M9SA 2ZYVX 3IHWA 3I62A 4D4LA 5P21A 2H92A 1OH6A 3E5HA 5IK2D 4B2LA 4HZIA 4EJSA 2MSEB 1KTVA 1E2DA 4ZKDA 3BFVA 3U6KA 4XWKA 3WY9A 4JLVA 5FOVA 1WDTA 3MRSA 5CM9C 3FKQA 3EARA 3TUJC 4UXIA 4GOKA 1KSJA 5L3VA 1E79A 4HATA 4MRVA 2AWOA 3GLHB 1F2TB 3S1AB 1EX7A 4P31A 5F98A 1HYQA 1FNMA 4OHZA 3U4QA 2L0XA 1DOAA 2HCJB 2OESA 1IXZA 1UPTA 1W4CA 3GEEA 2A78A 4XSGA 1AJEA 1A82A 2BBOA 2J3EA 5CM8B 2WAYA 5CK4A 2CK3D 3K0FB 5KNDA 1GDDA 1H8HA 1KSHA 4ILEA 3U61B 2OXRA 1G17A 1AIPA 1IAQA 2NOAA 2GF9A 3K0AB 2VL7A 2FSHA 5KPDA 1MO6A 1KZ7B 1VG9B 3RNLA 1KO7A 1QBKC 2CBZA 1G21E 1Q57A 4LX0A 1SVIA 4UNPA 5L3RA 5FUVA 2GJ9A 4EDHA 4WBSA 1HT1E 4OQLA 3CPHA 3SR0A 3IDQA 2A3RA 1DAIA 4HB4A 3LWNA 1OSNA 3CPJB 4OQXA 1SVSA 3QUSA 4NDZA 2AXNA 2VP6A 2WWWA 4B35A 1C4OA 2RGNC 4RZXA 2WTUA 2P0EA 4QJ3A 3MFYA 3IPXA 3H4MA 4DVGA 2YZ2A 1IXSB 4B34A 4PX9A 4CEHB 1NY5A 1A1VA 1Q3TA 1QVRA 4LZZA 2C9YA 1ZM4A 5EZ6B 3NDBB 5DYGA 2ZRMA 1R8QA 1E6CA 3IKJA 3QKUA 1BO6A 4URYR 4CF7A 5A0FA 4H9GA 1KI8A 1TL7C 1VDZA 2ZSDA 3CRW1 4TMZA 4HB2A 2JLYA 2GK6A 4OK6A 3ZLJA 5BW8A 4Q1DA 2Z43A 5CJ2A 3PEUA 4V0MA 4G3XA 4EQ6B 2FDCA 3F3YA 4W5WA 4BPBA 5JI2E 4JS0A 1NY6A 3THOA 2A5FA 1II0A 4Z8YA 5A4JA 1H65A 4QG7A 5GVRA 2VP2A 3KB2A 1Q1BA 2GK7A 1S8FA 4R7ZA 4NYJR 2FOLA 3MJRA 3X1ZA 2G1KA 3W8NA 2V1UA 2NO0A 4EAQA 4B32A 2IXFA 1ZW6A 2PMKA 1AK2A 4G5RA 3LDAA 2ZSAA 3QKSB 5EP4A 4ZCLA 4Y0AA 1U90A 1Z22A 4IRUB 4DKXA 1KHTA 2ZRHA 1CTQA 5D3QA 3I61A 2HLDA 3I1FA 1RFLA 3QQ5A 3TUIC 3AF2A 1O3YA 3QXCA 1YZKA 1R0XA 1QHHB 4ZI3A 1CBUA 4BWYA 1F48A 1W5TA 5DSZA 2ZRGA 3OEEA 1F60A 1N0VC 4TYYA 4QHSA 2VTKA 3X1DA 1GKYA 3CB4A 721PA 3N2EA 4LYAA 4HLDA 4DLSA 5GVSA 2HUPA 2PZEA 1UJ2A 4LJAA 4XVUA 2BHRA 5L3QA 3NTUA 3K0CC 2YWGA 5EE1A 1XD8A 1E2GA 2WV9A 3ZVMA 2X1VA 3U4QB 3AVUA 3OF5A 2PH1A 3T34A 5DH9A 5EP2A 1ZNWA 3GLFE 1P2SA 4NP6A 2GRJA 4L5BA 4DLYA 4Q19A 4WA7A 2FGJA 4PC7A 3LQRA 4RD6A 2B8TA 3UPUA 1Z47A 3T5GA 1US8A 3ZS8A 1JXMA 2IL1A 3KKQA 4JT4A 2GXSA 3WYFA 2BWJA 3K0AA 2QM7A 3HYRA 3TRFA 3U3KA 3RRMA 4Q18A 3RYTC 4BEJA 3PVSA 2O8CB 4Q66C 4OI2A 4HAYA 2V6JA 3B9PA 3HR8A 1JB1A 3KKNA 5FR2A 4DLXA 3G0HA 3K9GA 3W6NA 2ZYWX 1F6BA 4PFSA 2XTMA 1NLFA 2CDNA 1E2PA 2ZM5A 2PZFA 4RFSA 2IF0A 4B75A 4KVGA 1ZUNB 4V02A 4NYIQ 1G19A 1WE2A 3Q85A 4W7SA 2XOKD 4KAXA 4URXR 2W83A 4V0OA 2PLRA 3SDZA 3U7FB 5C2JB 2CVHA 5JLJA 4FMDB 3PUVA 1QRAA 5C46F 5B58C 2VSFA 1E94E 2BM1A 4KSBA 2DWPA 2V1XA 3MWYW 5L8VA 4BLQA 2QN6A 1COWA 1OYYA 2ZJAA 4TN1A 4DRZA 4DXAA 5JWOA 4PZYA 4Q7MB 5FTJA 3GLGB 2UVQA 1AN0A 4RFSB 1ZC4A 5DO9A 4EPXA 1OXUA 1KI4A 2IYTA 4LRWA 2OXCA 4MRNA 2XITA 2X2EA 4A9AA 3B2EA 2BV3A 3NEJA 2XX3A 1VCNA 4L16A 4US1R 4JJZA 2IYVA 5AJWA 2ONJA 1Q1QA 2QM8A 4DUGD 3NEYA 2J59A 2NQ2C 2WPDA 2PT5A 3F5FA 3B1ZA 3QEOA 1RZ3A 2ZRCA 1E2MA 3HR7A 1R7RA 3GFOA 4II7A 1D9ZA 1NVWQ 2XZPA 5CYOA 4HLUC 2JJ1A 1QHHA 3THYA 1Q12A 1R0WA 3FMPB 2H5EA 1CULC 4L9SA 4NCNA 2IS2A 5KOYA 1RPZA 1NJFA 3U44A 3ICQB 3B85A 4R71A 1E9RA 3LQQA 1OV4A 1FQJA 4I1VA 5GJCA 3DPUA 4CDGA 1JBKA 1SVLA 1XTSA 2VP5A 4F4JA 1NBMD 2Z4RA 3OEHD 5HTKA 2D7CA 4OHXA 5C4MA 5KPJA 1XZPA 1X1SA 2V8OA 2QBYB 4ON9A 4YC7A 1ZAKA 1AKEA 2CCGA 3EIQA 4LHWA 3PUWA 1GNPA 1IBRA 4PO1A 1M7BA 5JSZB 4FINA 1JALA 2WJVA 4QFMA 4RZUA 3T06B 4FWIB 4KVAA 4PZZA 5E3HA 2VF8A 1W48A 1EGAA 1EFHA 1WMSA 3MWKA 4Q47A 4P4SA 4ASUD 3N2IA 2H57A 4C2UA 2WJIA 4UXJA 2X2FA 1XMJA 2ODEA 3SZRA 1G7SA 1G5TA 5AWFC 2WWGA 4BFVA 2VSOA 2ZI5A 2FGKA 3TR0A 4TYWA 3AF3A 2C99A 2J41A 4MA4A 4PPQA 3RABA 1CJVC 2FEMA 1OW3B 3PUXA 2NTYC 4TYQA 1QHYA 1ZUIA 4R2HA 1XJCA 2R2AA 4B3XA 2XAUA 5JEDA 3NVAA 1G6OA 3LBIA 3RWOA 1G4UR 4GZLA 2IX3A 1AZTA 1YRAA 2R44A 2Q0HA 1XD2A 1ZNYA 2G88A 2RB4A 2ZS9A 4CEIA 1KI9A 5KDDA 3Q9LA 4A2WA 2YNMA 2QPAA 2GVZC 1LV7A 1Z0DA 2NO6A 3MWJA 1E2JA 2VH5R 5DLQC 4EPRA 1ODFA 3RVBA 1NSTA 3VR2A 1RJ9B 3QEJA 2ZU6A 4A8JA 2ZPTX 2YHSA 4JL6A 2OFXA 1JAIA 3B8HA 4GP6A 2G0TA 3FMIA 2G6BA 1E32A 1NN5A 3NDPA 4UKDA 1UEIA 2O8EB 1XMSA 4PPGA 4DEYA 1T6NA 2WJHA 3SJAA 1BIFA 4RSGA 3PXGA 3VU9B 5LD2C 1N6OA 5TMPA 3LBHA 5J4LA 2J9RA 3CM0A 3GFPA 1XTQA 2KBFA 5J4YA 4C7OB 3QBTA 4ARZB 1XFAA 1XXHE 2ZJZA 2IWHA 4URUR 4CYMA 1XTRA 1HA3A 1QVAA 2FFQA 3W9YA 1TUEA 2CJWB 3BB1A 3EWSA 3JZMA 1OIWA 4I1UA 4IVRA 5J47A 3LAWA 1KNXA 3X1WA 2IXGA 3AGPA 3I5YA 3EPHA 1OXVA 4L15A 3H86A 4DLRA 1Y63A 2ZQ5A 4DIDA 3QNUA 4IW3B 1P9WA 2VHCA 3THXA 2NMVA 3GJ3A 3GLHE 1G5PA 1YR7A 4Q7JB 4JYBA 5FL7D 5CB8A 4A0RA 4C0KA 5JHHB 3UKDA 1U2RA 3GEHA 3O8CA 3U2QA 3K70D 3CBQA 3QE0A 3VTKA 2IYLD 1OH8A 4DB4A 2ZR0A 1GSIA 4BE7B 3L0OA 4IOJA 3TAHA 4B2PA 3RANA 1IHUA 1F2UB 2RAPA 3A4MA 4X8MA 1G7TA 1KK2A 3T35A 1U81A 2O5VA 1LNZA 1LF0A 1N2CE 1XF9A 2CLSA 3M4YA 2ZRKA 4HAVA 4NYMR 1AGPA 1IN6A 4XWOA 4GT1A 1E2QA 2ZI7A 3LW7A 4PO9A 1F5NA 4QGHA 4BFUA 3ASYA 4PC6A 4XTCS 1E0AA 4RZ3A 2AKAB 3J81k 2W58A 2QBYA 2ECKA 2EYUA 1CP2A 2P3SA 4HZUB 2R6CA 1Q3HA 4QM7A 3NC1C 2AK3A 4NCKA 2DFLA 4GOXA 2DFNA 3QVVA 2ZJOA 2KB0A 2HT1A 4EPTA 1I2DA 4M1YA 3VQTA 2YVUA 5CIWA 4CIDA 1JPNA 2P5SA 3TQFA 4TLBA 3RDPA 1U9IC 2F3RA 2B92A 4LHVA 3K9NA 1VHTA 4LV5B 2GHIA 3GPLA 3O8DA 3CNLA 2XNDA 2X19A 3G82C 3PITA 4DUGA 2W2XA 3EZ9A 4IJMA 4TZ6A 3HPRA 2NG1A 3T1TA 4Q4HB 2C9OA 1W0KD 2CNWD 2D06A 2Q9AA 3QKSA 2BBTA 4QHTA 1N25A 3GJXC 3RS4A 2QZ4A 1EXMA 4MKHA 1HTWA 1YJ5A 1KMHB 5SZKB 1SHKA 1W4BA 1YZLA 2W6ID 2DY1A 2ZJ2A 3D6TB 1YZUA 3P1JA 3N70A 1LFDB 2N42A 2J45A 1WCV1 3EZ2A 3SHFA 1MABB 2BBWA 2AFHE 2D2EA 1G3UA 3RS7A 5HZKA 1QHGA 1ZU5A 3L2OB 1G41A 5JRJA 2V6IA 3SJBA 1II8B 1R8SA 2OM2A 3KJGA 3ADCA 4OHYA 4YMWA 3TKLA 2OAP1 3FFAA 4MRSA 2AL7A 1S2MA 3ZYCA 1QHXA 3PEYA 3A1SA 2ERXA 4LJ7A 3CRMA 1G64A 1A7JA 3BH7A 2GTPA 3QKRA 2E87A 4AG6A 4MGIR 3C16C 3LO5A 4YXWA 221PA 4JIMA 5A5GA 3KTAA 2VHUA 3U7EB 1OHHD 3IUYA 3BFXA 2CMKA 4KI0A 2GESA 3B1XA 4U00A 2I4IA 1OPXA 3IEUA 1XTJA 4LBZA 3W6PA 1J7KA 4OL0A 4WXPA 5DHFA 3K8YA 1CR0A 4LJ9A 2QEQA 4MDFA 3GQBA 1FPMA 4Q9LA 3TIFA 2ZETA 3BERA 2QMHA 2BC9A 2OLJA 4LDJA 4EPVA 5DNYB 2GJ8A 5FTLA 2IUUA 1G7RA 1KNQA 2VYFA 3KTAB 4Q21A 4AY2A 1E9AA 3BE4A 4UNNA 2R65A 2PEZA 3ONWA 2XNSA 4KJZA 1TX4B 3KUCA 4XH9B 1KDOA 1GOTA 3AKYA 3P27A 4JSYA 4CGZA 1GL7A 1EFRD 3VX3A 4B48A 5BN5A 2ZJBA 521PA 3NKVA 2QENA 4GFDA 3C7KA 3WMFA 1PVOA 1UBEA 1XMVA 1A5TA 3ZVLA 1ZM7A 3GLGE 4YONB 3H2YA 3BS4A 1E2NA 3A6PC 1VYTA 1W46A 3I8XA 4OI1A 2FE4A 2F1IA 5KU1A 3B60A 1XZQA 1J99A 1KKLA 1XCPA 4GNKA 4C2TA 3H84A 4TMWA 4LHZA 3CONA 1HV8A 2ZAOA 1UM8A 2VSXA 3BWDD 4LYHA 5TV2A 4M1SA 4Z1MA 3P26A 4EKDA 2ZE8A 1KMQA 1W36C 3BFKA 3EG5A 2WMNB 3IPYA 1EWQA 1OFTA 1G7CA 1DE0A 3D3QA 1IN8A 4PHFA 4TQ9A 2XB2A 1DELA 3B82A 4D4KA 1EX6A 2BMJA 1P61B 2IW3A 1CKEA 1VTKA 3AUXA 3LA6A 4WXRA 2JLZA 3SHWA 4TSFA 5SZIA 3GJ6A 1TU4A 3REGA 5L3QB 3FB4A 3UWOA 3ZZUA 2EFCB 3SBEA 2EQBA 3IBGA 4IFBA 2ZROA 2ODBA 1XEXA 1IJEA 3A1VA 1ZINA 4KSCA 4TL8A 5FFMA 1CS4C 3RSLA 3AUYA 3LLUA 3OIYA 4JSTA 5H68A 1CXZA 1GL6A 1ZCBA 2ANCA 1X3SA 1KI1A 2DYKA 2IC5A 4ZDIA 3SE0A 1OYWA 4H1VA 1P72A 4W9MC 2FV8A 5JWRA 1WBDA 1QHNA 2WSSD 1NBME 1S0UA 1EWRA 3LBNA 3S1AA 4PAQA 1MRNA 1CIPA 2WPDD 4S2EA 2O8CA 1HE8B 1JR3A 2RGEA 2Q9BA 4PZLA 1SKYB 4CT4B 6Q21A 1ZJ6A 2ZXUA 4FCTA 1ZC3A 4AKHA 1QDEA 2WZQA 1N6LA 3BORA 3MMPA 4B33A 4NBSA 3VKWA 3ZD7A 2B21A 2JIZA 3MAAC 3ZQJA 1G8FA 3JVUA 2OT3B 4DLWA 4QL3A 4NYIR 4M21A 4DBLC 3DKPA 3RHFA 1Z83A 4QGAA 1H8HD 3MUFA 3CZPA 3OFND 2WJGA 3OIVA 2K5UA 1SVOA 4XVRA 1E9FA 3K0SA 5G3ZA 4OQMA 1AA9A 3M1IA 3BB4A 1YZNA 4BLRA 4NCJA 2IYWA 1X8LA 1XMIA 2J1LA 4FIDA 1G6HA 2W2VA 3NBFA 1VIYA 2IYSA 3FE2A 2VQSA 4Q9HA 1KAOA 5TY0A 2ZRBA 2Q3FA 2F43B 2GDJA 2N46A 3FHTA 2D62A 1XNJA 3EWAA 1SVKA 3NG1A 4Q02A 2IT1A 3PUYA 5AUNB 4GZMA 2IYUA 3CWQA 1TQ2A 1G1MA 1NVVR 4C30A 3SBDA 4DEXA 4R2IA 2ZRPA 1WXQA 2R6FA 4B71A 4ABYA 2RGBA 4WVFA 5E7JA 4D82A 5SZJA 2WAXA 5E7IA 4C9BA 2JGNA 1LTQA 4JT2A 3WRXC 1NIJA 2ZRJA 4DCUA 2DFTA 5E4FA 2NPFA 2CE2X 2IF2A 2QSZA 4UNQA 1CLUA 1L4YA 4C0SA 2IHBA 4A82A 1HUQA 2ZS8A 1KK3A 4A8JC 2KE5A 1KGDA 2MSDB 2J7PA 4US2R 3BH0A 3TJZA 4MYCA 1IY0A 1J90A 1GKIA 4B47A 1N6RA 2VBCA 1Z63A 3RAPR 4X8HA 3TH5A 2JDID 2WJYA 2W2TA 3AH8A 4JMPA 3EX7C 1VG8A 3TSWA 4BLSA 1XEFA 1P9NA 4JLAA 2A5YB 1EG7A 1NI3A 1RYHA 1VG0B 1VHLA 1Z2AA 2REBA 4DZZA 1Z2CA 5FI0B 2KWIA 1XPRA 3UWKA 2J46A 4D0LB 1GL9B 3AV0B 4FMCB 3VKHA 1XD9A 4EJSC 1N6KA 4AYTA 3VMFA 3RS0A 4V0LA 4M1TA 1MO4A 4Q9KA 2GKSA 4N1AA 3H0KA 3ZH9B 4F91B 2O8FB 5GJBA 4ZKEA 2BEJA 1VYUA 2B6HA 1UKVY 4Q1EA 4KODA 2QY9A 1OB2A 1J8YF 1CR4A 3I73A 4NE2A 1RVDA 3FTQA 3QENA 1ZD1A 3CH4B 4DDUA 3IILA 1P73A 1UDXA 3TGPA 4HAWA 1ZIOA 4MGZR 2ZE7A 2OV2A 4CRWB 1KI2A 4JYCA 5FTMA 2JLQA 2RMKA 4OBEA 4RCYA 4HAXA 1J8MF 1G3RA 3RWMB 2GBLA 5M04A 4JVMA 3PJRA 1XU4A 3QG1A 3B7GA 3SI7A 4KFRA 1TMKA 3EZFA 4FCVA 4RCZA 1I4DD 1Z3IX 4TYPA 1E0JA 4E09A 4KFUA 1MKYA 4ACAA 5AUPB 3D8BA 3FOZA 1BKDR 1N6NA 4OQNA 3OEED 1YHNA 3DKVA 2WICA 1CU1A 3HDTA 4QC2A 2BIFA 5L3SB 2P65A 2YOHA 2HF9A 4DCTA 2ZS7A 3W34A 4LSGA 1Q21A 1WA5A 1IJFA 3KQUA 3VNVA 1JPJA 1MV5A 2HLDD 3L0IB 1OKKD 3KL4A 2I1QA 1KY3A 2W6IA 3W5JA 2ZTSA 3TW8B 2H7VA 3SJZA 3R20A 4FD2A 5BYJA 4CW7A 3L0PA 2R6AA 3FMOB 4X8LA 3UANA 5FOTA 3U60B 4CZ2A 2IK8A 3A58B 4M4SA 2GEUA 1HE1C 2QL6A 1E4VA 1UBGA 4G0NA 4PR0A 4P4SB 4Q4LA 4LJ8A 3AP3A 1Z29A 4KU4A 5K8UA 3B5JA 3CF6R 5FPHA 1U98A 2UZIR 2IYQA 4DJTA 1J70A 1XXHA 2OUKA 3PIRA 4C0QC 1P7CA 3I5XA 2H18A 4TMXA 1N5IA 1P5ZB 3KKOA 3KQNA 3F8TA 3NBXX 3QVUA 1XCGB 2BEKA 1ZCAA 2HXYA 5EJEA 2GCNA 5EE9A 4C4PA 3CPEA 1BYUA 4NONA 2QORA 3M6AA 5DGXA 2PBRA 3GJ4A 1KSGA 4BFSA 2O0HA 4HDCA 3KB1A 3HU1A 2FA9A 1OB5A 5LPNA 1D8TA 2DR3A 2IYRA 4LCBA 4JLBA 2B7BA 1X86B 3NHAA 4TTQA 1W0JA 3GJ7A 3SOPA 3Q72A 3Q5DA 1P4SA 1TF2A 3QG5A 1BMFA 2OAQ1 5FL7A 5J4HA 4BQSA 5KNBA 1NG1A 2CEAA 3OFNA 3IHLA 1N3BA 5TVKA 2GA8A 1P6XA 4XVQA 3JZAA 3SC3A 1E99A 1V43A 2QMOA 3IQWA 2CLCX 1DVRA 4M1OA 3U3MA 4LK2A 5GJVC 2HXSA 2QAGC 5AJYA 2C95A 1SVWA 1Q44A 1ZD9A 4I4LA 2DPXA 1Q1EA 3CRRA 4LJ6A 2HT6A 3MCAA 4KO8A 2IHYA 2D4HA 2D7DA 4RD3A 4MGYR 3RRYA 3UG7A 3I32A 4JVSB 1AQUA 1UF9A 4M22A 3LVQE 4IKEA 5LDDC 2OE2A 1E4YA 3LNCA 3KXLA 2LKCA 3WYGA 2WSSA 4G5GA 1Y3AA 2O52A 3CX6A 4IDQA 2ZI9A 2ZRLA 4HAUA 2GAOA 3BH6A 4QOSA 3CR7A 5HCIA 2VHJA 1N0WA 5F9HA 2GJKA 1TPZA 2ODWA 5JBQA 1CJMA 1NVUQ 1W0JD 5KDOA 4HUQA 5J40A 1G20E 3CO5A 1M2OB 4WOPA 5KSOA 3TQCA 3WBKA 3O8RA 4HI0E 3EPLA 1NKTA 4QGGA 3OE7D 1SXJA 4LV6A 4DCSA 2ORIA 1M7HA 3TLXA 4D4JA 2Q3MA 3B9QA 2CXXA 4RVCA 3WNDA 2X8AA 3OHMA 2JLUA 3L43A 4BEBA 4JVNA 3AF0A 1TNDA 4ZI2A 4QNRA 3VR6A 1JNYA 4TLAA 2G83A 5K8IA 2YC2C 4M2LA 2ZR7A 5JCZA 1E9EA 4JLPA 1LS1A 3EC1A 1R5BA 4FMCF 3THWB 2IS6A 1KI3A 5GADl 4NCIA 4DLTA 1PUJA 3CRVA 4XSHA 1R6BX 4QKQA 4QBFA 1X8JA 2JCSA 3K09A 1R0ZA 5JMTA 4K8OA 4QXAA 1FP6A 1FUKA 2YJTD 1OLOA 3EZ7A 2J0SA 3PFIA 1T5IA 2GEDA 4O2LA 3D7MA 3BC1A 3IGFA 2RGDA 3EIHA 3UG6A 3DM9B 2ZYTX 1YR8A 2KSQA 1EFRA 1W49A 5K8TA 5KNCA 4A36A 1U0LA 1IY2A 2PJZA 3U5ZB 1M74A 4PTLA 1I4LD 2F6RA 4TQAA 4A0HA 2AHOA 5AJXA 4PSKA 2PL3A 3OIWA 1S1CA 1DBSA 1E9BA 4HB0A 4JBYA 1DG1G 2ZUBA 1KDRA 4MUBA 5BYKA 1E98A 1F2TA 3KQLA 1FOEB 3OESA 4QRHA 3RLFA 2XJ4A 2QRNA 3TNFA 1XTIA 1Q0UA 3CW2A 4I81A 3R7WB 2ZRIA 4PSVA 4LBYA 4IOMA 4Q00A 5H1YA 4FMBB 4HEJA 5CK5A 5EXXA 2J5XA 3L8YA 1T8UA 2O8DB 2ZUDA 1AM4D 4NZYA 3DM5A 3GLIE 4ZV4A 1XRJA 1GTVA 4C0LA 2BDTA 621PA 4O3MA 1OKKA 2PX0A 2WHXA 3GD7A 1EK0A 1T9HA 2BBSA 4IOKA 2QE7D 4IFEA 2EWVA 3BGWA 2YWHA 1S96A 1ZNZA 3EA5A 4TT3D 2H8KA 1E2FA 4AIIA 4IVQA 4BASA 1JJ7A 1G291 5DI3B 3SS8A 2C9CA 1OIXA 4YMUA 1FMJA 3AVTA 1PLKA 3RS2A 2NO1A 2O8DA 1WRBA 1I4TD 3NC0C 2PZGA 1PZNA 2XEXA 4IDOA 4BFZA 4TYNA 3AP2A 4URZR 1U0JA 5IDVA 4E22A 2P6UA 1J2JA 2A2ZA 1D6JA 1E69A 3OAAA 4U5XA 1KDPA 4DSOA 1R5OA 3KFXA 4UNRA 4A2QA 4B6EA 3W5IA 3P20A 4F93B 2J0QA 3ADKA 3C5CA 1UEJA 1F2UA 1MR3F 1W4AA 1D5CA 2GCPA 2CNWA 4DDWA 2JLRA 3GJ0A 3IIKA 3BXZA 5FUYA 2FF7A 1G8HA 2OHFA 2XZLA 2ATXA 2WVJA 1QF9A 3EPKA 1VKJA 4JLKA 5FBQB 2FNAA 2BCJQ 3A1UA 1ZD8A 3FPAA 4JKIA 2H16A 2QMEA 4KLNA 5DE3A 1DAFA 1JQLB 4NPHA 1OFIA 2FFBA 2CCKA 2I3BA 4NHOA 2X77A 1T0HB 4Q7KA 2JASA 1DS6A 3CR8A 3TR5A 3TW4A 3SJCA 4GSYA 1SKQA 4EQ6A 4L8GA 3AVWA 1NLZA 1DAEA 2YWFA 3AKDA 4Q1BA 4N0EA 2XZOA 4PPNA 5IRCD 1TEVA 5AJZA 1GRQA 2NIPA 4K81B 4A6PA 4URVR 4TLDA 1PUIA 3GP8A 2ZSEA 1JR3D 2Q21A 3KQHA 1NSFA 1T5LA 4RY2A 2IXEA 3CZQA 2NGRA 4QM6A 3QXJA 4LYJA 4F4CA 2KBEA 4ZIRB 1IN5A 1ZMXA 2R6GA 4QBGB 4JZKA 2CK3A 5F3WB 4JBWA 3TSZA 4NYMQ 1IN4A 2DCUA 2F1HA 4BFXA 2C8VA 1MABA 3H1TA 3A4LA 1WP9A 4IXNA 3NXSA 3SFVA 3V9PA 1R10A 4B3CA 2EFHB 2HJGA 4RZ2A 2Q6TA 3NWJA 3C4JA 2E9SA 1Z8FA 3VR1A 2FU5C 2ZSBA 2ANBA 3MD0A 1CR1A 1M34E 1R0YA 2DBYA 3OZXA 1XWIA 2GJAA 1RRPA 1WBBA 5SZHB 3DL0A 4GOJA 4AYWA 4DHEA 1CF4A 2PMDA 3THWA 3Q8XB 1CEEA 4CEIB 4OI4A 1ETUA 3UK6A 1VIAA 4ZPXA 1N5KA 3AF1A 2HV8A 5D3MB 4QHYA 3AGQA 2J7KA 2OBLA 2BCGY 1YE8A 1VMAA 4M9XA 2C78A 2VLIA 4M9QA 2VA8A 2F55A 4FMDF 2PCJA 2V7QA 3DO6A 2XOKA 3DZDA 3DZ8A 2Z0MA 1YZTA 3REFA 5K8LA 4MGKR 1GNQA 4BLTA 2XSZA 1OF1A 4AKIA 1R2QA 5LD2B 2IBMA 1OH5A 1W47A 4LC1A 2JLSA 4XD7A 1NIPA 2F1JA 3K0FA 4TQUS 4YLGA 3IO3A 2C77A 2JIZD 4UQOA 2RGAA 4IXMA 821PA 4DC9A 3KJEA 1YR6A 4DT1A 1NRJB 3LY5A 5EXSA 4XIGS 1KO4A 2QA5A 3VU9A 1ONBA 5BQ5A 2FFHA 2QP4A 1C9KA 2F1RA 4P3YA 5JJLA 1KYIA 3T12A 5FBWB 1FTSA 3AKCA 1UKYA 1U0HC 1ZUHA 2WSMA 5FH9A 1L4UA 1DG3A 1JECA 1OFUX 2G3YA 2MMGA 4RD0A 2A9KA 3K9LA 5FPKA 4CEHA 1A4RA 3B78A 1U8YA 1E1QD 3TK1A 2VPPA 2V4ZA 3K53A 1KJYA 3TAUA 4ESVA 1U8AA 2DHRA 3R7WA 1NKSA 1XCMA 2QP3A 4G01B 2IUTA 2G1JA 4DLVA 4Q1AA 4ZDJA 2GVDC 4LUCA 1GIAA 2J87A 2ZI4A 3BD9A 4DSTA 1FNNA 1QZXA 4LJ4A 4C0AC 1ZBDA 3VR4A 1MOZA 2C5LA 3BAFA 2ZRFA 3GJ8A 5FOSA 4RD2A 2V9PA 5HR5A 2WKPA 4NTZA 5E95A 3GCGA 4M8NE 4MH0R 3SQXA 1VCOA 4DCNA 1U9IA 4C0HA 5IF9A 4HLUA 4POAA 3AVYA 4WAUA 3UXMA 1EFUA 4BECA 4F92B 4B76A 3DDCA 4LC0A 2P5TB 4LOAA 1Q1ZA 5G53C 3VFDA 1M6NA 5HE8A 1YZQA 2F9MA 3TMKA 3FWYA 4W5HA 5EZ5A 4YQFA 3EPJA 3CKLA 1BS1A 2PEYA 3MLEA 1GILA 1TF7A 4HZUA 1KO1A 2BMFA 2YOGA 1H8EA 2R9VA 4M1KA 4JLDA 1IOZA 2KI5A 1KOFA 1ZP6A 2WMOB 4G1UC 1OT3A 4D25A 1KI6A 1VG1A 3C14C 1CJTC 4IHQA 3CNNA 1Q22A 5LBIA 3WXMA 1HEIA 4BRUA 1KJWA 2AFIE 2FN4A 3THYB 1TUIA 1ANKA 4US0R 3M0EA 5AR1A 1A2BA 3L0SA 4KBGA 2BM0A 4NYJQ 5DIFA 5EP1A 4JLMA 5FR1A 5ELXA 3N5CA 1UAAA 3A8TA 4HB3A 2EFDB 4MUAA 4B3FX 2UKDA 3KXIA 4KLZA 3U3OA 4MYUA 5BXQC 1L7VC 1C1YA 3BOSA 4OHWA 1B23P 1P60A 1GRRA 4P4UA 1BOFA 4RD1A 3X2SA 4A1FA 1OIVA 4OQFA 5BN4A 2LCFA 5FOXA 3LH5A 5AUOB 2QNRA 3BK7A 4YDHB 3GLFB 4PC2A 1NBMA 3OEHA 3HP1A 2ZJ8A 5KO2A 1CJUC 1NLYA 2OCAA 1GRNA 2PT7A 2JATA 1T3SA 1D2MA 3WYAA 2J0VA 3AQ4A 3FFBA 2IA5A 3KDSE 4AC9A 4ZCIA 2BJWA 4GDFA 5C4GB 1GP2A 1IONA 2ZI6A 1BMFD 1OXXK 3QPWA 3B1YA 2ZVQX 1FFHA 2VIIA 1QG2A 1U99A 1TAGA 2CL0X 1II9A 2F3TA 3ND8A 2FWRA 4L9WA 1NN0A 4UJ3A 2AK2A 2YV5A 2BMEA 5FL3A 1T0JB 3HPQA 2ZEJA 2FZ4A 3G5UA 3I8SA 4KXFB 1RRCA 4DSUA 1NG9A 3K0CA 4OHVA 4YMTA 1P3JA 5AUQA 1KDTA 2KJQA 1KKMA 1LW7A 2NO9A 2JJ8A 1B0UA 2G9NA 4M1WA 3TVTA 4HAZA 4MKIA 1ZIPA 2GNOA 4PQYA 2FZLA 4E5UA 2WKRA 3CH5A 1G3QA 1NMZA 1F3OA 1P75A 1Z0IA 1CJKC 3CUEF 3QJYA 1Q20A 4HLQB 1W44A 2F7SA 3F0TA 3FKSA 3NBYC 4KV9A 4GL2A 1KK0A 2YC4C 1QG4A 2F9LA 4B73A 1W7AA 3B6EA 1E79D 2FMXA 1FUUA 2WOOA 4PC3A 3U6BA 3CF0A 2QAJA 1RRGA 2ZU0C 2ZJ5A 3LFUA 3QPVA 5IHPA 4Q4JA 3UATA 5JECA 3P4YA 1E2EA 1IM2A 4KCGA 5JWHA 4CVNA 1WB9A 4D2IA 5FUXA 2OLKA 1KI6B 1G8GA 1RYFA 4EPWA 4CT5A 4LPSA 4OK3A 3RS3A 2V54A 3TVDA 3SYKA 1FX0B 2ZE6A 3CLVA 3LRPA 1GITA 5JS7A 5HKKD 1AS3A 1GAJA 1JJVA 2WIAA 4ZCMA 1X6VA 3ECCA 2EFGA 1IQPA 5EP3A 1KZGB 4RD4A 1KO5A 2QU8A 4V0NA 2C03A 4HDQB 1M1YE 2HCBA 4LJYA 5F2EA 2FJUA 4NL4H 4BZQA 3QY0A 3CNOA 3SYNA 1JEDA 4BFYA 2XSZD 3U3RA 1XPOA 4QJ4A 1K8RA 5CB6A 1XTKA 4O2RA 2A5GA 2V7QD 3HYTA 4OJQA 4TL7A 3MSXA 3MWLA 2VRWA 4TLCA 5F9FA 1T91A 2QI9C 2REOA 2RGNA 3VNUA 3PQCA 2ZR9A 4JLNA 3QI2A 1NL3A 1PLLA 4LJ5A 1KMHA 1FMLA 4TMTA 3QF4A 3QSYA 4HSEA 4NCHA 1XJQA 3PEVA 4HYYA 2CHQA 1YVDA 121PA 1PLJA 2NZ8A 1ZM3A 4N3NA 1XX6A 4JL8A 4TLEA 5EE5B 3U7HB 2REXB 1N0UA 4G5SA 2JDIA 3NBZC 1Z28A 1II8A 2GXUA 4LY6A 2WOJA 4PXAA 1UBCA 4PQRA 2GCOB 2GJSA 3LX8A 3LV8A 3LXRA 4FXPA 4HUTA 1X1RA 1AQYA 5DHAA 5CDFA 3ZVNA 4DIEA 4MRRA 2A5JA 3QKTA 2IYXA 4RJLA 3I4LA 1XXHB 1NVXQ 2QPTA 4LV8B 3W8RA 1HQCA 4AURA 2VHQA 1OH7A 2QG6A 4QBIA 3VHLB 5IT5A 1DO0A 1SXJE 2O0JA 1KO8A 1WQ1R 3V4RA 2QTVB 2EWWA 2YINC 3NH9A 4IVPA 2AN9A 3PCRB 5FTKA 4X8OA 4B2IA 1G18A 1FP7A 4D6PA 3B1VA 2EW1A 1M8PA 2BVNA 3P32A 4NU0A 1ZRHA 2RGGA 1IN7A 2CJWA 2F43A 1U94A 5FBLB 5KHOC 3FGNA 1S3GA 4AD8A 2W6JD 3SN6A 4ARZA 4Q4AA 3WNCA 3VR5A 4I1SA 4IDNA 5DN6A 1YU9A 2D74A 4WZBE 3AVQA 1HT2E 3E2IA 3AVXA 2H1LA 3U3JA 2ORVA 2A7QA 1K6MA 2HDNB 5DYIA 1R5NA 5JHGB 4OI0A 2Z5FA 5JZVA 3DOFA 2CHVA 2GILA 3TSOA 2R6DA 3GLGA 2WJJA 4E07A 1TQ4A 1D2EA 5CYPA 1VCMA 1JI0A 3V4FA 3ZS9A 5FPSA 2RCNA 3PUZA 5FBRB 1XB2A 3LD9A 1R4AA 5JJIA 2P2LA 1SXJD 4D81A 2Z4SA 4BLPA 4NMMA 4BZPA 4UXHA 4I1OA 4MKFA 2B8WA 2GEVA 3ZIAD 2ZYUX 4TT3A 3AVOA 3WBJA 2OFOA 4KYIB 1NN3A 4GP7A 5KSYA 2IEYA 4B3BA 1XPUA 4G5QA 1N6IA 1SXJB 1NF3A 1UADA 3TE6A 2AR7A 2QMUA 2W0SA 1CR2A 1OJLA 4R98A 1L8QA 1RRFA 3AP1A 3DVLA 4LBWA 2ASEA 1XEXB 4PC1A 2W6JA 3QF4B 5G41A 5FPYA 3A36A 3VAAA 1N6HA 3LXXA 4GBMA 4TTRA 4F7WA 4LWZA 3FHOA 5CITA 2JAQA 4A15A 4HDOB 1H8ED 4EUNA 1XEWY 1D2NA 3LX5A 1KSFX 2LKDA 3GFTA 2Q9CA 1PV4A 2QGNA 3KQKA 3EW9A 1DPFA 5B2ZA 1FX0A 3ZD6A 4U7DA 2GETA 1BH2A 4B3GA 5KTYA 1E2KA 2ZRAA 1PJRA 2RH5A 4FCWA 2FG5A 1EESA 3RSOA 3LLMA 1JEEA 2IS1A 4NKRA 1JR3E 4Z1MD 1OXSC 5B30A 1W2HA 2XXAB 1K5GA 1COWD 2OILA 3W3ZB 3VX4A 1T3HA 2A30A 2VP4A 2I1VB 4XWAA 4PAOA 4EJSB 1P2UA 2CE7A 2XB4A 3CX8A 1Z0AA 5CJPA 4A0GA 4ITRC 4EFNA 1UKZA 1BYIA 4KHZA 3EIEA 2RHDA 4PPFA 4JLOA 1AKYA 3KZ1E 3UMFA 2BJVA 2OCBA 2HYDA 3HJNA 2FPMA 2QQEA 4KITB 1FZQA 2UZ3A 2QAGA 3QF7A 5UKDA 1S4QA 3R8CA 4EFLA 5KUTA 2B7CA 4YXWD 1GM5A 3KKPA 2AD5A 4M0LA 4DT1B 2VF7A 4A2PA 1Z08A 4DLUA 1E1QA 2CLDX 2Z6VA 1XJ0A 4FN5A 2IEZA 1E2IA 2XTZA 4PANA 1E1RA 5J4VA 1TF5A 3NHBA 4FI3C 4YMSA 1E0KA 2QTHA 4AKEA 2PJRA 1NMYA 5AJVB 1RC8A 1OE0A 3NH6A 5CIQA 2VHTA 3QXHA 1FQKA 1W36B 1UFQA 2FSGA 1DAGA 1DAHA 2FH5B 2NO7A 4Q01A 1GG2A 1DAMA 1XEWX 4GRAA 1V5WA 4MDEA 2P6RA 5G3YA 3AEZA 3L8ZA 3EAQA 4PAMA 2JJ2A 1S3SA 2EYQA
chains in the Genus database with same CATH superfamily
1ZFNA 1QIIA 4PIPA 5FOWA 1WULS 1NE7A 3DC7A 3OSUA 4PBTA 1EVLA 4JLJA 3L82B 3V7FA 4RPJA 5LP1A 3IELA 4Q93A 3SU8A 2W6NA 1KI7A 5FTWA 4AK9A 4EKIA 4D80A 3OKAA 1XQ9A 4DDTA 4ZAYA 2OBFA 3OIUA 2DH5A 5CJJA 4AU1A 1C1XB 4S35A 4WZ6A 3HBLA 2C04A 2PD6A 1VJTA 1NLUA 2BZGA 4YDSA 2R62A 2X0IA 4OX9Y 2O2SA 3KR0A 3BRWD 3LZDA 4PNEA 3R7BA 1LJUA 4IM7A 1U7DA 4K0RA 4WFKA 1H1LA 4IIBA 3W2GA 1Z5GA 1BJKA 5DT9A 1HFWA 1GTG1 1VE7A 3ANNA 3E81A 2GF2A 3GA0A 5FUWA 3ZWNA 3CLUD 5CT8A 4UM9B 1P0CA 2XVZA 3I5UA 4PQFA 1H0KA 1B73A 4I9GA 2UYHA 2B1GA 1RQLA 3F6SA 1YIOA 2HCFA 4V0KA 1DCMA 1H5QA 2I3DA 3PHCA 2JJQA 3USZA 4KG7A 5JNUA 2DB3A 1QU3A 1Y4DE 3DGFC 3FGZA 3RT7A 4HV4A 3OAAD 4LAFA 5KYUA 4X6LA 3FF4A 3FJOA 2FFAA 2O14A 3LT5A 2AX4A 4F38A 3U7QA 5DZSA 1DC7A 2ZITA 3Q6MA 4BC1A 4GR4A 2OK8A 1J2TA 2H00A 3PUKA 3WVNA 3X1YA 3OI7A 2WZBA 2XHEA 3AEKA 5B55A 2HAEA 2J7PD 2WM3A 2GKOA 3HA2A 2J4DA 3JQFC 3MJCA 3AYXB 5FBZA 2WFLB 5GJWC 3FPEA 4ND4A 4OYHA 2WM8A 3RHTA 4N3AA 5HF5A 3ITDA 4KTTE 2PFGA 5EIXA 1K9SA 5JEDA 1TKAA 4LY0A 5IBRA 1J33A 1FUEA 3FW1A 1DRVA 5F64A 5AVJA 5B3AA 4PLVA 2AXPA 2HHAA 1YTUA 2AW3A 1YKFA 1X19A 2P2YA 4B1FA 4BO3A 2OZPA 5JYDA 3DVQX 4CG3A 2FW0A 1ISSA 1NW8A 4DDVA 5K8CA 1A9XB 3G2MA 1MH1A 2WBLC 4QG3A 4L4RA 4EX6A 4H4EA 2YXNA 1CUAA 3HLKA 3IBYA 4AJ1A 3PFFA 3VZCA 1X94A 2Q2QA 1UOEA 2AOUA 2GO7A 2I67A 5SY4A 3VVCA 5G1NA 5J59A 3EG9A 4DWWA 5B57C 5A3RA 5AKKA 3HYSA 1LWNA 1QYRA 3AIMA 4J75A 7ABPA 1YRBA 4NJEA 1NYRA 3ASZA 1D9XA 1HL7A 3KJIA 2VATA 1JSRA 1UBHS 2QE7A 4YJHA 4J16A 3DEIA 4DLNA 4PLYA 1MC4A 2WG1A 4V1CB 4F9FA 4JQYA 2TS1A 2VJDA 1N5LA 5HJ2A 3OFSA 1XZDA 2VJQA 3WL6A 3WK5A 5E7MA 4B83A 2ATVA 1XD2B 5J2UF 5EN4A 4DCVA 1DARA 1LY1A 5AVQA 4G1FA 3GT4A 1Z0KA 2E7ZA 1SBQA 2CFSA 4I5DA 1SURA 3AERA 5CLLA 4BNVA 4XAQA 1OFHA 3FOCA 3BJZA 4JBLA 1KIFA 4IJQA 4YALA 2YY5A 3CRQA 5C8XA 2CVZA 1E89A 2IEBA 4ZIRA 3HS3A 1L1RA 2HEIA 1K08A 3DV0B 3PC8A 3UJ9A 4WN9A 1DIGA 3R09A 4XIFA 2N1MA 2W5UA 3M3HA 2X8JB 3QKRB 1UBFA 1SELA 3D31A 1N1GA 3LU1A 4LYFA 3SYTA 3ZK7A 2P68A 2YN0A 4EL0A 4EVRA 1DQNA 3PNQA 2P2CA 2Q4DA 2WUGA 3C24A 1RVV1 2DLDA 2R7MA 1YBVA 3T3EA 3FOEC 4KMOA 4JYAB 5C7OO 1ZVMA 1CYDA 3QVTA 4I36A 1JG7A 4FFDA 1KJZA 4YQEA 2IIQA 4Y98A 3TOXA 4JV5B 2C0CA 1NNEA 2CL6X 1YUMA 2CDBA 2XMSA 2YHIB 3BMQB 4QELA 3WLAA 3ZCRA 1VZ3A 1GZ3A 4XQ0A 3R9WA 1KQPA 4BFTA 4DF3A 1XOIA 2WP8J 5AI0A 3PEWA 3AKEA 2FMIA 3H4VA 5EJGA 2WABA 4LGYA 3H05A 3D8UA 3TUZC 3F90A 3PU6A 5EZYB 3FOAA 4UUMA 2JLVA 3OE7A 3FMFA 1ZD3A 2X9VA 3RGGA 2JHPA 1H5UA 1GUBA 5ERXA 1AXRA 1REQB 1X7YA 3OTWA 1NJ5A 1X7HA 2PH7A 2GT1A 2YV1A 4M0CA 1AQLA 4ROTA 4BFWA 2PUFA 1Z62A 4R1QA 3TDMA 3KETA 1UKEA 2PWYA 4ARCA 3LXUX 3PRYA 1QKKA 1GADO 4JFRA 1L7BA 4IZOA 4XOIA 1CC1S 4KX3A 1LPAB 3HXOA 1TKRA 3MJTA 2R8YA 4MICA 4TMVA 2UZ1A 5CVDA 4DB2A 1E0SA 4WLEA 3RTGA 4ZVOA 2ZKIA 3VHRA 1HI9A 2Q1UA 3IOBA 3KD2A 4EO4A 4OKSA 2GZAA 3KE8A 4MVJI 4RW0A 5DHUA 4Q4JB 5IAGA 1AU9A 3FYUB 2NV0A 1GXSB 5BSRA 1Z2PX 1R6DA 2GBPA 4GWLA 1J6UA 4QRDA 4A4DA 4D4MA 3U39A 1R9NA 2IJGX 3ZV4A 4IICA 4H18A 2R2GA 3EA0A 1XIVA 1SU4A 2XMQA 2YWXA 3AVPA 1M2NA 3INTA 4MI3A 5ALKA 2EFEB 3G0IA 4BX2A 2WVAA 5K1ZA 1X7DA 2XIJA 4HWOA 2AN5A 4RPKA 1XDZA 2C4NA 5ED0A 5EWMA 4YREA 2PMBA 4YCNA 2P2DA 1HY3A 1H6CA 2V3WA 3PG5A 1WLYA 1SBNE 3QI7A 1N2CA 1T1IA 3AWIA 1O0BA 3RHZA 3ZQUA 1TQ6A 4JC8A 4CEJB 2ZJYA 4B17A 5DN6D 1GO2A 5EE0A 5JSZA 3GFRA 1E2HA 5H8WA 3UBTA 1Z6TA 1TJPB 1VE6A 5I7UA 3TE7A 4IGAA 4BTVA 4WNAA 1X1AA 3PNMA 2LWIA 2OZEA 3PC6A 4YBRA 5HK9A 3BXHA 4AKGA 1V11B 5K09A 2P6NA 4D26A 1OROA 3QUQA 5AVVA 3P7MA 3MGKA 4BX9A 2BEUB 3F3KA 5F51A 3GPIA 1N6PA 2DY0A 1YNSA 3RC2A 4X66B 1N9GB 1P19A 3U7GA 1NPYA 3DYIA 3IDFA 1BW9A 3JWHA 1A8SA 3DF9A 4KNVA 2JA1A 2BF4A 3W6OA 1H3NA 4DWJA 2BKAA 2E6KA 1B2LA 3KVYA 2MHCA 3ZY3A 3UJCA 4FW9A 2YYZA 1ISFA 3NP9A 4J0DA 3LUJA 3TL2A 2QJRA 1XTVA 3KSRA 2IVZA 3ZIAA 5CDFE 5IYZA 5KTTA 2FZKA 2HDHA 1N7IA 3RSZA 4AG3A 2Q2WA 2WIJA 4BVBA 2BKUA 4LF6B 1UK9A 3IQXA 2OCGA 2J08A 3PGJA 2WWVD 2HLNA 4OQZA 1V1MB 2ZRDA 3S2SA 4KQJA 4AF7A 4F4FA 3ZJTA 2VDOB 2FEPA 1S9HA 5GZ3A 4IEEA 4NVRA 3MYRA 2XA9A 2WFAA 2Y71A 3BIJA 3KUKA 1L5YA 1IZ7A 3ZQ6A 3COYA 2QUZA 3D6UA 3QPUA 4US2R 4ISBA 4Z51A 3RRZA 1MJGA 1PR5A 1G3MA 1JKJB 5A4KA 1M6VB 2GZ3A 3FNGA 2V5UA 1TPYA 3AT1A 4LGMA 3B53X 3LQFA 4NBWA 3JQBA 2ODTX 5FUBA 5HIAA 2IODA 3L01A 3R6WA 2WY2D 3IP1A 2PLFA 4X84A 5ULLA 1Y9EA 3ZIUA 1OI3A 1QHIA 4CCAA 2W2MA 1VPTA 1O6FA 2HSDA 5EMJA 2BZ1A 2PKEA 4TWZA 1UMBB 2FE1A 1B6RA 3HKCA 1SBHA 1MIHA 4ESHA 4FLEA 3RC8A 2CF5A 2NO5A 1YBFA 2FUKA 3BULA 3COZA 3IVCA 4MV5A 1R66A 1XZ8A 2WTBA 2DWQA 1N2GA 4G86A 3FDIA 3H8JA 4J3FA 4QJ5A 4EY3A 3WGGA 4K46A 3KUDA 2XTNA 4B4VA 3P5BA 5KCMA 1CJCA 1YS7A 4QYMA 4WGGA 3F5SA 3SC2A 4A0FA 5AKXA 5FNVF 1EK2A 3N8HA 1K6IA 2PX3A 1E6MA 1G66A 4Z1OA 2E4WA 3ACCA 4QTUB 1RJWA 3L4BA 3B1FA 1U5CA 3E9NA 1HDRA 1I36A 2WWYA 3R8FA 4IUYA 5AHXA 1CZLA 3BBPA 4KXWA 4M8SA 4O2BB 4EYQA 1PQPA 4NX2A 3T5TA 3RF6A 3D6VA 2XW6A 3CXRA 4UAJA 3LK7A 1L6IA 4HHEA 3VHXA 1UBLS 2AD1A 4NH0A 2G5TA 3K0KA 3ZTWA 3DFMA 4OFXA 4AWAA 2IIPA 1IOWA 2F62A 5CDGA 2HD4A 1I7LA 2HY7A 1MFPA 1ZHFA 2H4YA 2XJ9A 3FRJA 2OEPA 4MYSA 5ILQA 1B8PA 1LLCA 3GLSA 3SEAA 1G9SA 2JRCA 1EAMA 2CVFA 4XYGA 3DCIA 3M6LA 3UHOA 1BXKA 3IAUA 2WWHA 4IDDA 3FBTA 3MA0A 3IUPA 2QSYA 1P2TA 1JH8A 4FZJA 4ED9A 5CLQA 3AO0B 4QYXA 1A5AB 5LM3A 3IIIA 3LJKA 5DI3A 3TSAA 2OCPA 4HDAA 4TT8A 3QXSA 1PT5A 1JKXA 4OA8A 4AYXA 4MIKA 2VTVA 5AD1A 4K05A 2UUPA 4BBAA 3O1JC 3SFZA 3RI3A 1RAIA 4EB8A 2XBLA 1QNFA 3EJWA 3VR2D 1KJ8A 4N18A 4J0QA 1H2XA 1NYLA 1BX0A 3NIBA 5K4AA 4BP1A 1VXRA 1YWGO 4I99A 2I62A 3D59A 4YJ2F 1G8YA 1GU7A 2I2WA 3NBAA 1MO5A 4ER7A 5H82A 1SXJC 3JD3A 4JWKA 2ENWA 1PS9A 2C96A 2ZCVA 4IV8A 1Q16A 4ENQA 3SVLA 1VYVA 3EXAA 5TT1A 3QVMA 1L7AA 4BEVA 1L7QA 3X1MA 3FCOA 1TMGE 1YBAA 3LW8A 2CHGA 4L5CA 1UOOA 3ROXA 3HNOA 1RQRA 4JL5A 5A9SB 3PKJA 4LYYA 4Q1CA 1TEXA 1YKSA 5GINE 4H31A 3CVUA 1W88B 1SKYE 4D9EA 4W5TA 1BZYA 3EXG1 3GGGA 3U4DA 1QBGA 1L4EA 3OT1A 2HKIA 5IKOA 1GNSA 1I4OA 3C8ZA 3MINA 4HQNA 3WMGA 3H5RA 5JI3E 4I19A 4ND8B 5KJCA 4BB5A 3O7WA 4J76A 5ALOA 2PD4A 5KYYB 3KFVA 3MPUA 1RYZA 2A5DA 5G4KA 3CHYA 4M9SA 3I1JA 3IHWA 3UMMA 3AG5A 3DP9A 1H93A 4D4LA 3PWTA 5AXBA 1QGED 3WZMA 3M9WA 4LMAA 4UBIA 4Z0TA 5IK2D 1RFGE 3I83A 3PQ4A 1ZH0A 4C2BA 4ZKDA 3BFVA 4PBSA 3U6KA 4JITA 4CM9A 4XWKA 4MK4A 3CNBA 1F4LA 1DIHA 1YUBA 1DQSA 2GEFA 3MRSA 5CM9C 4P08A 3EODA 3GCDA 1NF8A 5LZ5A 1QWOA 4ROSA 5CA1F 4IDCA 1PR4A 1EXDA 1KHHA 2JKVA 3FGOA 1E1LA 3K1ZA 1GZDA 2EEZA 1JHOA 1P8AA 1E5XA 1UBUS 2AWOA 4RGVA 1F2TB 2JIMA 2PU7A 2Z57A 4MQ5A 1EX7A 4MW0A 5F35A 3AONB 3S1AB 1XMQB 1HYQA 4C20A 3U4QA 3CN7A 1MX1A 1M2VA 3S5JA 4PLPA 3IKVA 1SCBA 2HCJB 4DMRA 1C4XA 2O2ZA 4R51A 4UBJA 2M6LA 5TEWA 5JSUA 3C0KA 1Y81A 2AH5A 1Z7YA 2ZWIA 1A82A 2ROQA 4AZ3B 4H15A 5DGTA 4RPLA 4Q6WA 2Z2ZA 1PKEA 1TMOA 3ENQA 3MT0A 3L0BA 1BFDA 5EPEA 1WHSB 2BKXA 4BV9A 3VV2A 3H5TA 4FGJA 2WJWA 4RC9A 1JEYA 1FEZA 2VPXA 1PV2A 3C4QA 3LCRA 4JEUA 2AJDA 4PIMA 2WT4A 3AZQA 3M3DA 1UPXA 3I2HA 1FU8A 5KPDA 1SUAA 4G1MB 4IIFA 1GUYA 4D3SA 4HP8A 1EI9A 1MO6A 3G8YA 5CBKA 4JR2A 2YFYA 4I50A 5CFLA 1U7XA 1AHIA 3U56A 2PPLA 1KO7A 2CBZA 2VDKB 1G21B 4UNPA 1SVIA 3ICCA 3MN1A 3WL8A 3QELA 1RXSA 2MWMA 2A1UA 2XIQA 1P74A 2XXBA 2WINI 3HA3A 3IDQA 5BY2A 1ZJZA 3PJFA 2PXAA 3O73A 5IEBA 1EGVB 1MCZA 2UV8A 4OQXA 3C7TA 2WUFA 4JX9A 1U9ZA 1SVSA 2VF4X 1ZY2A 3PBKA 3QUSA 1A8HA 1BMQA 1QQ5A 1RKVA 3VO8A 1YRQA 5FADA 2NT3A 3MC1A 1JG4A 4KKVA 4J91A 2C3UA 4IH1A 4RZXA 2WTUA 2P0EA 4QJ3A 2ZAYA 3Q8KA 1B41A 4RUKA 5SYNA 1ADGA 4EG7A 2WWTA 3AW8A 4U2GA 4DVGA 4LMBA 1FDOA 2X2PA 1KR5A 1A98A 3L9XA 4EM6A 4GUAA 4ZOAA 4CEHB 5A9TA 3ON5A 3ZDCA 3SHOA 2PUHA 2QYTA 1A1VA 3BMCA 4BNLA 4JQZA 3PR3A 4GM4A 4EJ6A 4IO1A 1L3BA 3HVHA 4BYGA 2C9YA 1ZM4A 1QGOA 3IAFA 1WXIA 4YDQA 3IUMA 1E6CA 4MRMA 1BO6A 3OLVA 4CF7A 1W25A 1KFJB 2CKDA 3GGDA 3R77A 4XJSA 4I0WB 4MS1A 5A0FA 3H13A 1SUDA 1TL7C 1VDZA 3BQ9A 3ACBA 3CRW1 4TMZA 3LG2A 5C8ZA 4COKA 4DPLA 2XKJE 4XSVA 1ZHHA 2IQIA 3BD8A 2QVZX 4KFCA 1CUVA 4N8EA 5ELMA 1ULBA 3D5QA 1PJTA 2RHRA 4FYPA 4WLFA 5IM5A 1ULTA 3A3PA 5SYMA 1YR3A 5T4HA 5BV7A 1Z13A 4MUEA 4B7XA 4EQ6B 3SD7A 1KFBB 3A9SA 3ZGYA 3EEOA 3SPXA 3C6BA 4K26A 3ICVA 4YH1A 4CTOA 1QAMA 1F0PA 1KH1A 5AQEA 5GVRA 5A4JA 2P9BA 3KB2A 4CF5A 4MPPA 3SCZA 4N49A 3W4IA 2BPOA 3FSEA 2CZCA 4DA8A 1SU6A 4BAUA 3CQ9A 4NYJR 2X4LA 3MJRA 5K05A 2G1KA 2V1UA 4C22A 5JADA 2H1VA 3MTAA 5I7EA 1L5RA 2FJ0A 1YZVA 2FVYA 4O4IA 1NKVA 2P75A 1N34B 1J0XO 3H5IA 5I7RA 3AOEC 3O6VA 2JZCA 3KZCA 4REQB 1K2VN 2BH9A 5DK6A 2NU8A 3JQ9C 5JAMA 4Y0AA 3N7AA 4DV2B 3P9RA 4EW6A 1QANA 2PRYA 3FLBA 1J5PA 5FBHA 1KEEB 1IPFA 1RXYA 3TUIC 3AF2A 3R6GA 2G72A 3TD9A 1QHHB 1RAFA 4ZI3A 3FTFA 4BWYA 1RWMA 3GUVA 4EW1A 3LX6A 1V48A 1W5TA 3UAXA 3BICA 2WG0A 3GJZA 4L8VA 4TYYA 1NRIA 3TS1A 5IJ9A 5TEVA 1WUYA 4EG4A 4J4HA 4FM9A 2AQKA 1PZMA 2QD2A 3AJRA 4HLDA 3NVMB 4QUDA 4C5AA 5KNBH 1CEXA 4Q3NA 5ECDA 4M9CA 4V1CI 2PZEA 1GGJA 5B37A 1DKMA 4L8YA 1WKVA 2O3RA 4QIHA 1X77A 4XVUA 3NTUA 2IOFK 3DDUA 3AM4A 3EAFA 4FZVA 5KOIA 3VJMA 2Z8XA 1XD8A 1E2GA 2HMSA 4ZQHA 1WXGA 1SXHA 1YS4A 1JDPA 2PH1A 4L8LA 5ERYA 3N39C 5DH9A 5BORA 3DULA 3TEMA 7GPBA 3F6RA 1Z33A 2BFEA 4FNMA 2AN3A 1PDOA 2IZ5A 1BKSB 1UMCA 2P6OA 3I9OA 3M83A 4KXVA 4LY9A 4WA7A 2FGJA 1G2PA 1X7GA 2CMGA 2WUVA 3DFUA 2ZUWA 4KDFA 3WIOA 1XG5A 4AO6A 2LNDA 3RFTA 3ZS8A 3UAZA 2W2KB 3WJ7A 1MORA 1O95C 2GXSA 4JT4A 3BDVA 2C29D 1YR1A 4ZVRA 3WJ2A 1DKPA 1GFZA 1SA0A 4B4OA 3IDZA 2XRZA 4HMOA 3U13A 4BEJA 3L7KA 2O8CB 4IPTA 3LS2A 2GAFA 4HDMA 1N4DA 2V6JA 2YQ5A 3B9PA 5LQAA 1O9GA 3IP3A 4DLXA 1PNTA 2BUCA 4AS3A 4CMIA 1ZJ5A 3W6NA 2IIBA 5HKOA 2ZYWX 1F6BA 4EJMA 5K6RA 4IIEA 1ZCZA 2WT8A 1U65A 1NVEA 2FW1A 1NLFA 4X7RA 2QIPA 1YIDA 1MBZA 3ZGZA 1ZH4A 2PZFA 5EMKA 1JL3A 5BSWA 1M1UA 8ADHA 1ZUNB 2C4MA 4W7SA 3VSAA 2XOKD 1HDOA 1X80A 1Q91A 5HIKA 4KAXA 4URXR 5A0VA 2C3MA 3RVDA 3E82A 4C76A 5JLJA 3AR6A 4A16A 2NYAA 4RADA 3P19A 4S1OA 3IBCA 4BMPB 3AFOA 3CSDA 2BM1A 2BR3A 1FXWA 2C5SA 2C7QA 2V1XA 4WEQA 3QOXA 1C4WA 2D0DA 4BLQA 3JCZA 2NUAA 3BIOA 1COWA 4DRZA 1AXGA 2BCEA 2X1HA 3BJRA 3DR3A 5FTJA 4GX5A 2WTMA 3BMCB 3JWJA 3WL5A 3R9KA 5BVGB 3ZJUA 3UHJA 3I5AA 1Z2OX 3PL1A 1V6SA 4PG6A 4FUQA 1QP8A 5DO9A 3BK1A 4XKJA 1RKXA 5DIZA 4P58A 1SOMA 4I3HA 4D8XA 3KQMA 3E3OA 1RJFA 1XL0A 1RZVA 3EUFA 1T6ZA 3L5OA 3NEJA 3Q9SA 4P82A 3WNQA 3I4FA 3WSWA 4CHGA 4JJZA 3K2EA 3O5AA 4ZEMA 5JW6A 3A1EA 3W9SA 2IYVA 1QH8A 2HQBA 3W5HA 5AOVA 1BE1A 1B6TA 3T38A 1P5HA 3F5FA 4IZIA 3B1ZA 1UT6A 2Q62A 3QEOA 1QZTA 4O08A 5AVKA 3HBMA 2WHEA 4XFKA 5BNZA 1QE5A 3W77A 5JROA 1HM5A 1U4SA 1A04A 1NVWQ 2XZPA 4C4OA 4IV0A 3AUFA 5J1TB 1CHNA 4GVLA 3MTEA 1DJPA 5EMMA 3HKBA 2JGEA 4ZYWA 3VNAA 5F76A 5TNXA 1XTPA 1Q83A 2YH2A 3A1FA 4P7BA 2GM5A 1CY0A 4WQMA 4HQOA 1UKCA 2FWBA 3UV6A 3TLZA 2LZ0A 3D0KA 4X92A 1GZ5A 1AHNA 2NU8B 1C7RA 2XQKA 1SVLA 2VP5A 2RH4A 3AI1A 3HFJA 4DLAA 5JD6A 1K63A 4KDEA 3UOWA 1ADJA 1FFEA 1K27A 3LCJA 4ON9A 2JI9A 3NTVA 3NHPA 3PUWA 2ZTHA 1IBRA 4KJXA 1CDDA 3KR1A 4FINA 1PSZA 3A4IA 1J22A 2Y93A 1VLJA 4QFMA 1Z5WA 3WWDA 4BQFA 1KZ4A 1VB5A 4KLCA 1GQSA 3LCUA 4PZZA 4WJKB 2VF8A 5EIOA 1W48A 4Q47A 4P4SA 3HP4A 4Z5XA 2HM7A 1ECPA 4GH5A 5B58T 4DAOA 4UXJA 3R7LA 3CSSA 2P4UA 1XMJA 2YJ3A 3SZRA 4N40A 1UBJS 4ZQCB 3E9EA 1SU8A 2WVHA 1PK8A 3DBOB 5ADUS 4CL2A 5D85A 1I7NA 2CZGA 3ANLA 2FGKA 4TYWA 4LSWA 4I55F 2J41A 4MA4A 1FJXA 4MVXA 4CCSA 2EL9A 1XWWA 2HCTA 1ABFA 2JFGA 1OW3B 3BA1A 3QWHA 3BEDA 2DUNA 2G1AA 3TZCA 1QHYA 3DPIA 5LQRA 1ZUIA 1Q7RA 3F2IA 1L5SA 4R2HA 1M75A 1XJCA 2R2AA 4TV8F 3IVXA 4EABA 4MI1A 3GVIA 5IARA 2IX3A 3AHFA 2R44A 4W7HA 1F8UA 5D1HA 2RB4A 2YMLA 3A6JA 4KYVA 4NBTA 1KI9A 3QHQA 4KQMA 1NUHA 1GN8A 2QD3A 4AIRA 2QPAA 3DV2A 4QDTA 4QFCA 5TPZD 1NLMA 1CB0A 1LV7A 3E5RA 3QFHA 3T95A 3ZXXA 1E2JA 4C07A 1Q0ZA 1KP3A 4EPRA 2CYBA 2NPOA 2ZUFA 1PZFA 3D0OA 1T8SA 5CP8A 2LXNA 1WM1A 4J43A 2DPHA 2FWJA 2LV8A 2Q1TA 2ZU6A 2P27A 1TK9A 3M4XA 3QXGA 2YMPA 4FQ7A 4FS8A 4ND1A 1YCHA 4GXRA 3URMA 2HIHA 2G0TA 3FMIA 1E59A 4QX6A 1NN5A 4JODA 3VR3D 1UBSB 4E51A 5JDCC 1VPVA 3RR2A 1G2OA 3AR3A 4PPGA 2FR8A 5EC8A 2WJHA 3V8QA 1TC2A 4YRSA 3SJAA 1JFFA 4WMLA 4RSGA 3PIIA 2VNAA 5LD2C 3PC7A 1N6OA 1NVFA 1CFJA 1AURA 3LBHA 1Q1GA 4RVOA 5BUQA 1U7HA 3KLOA 2DE0X 2JFNA 4UEKA 5D3ZA 4PONA 4C7OB 3GOQA 4O3FA 1MAVA 3EGCA 6YASA 1SZCA 4ENWA 2FFQA 4QATA 1QG0A 3NTOA 1VPEA 3E2PA 3QUAA 2O07A 3LAWA 2XB6A 5A4MS 3X1WA 3FOBA 4KO4S 2HMVA 2IXGA 5EHIA 5AK4A 3I5YA 2L82A 3ELYA 4H17A 4IMJB 4R7GA 4G0ZA 2ZPAA 1T25A 5K3FB 3QNUA 2VN8A 1E3DA 5C8YB 4XWWA 1Q14A 2VHCA 2JAUA 1CRLA 2C83A 3GJ3A 4CM5A 5DRYA 4UFPA 2YCBA 3I8OA 1G5PA 1YR7A 3HCCA 5D5PA 2A9RA 4V0SA 5FL7D 5ALYA 3RUDA 4ZCTA 1Y42X 1E6EA 3FTDA 5IU6A 1EB8A 3MINB 6LDHA 1VE9A 3WAKA 1EUCB 3O8CA 4OP2A 3K70D 3Q98A 1V6CA 2L18A 4K8RB 3CBQA 3I28A 2NZUG 3VTKA 5IWAB 2ZR0A 3NCTA 1U0GA 4P4GA 3L0OA 4D9KA 3R7AA 3EGXA 4P3XA 4EHFA 2W2QA 1LPOA 3A4MA 3ZEIA 1JNXX 4NIMA 3CVVA 1JDSA 1XF9A 4BAZA 2JAPA 2I4RA 2GHTA 2ZRKA 3ISVA 1I1QB 1IRIA 1TYEB 1IN6A 4GT1A 1E2QA 2ZI7A 4MUGA 2AN1A 5I3CA 1F5NA 4LJLA 4QGHA 3EMKA 3FDZA 3ASYA 3TL3A 2WYVA 3WG9A 2AKAB 1YA8A 2VK2A 1O1YA 2QBYA 4M86A 1HDCA 1DHTA 1PGPA 4MW6A 1FCJA 2H1WA 3TRHA 5L7TA 4NCKA 4QM7A 4I1PA 4M6WA 4GOXA 4Z4EA 3QVVA 5DFAA 1ZX1A 2HT1A 2RH8A 1KEVA 1I2DA 4YHHB 3TPZA 1JN0A 2YVUA 3R4VA 1YB2A 4IMIB 3E9QA 4L4XA 3RDPA 5A02A 5EEGA 3F6PA 3DW3X 2MINA 3H5LA 4MA5A 4EOGA 4UDYX 1PBTA 13PKA 2ZDQA 4FVTA 3IE1A 1H69A 4INPA 4PW0A 4UREA 2YBEA 2UVDA 3CNLA 3FCUB 3ODGA 1ZLYA 5F2OA 1M8FA 2PV7A 2R3SA 4KPUA 4X95A 4MUFA 3AF6A 3HPRA 2NG1A 1N9GA 3REQA 2VJAA 4KAAA 5AI5A 4EJ0A 5TF4A 3ANMA 4IL5A 2PR2A 1Q5PA 2H1RA 4FR2A 4LZPA 1OC4A 3RS4A 4H6XA 2C2ZA 2QZZA 4CHTA 2P9FA 3ICPA 3NAQA 2JD1A 4QDZA 2EHJA 1PW7A 4MWGA 1ZCFA 2UVPA 4FT2A 2ZZMA 2XBUA 3S6JA 2DY1A 2ZJ2A 4N5IX 4E5YA 3NAMA 3N70A 1LFDB 1KZ9A 2N42A 3NP7A 2A9JA 3D2CA 3L1JA 4MO9A 3EZ2A 4V0RA 1R8XA 5TQ2A 1MABB 2D2EA 3HB9A 1G3UA 2DBRA 3KKKA 4HWRA 1R9GA 4FFRA 5HZKA 1ZU5A 3EDRA 3O38A 2V6IA 3KWLA 4FLFA 1BKYA 4PG4A 3EUEA 4C5BA 4LRTB 1JX6A 4KO3S 4YV1A 1N2HA 1IOLA 1THTA 4YMWA 1PDVA 3N86A 3TKLA 2OAP1 3FFAA 3USES 2HPHA 3HVIA 4IG9A 3WFIA 3ZD8A 4CKCB 3CRMA 2LP4Y 4H1TA 4RK4A 5BN1A 1MNQA 4BNGA 2IEGA 3QKRA 5LA6F 3L93A 4YXWA 4TM8A 4E4RA 3KTAA 1M1ZA 1SQFA 4RULA 1QFMA 3FUTA 1OHHD 4K9OA 4AKTA 4YY3B 2AQ8A 4XGQA 1Y6GA 2QLFA 2ATIA 3IA7A 1P0QA 2ZCUA 16PKA 1U7PA 1VLQA 2QEQA 3LUDA 2YVAA 4XFJA 2B8EA 4JMLA 5AI9A 4TKVB 4MDFA 1JU9A 1QUEA 2GN2A 4I4TB 2PYZA 2BC9A 1U9YA 2ECOA 2OLJA 2I71A 4RIHA 3P4UA 5CA0F 3ML1A 3KRTA 2GR9A 1GSAA 5CVEA 5A62A 3CG4A 5FTLA 5JPDA 2VYFA 4GGOA 4ZOQI 3UAOA 3JALB 3T7CA 1CUIA 3KZVA 4MMXB 2XNSA 1TX4B 2Q5QA 2VK8A 3ETHA 3KUCA 5THXA 1G0OA 1RP7A 3VVLA 3OOWA 1LGYA 3JQ8B 2ZJBA 3NKVA 3P2MA 3PXUA 2I4NA 3LQ2A 3SFTA 3G89A 2IY7A 4GFDA 3C7KA 3WMFA 5AW1A 3ESXA 3FFXA 3L7BA 3Q2IA 1PKXA 5EEHA 1PVOA 1TJ3A 1XMVA 1JHYA 1UMDA 3H0CA 3VKFA 4ND2A 3H2YA 3BS4A 1E2NA 2VDLB 2ZSHA 4DRXB 5CLFA 4OI1A 4GNKA 4C2TA 3EDYA 4FGUA 5GV8A 4EGQA 2Q29A 1B0ZA 1HC7A 1HV8A 1Y6ZA 2OV3A 2VSXA 3LYAA 3JAMA 3E23A 4G8JA 3E0QA 4BU0A 2XXJA 2HSWA 1VL1A 4PV7A 3EVBA 1WG8A 1ICEA 3BE8A 1H0RA 3FZYA 3IPYA 3VDXA 3DLCA 1EAYA 2VF5X 4TQ9A 4LCEA 2I2FA 2NU9B 5JJBA 3JSXA 5F5NA 3CY6A 2O8EB 1CKEA 2OHVA 3AUXA 2PKXA 3AY6A 4LX8A 4HFJA 1TU4A 4TSFA 5DLPA 5SZIA 2NWQA 3FB4A 1QP7A 4E2XA 1Z6QA 5ECWA 1JMYA 3SBEA 2EQBA 3L18A 2ZROA 3K5WA 1K68A 3TEJA 3AI2A 3OTQA 1XEXA 4QD3A 5LN1A 4UEWA 3DONA 4BVAA 5HFJA 1U6KA 2CLMB 4HNSA 4TL8A 5FFMA 3DMHA 1DT5A 3AUYA 2J6HA 3B5IA 3OIYA 4JSTA 2YJ4A 4NNPA 1UJBA 2RI0A 3VM6A 4F11A 1GL6A 2ARKA 2QQFA 5K01A 3ABRB 2G8LA 1NOKA 1ZL0A 1L1EA 1CQJA 3H16A 1PR9A 1R50A 2JI7A 2I55A 2W2LA 1QYCA 3ZWOA 2YW9A 4EBFA 4G0MA 3A0UA 3PCXA 3IXQA 3ZDBA 2IKQA 5JCJD 2Q3DA 1NBME 4O4LB 4PS1A 1EWRA 1FFCA 4QT0A 4PAQA 2Y1KA 4CV2A 2YN4A 4X7BA 1HE8B 1JR3A 4KXLA 2BEVB 2Q9BA 4R8RA 1NX9A 3SHVA 5T6BA 1EXVA 2XQVA 4AKHA 3A3NA 3HUTA 3MMPA 4Q3CA 4B33A 1R64A 1YJCA 2YJ6A 3ZD7A 3OPXA 1KRXA 1M2JA 1Z0ZA 1JIXA 3MGGA 3J81A 4RTKA 1NXXA 4HX9A 1AA6A 4L3OA 4QGAA 3TLGB 1H8HD 5AW4A 3FHLA 1EA7A 1QKJA 3MOIA 2MIIA 3RRFA 2G25A 2R25B 4G2TA 3W1VA 1C3OB 1SVOA 4J9VA 1Z7WA 4JOBA 3UVEA 3L41A 4BKMA 3VPGA 5G3ZA 2WQ7A 2BRUC 3K0SA 5L7YA 3KPJA 3U7RA 3KC2A 4HKTA 3TRKA 2DSTA 4Q7EA 3E7PA 4ZPJA 4PZCA 4PCUA 4RMNA 4DMLA 1N0HA 2UZ0A 5DCLA 4ETIA 2VQSA 4MWBA 6ADHA 2WYWA 2NSJA 1CE8B 2X2OA 2EARA 2OY0A 2GDJA 2RBKA 3K05A 1HKHA 1V6AA 5CH5A 1SVKA 3ISJA 4FXOA 2VZ9A 3IX7A 3KXDA 3UAWA 3W2EA 2EL7A 2J6IA 2PUBA 4Q05A 2WILA 3RT1A 3ZWWA 4YAOA 3LRTA 1WZUA 5H3HA 1G1MA 3F7OA 4DEXA 2FUNB 3CJTA 2A6PA 3U19A 4LECA 4FFBA 4FLMA 1WXQA 2LGJA 2R6FA 4B71A 4WKPA 3KDAA 2HMYB 4RZQA 2WDZA 1USWA 1BSVA 5GM2A 4L7VA 3FYCA 1ZOSA 4QICA 5JSFA 5L4LA 5H5JA 2YHIA 2D5AA 3C3AA 1E4EB 4MAAA 4WUVA 3SS7X 5BR1A 3WRXC 4IGFA 4D3XA 5INTA 5JXHA 2Q0QA 1NIJA 4EY4A 5TS2A 5ELLA 3ZCSA 1WPQA 2Q99A 2CE2X 2NPFA 2QSZA 3TLJA 2JG3A 1POXA 2HJ9A 5JH7F 3U3DA 1HUQA 1KK3A 1V7PC 2KE5A 1PV1A 1KGDA 4CLHA 1L9KA 3BH0A 1IL0A 3A32A 4F0JA 1ORWA 3X44A 3VPSA 4B47A 1NATA 4JP5A 1NJ2A 1NONA 4XD2A 1VPDA 1ZUNA 1Y6RA 2VBCA 4X8HA 2WJYA 3AH8A 3KG2A 1T2AA 1LZLA 1E8NA 3MIIA 1ORDA 3N6VA 4NK4A 1A0OA 4PSUA 4N5MA 4BLSA 2JC3A 2P1RA 4MKRA 2VKTA 3WRWA 2PGNA 4B5KA 4MWZA 1XF1A 3ZW8A 2HIAA 4YWJA 4EB3A 5ADWA 4JLAA 2OCXA 4N3CA 4Y2JA 3HJAA 1NI3A 3OJFA 4IJKA 2REBA 3IPLA 1USVA 4ZO8A 3G9UA 1PG5A 3NIWA 5DHRA 1TYCA 1T3TA 2YJZA 3CJQA 4JJ8A 5TPWB 3TF5A 4BJ3A 3NM6B 4D0LB 3QPDA 1LSJA 1WMBA 2JGMA 2Y4NA 4V39A 3UA4A 1XD9A 3WIDA 3DBRB 3S2YA 1G4HA 3FCYA 5CLIA 2V03A 4M1TA 3UZUA 4Q9KA 3ZH9B 4QFDA 1AGYA 2FRXA 1MJGM 5I9MA 1B0PA 1VYUA 1W73A 5A3QA 2HPZA 1D1TA 1QO0A 4CR7A 1OTHA 3AWDA 3NGXA 5A9RA 2H1SA 4EHIA 1J8YF 1CR4A 1SBYA 1OB2A 1ZWLA 1RVDA 3M89A 3QENA 5FWAA 1P73A 3HE3A 2CJYA 1V3TA 4XUEA 1CUGA 2HA4A 3S4YA 1OC2A 1A4IA 1YTLA 3JQFA 2RMKA 1ZK3A 5JAIA 1JU4A 4HS4A 4KQ6A 3C5EA 4OBEA 2QVLA 3BUSA 4JVMA 1SKAA 2HWWA 3EVGA 3FDJA 3G17A 4HYEA 3WLTA 3B7GA 2J4FA 4K9SA 2PWAA 4OQYA 3SI7A 4HXEB 5CYGA 1WF6A 1Z3IX 2SKEA 2DG2A 4OSOA 4KQCA 4RVFA 4D9NA 3I42A 4JUFA 2HMWA 2WF8A 2XI4A 4ACAA 5LMUB 2HWUA 2PVPA 2HHHB 4OQNA 2SNIE 4FHCA 3OEED 4FBLA 5JDIA 1DSSG 3FNQA 4M76B 1LQ2A 3C3CA 2JFVA 2Y1WA 3S1SA 2E82A 1MTOA 2CF6A 1XKXA 3NB0A 3QGMA 5L95A 4B6QA 1MV5A 3QEMA 1K9VF 3F3MA 4NEHB 3KL4A