1HUQA

1.8a crystal structure of the monomeric gtpase rab5c (mouse)
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
164
structure length
164
Chain Sequence
ICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNTDTFARAKNWVKELQRQASPNIVIALAGNKADLASKRAVEFQEAQAYADDNSLLFMETSAKTAMNVNEIFMAIAKKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural plasticity of an invariant hydrophobic triad in the switch regions of Rab GTPases is a determinant of effector recognition.
pubmed rcsb
source organism Mus musculus
molecule tags Protein transport
molecule keywords RAB5C
total genus 55
structure length 164
sequence length 164
ec nomenclature
pdb deposition date 2001-01-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1huqA00
1CKEA 3A1WA 1G7RA 2YOFA 2QZ4A 1KSGA 2RGEA 2G6BA 2DFKB 1TF2A 1Z6YA 3EC1A 3R8FA 1ZUNB 4NCJA 1Z08A 2OG2A 1U8ZA 2J7KA 4TL8A 1E2DA 2HF8A 2ZRLA 1LY1A 2AFIE 3MJRA 2E9SA 1RJ9B 3SJAA 4DIEA 1GWNA 1ZIPA 3RDPA 3CNNA 2HYDA 4Q9JA 1TTTA 5FR1A 4OI1A 2AXNA 3KFXA 4H1UA 3RS4A 1P3JA 4NYMR 4KSCA 2O8FB 1J8MF 2N1BA 5CM9C 1JR6A 1E4VA 1E9AA 3G82C 2VH5R 3Q8XB 2I1QA 4EQ6A 5H8WA 3THWA 2BMFA 2IYWA 4RZ2A 2RMKA 2XAUA 1E2NA 4F92B 4QNRA 5AWFC 3VNVA 1FNMA 2W00A 4YONB 1T0HB 3TMKA 3NHBA 3RSLA 3ZVRA 5CLLA 4KHZA 4MYHA 3NIBA 2EYUA 2XXAA 2FMXA 2RCNA 3U3OA 2ZJ8A 4Q9LA 3ZIAD 2PLFA 4QFMA 3QKUA 1S8FA 1LNZA 4JJKA 4QC2A 1B23P 3MWLA 3H1TA 4HAZA 4RFSA 1UM8A 4G1UC 1JXMA 5EP2A 4CYMA 4B3CA 3THXB 2O8DA 4QGFA 4C4PA 4DB2A 4PC6A 3DO6A 1Q1QA 4BLTA 1SGWA 4HDOB 3JVUA 1J7KA 3U3RA 4F4IA 4Q7LA 1R4AA 1OXSC 4RD2A 1EFCA 1WDTA 3PXGA 2BMDA 3AKDA 3KJIA 1RYHA 1I4DD 4C0BA 4FI3C 3BFKA 1BS1A 3H86A 2KBEA 1Z3IX 4ABYA 1ZM7A 4A4DA 1AS2A 4J0QA 4TWZA 1S3GA 4PO8A 1RJ9A 4Q21A 1GDDA 4DLUA 4ESHA 1ZNWA 3O8CA 2ZETA 2O8BA 4DCVA 4TMWA 4I1OA 4KI0A 2D4HA 5E4FA 3ADDA 3S1AB 3I32A 1SXJD 4Q1DA 1JNYA 4Q7JB 5SZJA 4M1MA 4H9GA 4C30A 2ATVA 2B7CA 3U7EB 4A6XA 1JEDA 1NVVR 4BLOA 2WAXA 2L0XA 2BMJA 4OI2A 2WOJA 4JLKA 2YZ2A 4PAOA 2PT7A 4KU4A 2BBSA 2IEYA 3LXXA 4P33A 2JLXA 5G53C 5UKDA 3TSWA 1K5GA 1G5TA 2HV8A 2RGAA 4L5BA 4YMSA 4B2PA 4TYPA 1KGDA 1E98A 3KQNA 1TPZA 4HUTA 4P4SA 4O2RA 4D4MA 2XXAB 3GPLA 3QPWA 3PUVA 1Y63A 3GJ7A 4B3BA 4M9SA 2HDNB 4D4LA 4NYJQ 5TARA 1G5PA 1Z0JA 1X1RA 2NPIA 5ANRB 4BUJA 1CRPA 5FUVA 2DR3A 2AKYA 3UIEA 4WZAE 4EKDA 3EPJA 4WW0A 2C98A 2FGJA 2WJYA 1Q3HA 4Z8XA 2JLWA 2J0QA 2AHOA 4MYTA 1G8GA 4ESVA 4BECA 2PEYA 2DCUA 2P6UA 1QHXA 5FBWB 2NZ8A 5JECA 4ILEA 1Z0IA 2LWIA 1VG1A 2IUTA 2REXB 2IYTA 5EE9A 1R10A 4BFVA 3OAAA 2ZRBA 1DS6A 2Y8EA 5TB5A 4BFUA 3B9QA 4D25A 1C4OA 2QE7D 2O8EA 3P4YA 3BC1A 2J0SA 1RE0A 1UDWA 1E2HA 4LZZA 4ZKEA 3Q72A 1X3SA 2EU8A 3CIOA 2ORIA 2BCGY 2YWFA 1SKYE 3QF4B 1D9ZA 1MKYA 3M1IA 4QM6A 1WF3A 5CIWA 5FUXA 3SR0A 4Q9IA 4QOSA 4MKHA 1IONA 2I3BA 4P4SB 4MKFA 1GFIA 4MGZR 3A36A 4QKQA 1ANKA 2ERXA 2R6CA 1SVLA 4G0NA 3OF5A 1FUUA 1AQUA 3BB4A 1LTQA 1XEFA 2OHFA 2D7DA 3C41J 5LDDC 2CLSA 2BHRA 1KK3A 1DPFA 4OHYA 1M6NA 2EW1A 4DEYA 2FGKA 4HAUA 4M21A 2ZYVX 3TR0A 1W7AA 1VKJA 4IEIA 4TYQA 3FKSA 4KO8A 5EUMA 1G41A 4AIIA 4Q7MB 4LPKA 2GJSA 3U5ZB 4B47A 2VHQA 2O8EB 1E2MA 4G3XA 4B75A 2J7PA 5JS8A 1FX0A 1XJQA 5DN6A 2GILA 2OXRA 2OT3B 5KDOA 1G3IA 5CM8B 2QP9X 2WPDA 4DKXA 4B2IA 2XJ4A 1L4YA 4V0KA 1CLUA 3C7KA 4ZCLA 2AKAB 2QMOA 2UZIR 4TT3A 4ZPXA 5TMPA 4OJQA 3TW8B 3T12A 4NCHA 4A0GA 1EFHA 3SS8A 2WWWA 2RGDA 1NVWQ 2NQ2C 2UKDA 3PV0A 1XX6A 4AYWA 4URZR 2X2FA 4JVNA 3X1WA 3C14C 2WOOA 2IYUA 2DWPA 5LD2C 1AIPA 3A58B 3SQXA 3U4QB 4OKSA 3SJCA 1HH4A 3AF0A 5KU1A 1E2GA 4F38A 2ZSBA 1RRFA 4KITB 4LHZA 4UKDA 4XWOA 3FHOA 1R5BA 4KBFA 5EE3A 4XOIA 1E0SA 2IYRA 3DHWC 3KQKA 4DWJA 3VR4A 2YJTD 2C2HA 1QHSA 1JALA 3QY0A 2J5XA 1Z28A 2OAQ1 5FL3A 4YQFA 1KO4A 2GVZC 5C4GB 4NHOA 5JS7A 1IXRC 4MITA 5CJPA 3RS2A 2OSBA 1LW7A 3T34A 4WBSA 3R7WA 2A30A 2NG1A 1F6BA 1T8UA 4EJSC 4PANA 4PHGA 3UWOA 5E95A 1YR8A 2HLDD 3CPHA 3LO5A 1QVRA 4LHXA 4TN1A 4PAQA 4L8GA 3VR2A 1BIFA 1RIFA 2PL3A 3N2IA 5D3QA 2R65A 3MWJA 1XD2B 1Z06A 1GZSA 2GCNA 1N6LA 3LA6A 4BFXA 3AKEA 1GL7A 4DCUA 2YV5A 2XTZA 2ZR0A 3VTKA 2FZ4A 4NTZA 3AVQA 3NVAA 1NNEA 5LB4A 3GJ0A 4FWTA 1NY6A 2V6IA 4OK5A 4B48A 1ZNXA 4BLSA 4E09A 4MQBA 1LB1B 1N6PA 3SZRA 1FNNA 3DL0A 2DYKA 3WMFA 4AYTA 2ZUCA 1XDBA 4TMXA 3AVYA 3OE7A 3QSYA 2QTHA 1JAHA 2ZYTX 4V0ME 3LW7A 1YZNA 3DM5A 3ZIAA 1TF7A 1EFRD 1GG2A 5HCIA 4GSYA 2XZPA 3RSOA 2IUUA 1YR9A 3FMFA 1UBGA 1JQJC 1SVSA 4X8HA 3GLIE 2ZR9A 1G8HA 5JWOA 2REOA 1ZMXA 2IBMA 2F9MA 2ZM5A 2QP4A 4LJ5A 4GMDA 1ZCAA 2GVDC 3UKDA 3FMPB 4C7OB 4LDJA 1JJ7A 4L15A 4MGKR 1FP6A 1JI0A 4BZXA 5B30A 2HEIA 2VF8A 1FOEB 1Z6TA 2FEOA 5TDHA 1XCMA 5DI3A 3PUXA 4QJ4A 5FUYA 1OB5A 1OH7A 4CZ2A 4QXAA 1N6NA 4GL2A 1R8QA 1W44A 2QMHA 2VRWA 5DE3A 1E2FA 2F7SA 1F2TB 2JJ2D 1R0YA 1UKVY 3BWDD 4OL0A 5EXXA 4Q03A 2ZVPX 2REBA 2HT6A 4LBWA 2W58A 1U98A 4HEJA 2QROA 2WKRA 4I81A 4HLCA 3SN6A 2D2EA 3T15A 2PMKA 2W6ID 4G5GA 1N5KA 1U9IC 2VSFA 4G01B 2ONKA 4ZIRA 2IS2A 1N6IA 1NVXQ 3D3QA 3PITA 4MRNA 2GXQA 3WMGA 3THYB 3EIHA 2ZI4A 4BWYA 3RWMB 4JBWA 1IBRA 2MSEB 3K0EA 1XMVA 5FOUA 2YKGA 4D4JA 3ETLA 3QG1A 2VA8A 4WAUA 5EZ5A 3L82B 4JT4A 2F1HA 2ZJ2A 4IJMA 4NONA 4UJ5A 2N42A 3U60B 4IDOA 4PSAA 1O87A 5GADl 1CJVC 1KY2A 3AF3A 3BRWD 3CR8A 5KSYA 1II9A 3NXSA 5L3QA 2J0UB 5KNDA 5IT5A 2R62A 3L0SA 2WWHA 4LJ6A 2P65A 4NDZA 2OBNA 8OHMA 1W0JA 1U0HC 3LY5A 4Y0VA 4KV9A 4URUR 4W7SA 1EX7A 1K5DA 1G19A 3IPXA 1F2TA 5KHOC 1OF1A 4KBGA 1G3MA 3PEYA 4PQRA 1GRRA 1MRNA 3QIAA 5G3YA 3U3MA 3ZDQA 5KPDA 1PVOA 5FBLB 1CU1A 3ADCA 2GWHA 4G5RA 4ZDJA 5TV2A 1MABA 4X8MA 2A7QA 2XITA 1S96A 3QXCA 1OYYA 3CNLA 1ZD1A 2KBFA 4JKYA 1UEJA 2P5TB 1FZQA 2IXFA 4QJ3A 4UNRA 2ZSAA 3FPAA 1WQ1R 2XNSA 4ZIRB 4C2TA 5J5CA 2ZJBA 4N0EA 4TQAA 4LX0A 1NKTA 5A5GA 5KOYA 2ZI9A 1DE0A 2DPXA 3EA5A 5G3ZA 2ZR7A 2BVNA 4C0LA 2JEOA 4PSVA 4DBLC 2PT5A 4KSBA 5JWRA 4AKEA 4OBEA 4EJSB 3MG9A 2VQSA 1MV5A 3OEHA 3TGPA 1E2QA 4Z51A 2RGGA 5J4KA 1TQ4A 4B6EA 4BLPA 1NMYA 5FPSA 1LV7A 3FVQA 4BFZA 4R9UC 2VHCA 4FMBB 1DAMA 1AKEA 4L4UA 3HU3A 1G4UR 3AP2A 3BOSA 3TBKA 3CWQA 2GF9A 5L8VA 2BM1A 3GP8A 1W36D 2GJAA 2DWOA 4RCYA 3Q3JB 2O52A 1SHKA 4PC2A 1IN4A 2KJQA 2PCLA 3EZ9A 4EQ6B 3WP1B 4O25A 3EIQA 2IXEA 3VKWA 3LVRE 2EVWX 5B58C 1MOZA 1TQDA 2VO1A 2ZAOA 3QQ5A 4XJXA 3R9IA 5JCPA 3FFBA 5F98A 2VHTA 3TH5A 4F4JA 4JMPA 1QG2A 1MABB 2GAAA 1UF9A 3C8UA 3PENA 1HTWA 1XZPA 2DB3A 1NN1A 2J87A 4B44A 2GJ8A 4KYUA 3GEIA 4NCIA 4CEJB 2UVQA 2BM0A 2V9PA 1E1QD 4IEEA 5KNBA 4IFBA 1YJ5A 2J3EA 2GEUA 3MMPA 5JEDA 3SQWA 3CF0A 3RRZA 1T9HA 1N6RA 1AZSC 3THXA 3CX8A 5F3WB 2Q3FA 2Z0MA 2F3TA 5HKKA 1N3BA 4B43A 2EYQA 4B74A 1G6HA 2JATA 4B34A 1Z0AA 5KDLA 2VYFA 4TL9A 2MSDB 1TU4A 2ZSDA 5KO2A 2ZRKA 2GEDA 2NGRA 2WHXA 2FPMA 3OEEA 1E9RA 2V7QD 4GP7A 3PEUA 4DCSA 4DDTA 5AJYA 1W36C 2O8BB 2D2FA 3TQCA 1TQ2A 1BOFA 1CR1A 5F2EA 1XTRA 1IAQA 1PJRA 4K46A 4EPVA 2FJUA 3QENA 3AVVA 1COWA 2FWRA 2OXCA 2RGXA 4TLAA 2R6GA 4EFNA 4GZLA 3GEHA 2OV2A 4M8NE 2GCOA 4QGHA 1G6OA 3IILA 2IYSA 4KODA 821PA 2RAPA 4CT4B 2JLVA 4LI0A 4C0QC 2ERYA 3FOZA 1OKKD 1SQ5A 3K53A 2QORA 4UNNA 4LJ7A 3GLHB 2FSFA 5D3MB 1E9EA 2I1VB 4P0TA 1XMJA 2ZSEA 4CEJA 4Q18A 4HSEA 3BXZA 4L9SA 5FPHA 1KI1A 1H8ED 2FSGA 1ZNZA 3QNUA 2ZE8A 1LFDB 4FMCF 2ZQ5A 4LV6A 2WWGA 1DAEA 4BRUA 3RS3A 4TQUS 1GSIA 2QT0A 1R8SA 3CZPA 1YR7A 4YMTA 3AP3A 4KFTA 4WZ6A 3DOFA 3GFTA 1A2KC 1F2UB 1ONBA 3I72A 4U02A 2RGNA 2ZANA 4TT3D 1G7CA 2CNWD 2Q21A 4EPWA 3GJ6A 5K8LA 2YC4C 1W46A 3BS4A 4M1KA 2K5UA 4W5HA 1JJVA 3VX4A 1D8TA 2WPDD 3MAAC 4CEHB 4HLDA 4OJKA 2FF7A 2XOKA 2HJGA 1WA5A 2N46A 3OE7D 5EXPA 3T1OA 4AI6A 4TTRA 3WBJA 2G88A 1G7TA 2B7BA 3HP1A 4ASUA 4A82A 4U00A 3GJ4A 4Q48A 2XOKD 3TAUA 2JLSA 2XNDA 1T5IA 1U94A 2ODEA 5GJVC 2GCOB 1ODFA 4LJ4A 2WKQA 4B33A 1T5LA 2IS1A 5CJ2A 5EP3A 4ZCMA 1RYFA 4GZMA 5HCNA 3QG5A 2QBYA 4IXNA 2BBTA 1R5NA 3F8TA 5HE9A 3PQCA 4JYBA 5AUPB 3U3KA 2KE5A 2JA1A 3KTAA 2W83A 4JVLA 1BO6A 5D3MA 5GJWC 3ICEA 3SBDA 4P4UA 2PJZA 1OH6A 1EX6A 1GL9B 4BFWA 2JLRA 2ZS7A 3QEJA 4O0MA 4RZUA 1CEEA 1YVDA 2Q6TA 1YZLA 4JL5A 1VCMA 1KSHA 3ZS8A 5JRJA 4Z1MD 2AR7A 2W6IA 1ZIOA 1RFLA 1YRBA 2CVHA 721PA 3EZ2A 3V4RA 1TAGA 5C2JB 2RH5A 1XBTA 2W0MA 2ZI7A 1M2OB 2PX3A 3LVQE 3FGNA 3SDZA 1QRAA 2VHJA 2QPAA 3VR6A 3E2IA 4R7ZA 4ZI2A 4M53A 2VIIA 3PG5A 1DAKA 5CDFE 2CVFA 4CEHA 4GI7A 3IEVA 3ND8A 2ZU0C 2ZRCA 1NVVQ 4UQOA 3ZS9A 5AR1A 1YZUA 2O5VA 4US2R 2IA5A 2VTKA 4IKEA 1OB2A 4CEIA 1IM2A 2QSZA 1II0A 3B7GA 2FFHA 1YZTA 1OLOA 3EZFA 3FDIA 4AYXA 2IYYA 2F1RA 2QBYB 4LHWA 4A15A 2HF9A 2R6AA 1CJUC 1JQLB 2I4IA 4MKGA 4DSUA 5E7IA 4AKGA 3DMDA 1GIAA 3SU8A 1JAIA 5AUOB 1P9RA 3KTAB 1BYUA 3TVTA 1FTSA 1TUIA 5L3RA 5FL7A 2CE2X 1P61B 3O8DA 1R0ZA 1WMSA 3NWJA 4N3NA 5HE8A 1II8A 4TMKA 1Z6AA 3AF1A 3M6AA 3U4QA 4JSYA 2KB0A 5J4YA 1FQJA 4Q5IA 2W0SA 3B1WA 2VP5A 3QXHA 3LQQA 3WP0A 5BN3A 3F3YA 1V43A 1W5TA 4JL6A 1CRQA 3MRSA 4FMCB 1R0WA 1CR0A 1DEKA 3O8BA 5HR5A 1OHHA 1Q1EA 4YMVA 2DFLA 1SHZA 3A37A 1YKSA 3JVVA 1E6CA 2FE4A 4A2WA 1N25A 5ELXA 3MWYW 3JZMA 1E4YA 4FCVA 4I4LA 1NMXA 2QM8A 3DDCA 4E03A 3TW4A 3RS5A 1U99A 3DVLA 4FCTA 3HPRA 2MMCA 4YMUA 1QF9A 2CL6X 4C2UA 1G64A 3TAHA 4D0NA 4US1R 4YDHB 4W5WA 5LB2A 1VG8A 1ZRHA 4TQ9A 2RKOA 3SOPA 1SVIA 1FW6A 2GZDA 3W3AA 1KZGB 3A6PC 2YWHA 1ZP6A 1E9FA 1XD2A 3QBTA 1H8EA 1ZINA 2CL0X 4LOAA 1W4RA 4LHVA 3LWNA 3U2QA 1G291 4DSOA 2PCJA 3N70A 1N6HA 1Q20A 1DARA 2AFHE 2D3WA 2WWFA 3VQTA 3EPLA 2GETA 5IK2A 4EPRA 1W4BA 1DG1G 2ORVA 3GQBA 4PTLA 2D06A 3IDQA 1P6XA 4NH0A 1XTSA 2IEZA 3CKLA 5DH9A 3UMFA 4PQFA 2ZI6A 1II8B 3HR8A 2IWHA 6Q21A 5AJZA 1HYQA 3KKQA 5BQ5A 5JFGA 4K81B 1N6KA 1VDZA 3T5DA 1QHHA 4V0NA 2X77A 4GFDA 1KI7A 1UBEA 2ORWA 4P3YA 4NU0A 4HAVA 4TTQA 5JZVA 5LPNA 3G0HA 2DFNA 2WAYA 3X1XA 2NO6A 3CF6R 2DWQA 1M7BA 1IOZA 3GMTA 1XEXB 1Z83A 2CJWB 1KAGA 5GJBA 2WSMA 4Q01A 2H1LA 4R2IA 2IYQA 1W0JD 4TZ6A 1IXSB 1D6JA 5J4VA 1YQTA 1AKYA 2GXSA 1CTQA 2Z83A 3EASA 1HUQA 2FA9A 1NJFA 3CRW1 2JCSA 5DI3B 1G18A 4ACAA 3KQLA 4WIAA 2GESA 3P26A 3SFZA 4DLTA 3H0KA 2GK7A 3K9LA 4IVQA 5CK4A 3ADBA 3DEFA 3W3ZB 1YZGA 2FFAA 4WA7A 5LBIA 1GNPA 2A5GA 3GLGE 521PA 2HCJB 4XVRA 1IN7A 4KAXA 1G3RA 1RPZA 2GTPA 1R7RA 3UPUA 2XSZA 2ZREA 4DUGD 4M1WA 1TUEA 1D2MA 5L3VA 1SXJA 2RHMA 3C5CA 5AUQA 4ZDKA 1N5JA 1NKSA 3FHCB 4G5QA 1W47A 3KKOA 4XH9B 3RS0A 4TYWA 2X1VA 1QHHB 4OHWA 3UWKA 2Q9BA 2IF2A 1ZW6A 2G83A 3L8ZA 1TF5A 4DVGA 1H65A 1D9XA 1R2QA 4FXPA 5DHFA 1SVMA 3I1FA 4MH0R 1VCIA 5EE0A 3FTQA 5IDVA 4JLMA 5IF9A 1AK2A 4B6FA 4DIDA 4URYR 2IT1A 2P67A 4DLYA 2O0KA 3K0CA 4B3DA 1X1SA 1KDTA 2CCJA 1JXOA 3LX5A 1J90A 3X1YA 1ZD9A 4ON9A 2ZRAA 2QPTA 5L3QB 2J0UA 2IC5A 2YINC 3BFVA 1OFHA 4KJZA 4LV5B 3MCAA 3IQWA 4OQLA 3TNFA 3UK6A 3ZJYA 4MRSA 3ZVLA 3ZZUA 1U81A 2NO1A 1KJZA 2BEJA 2EFEB 2ZAMA 3A1VA 1KO5A 3J81k 4DC9A 1CF4A 2XX3A 3OIWA 3QVVA 5FPKA 4MRPA 2EQBA 2Q9AA 3I5YA 4II7A 1IY0A 2ZJOA 4IRUB 2VP4A 2CK3A 1XTJA 3IBGA 3FE2A 4Q1EA 1GUAA 1PZNA 2B21A 2A5FA 3T5GA 2ZITA 3TKLA 4DXAA 1EK0A 5EE5B 2GBLC 2VSXA 1AGPA 4HAYA 3TE6A 1N5LA 4GBMA 4JT2A 5L3SB 3ECCA 2VF7A 2ZXUA 1AM4D 3A4MA 1W48A 1Z0KA 4ZCIA 1IHUA 3EWSA 1UBFA 3FWYA 3PFIA 4Q1CA 2OFOA 2XEXA 1AN0A 1MO3A 2ATXA 2FPLA 3AVTA 3TJZA 1K8RA 5SZIA 4EJSA 4CF7A 1ZAKA 3K9NA 2BJVA 3UG6A 4F4CA 3GD7A 3LBIA 3AM1A 3CPEA 1TEXA 4KCGA 3UATA 3GJ3A 4MRRA 3R9XA 3C5HA 4EPXA 2CK3D 4BFTA 2MSCB 5JRZA 1ZC3A 3ZQJA 4DDWA 3QF7A 3TRFA 4NE2A 5BXQC 3BE4A 4LYHA 4JL8A 2G1KA 2YVUA 4I1UA 2GEVA 1NRJB 4Y0AA 2OAP1 3I62A 1FUKA 3IGFA 1FL9A 3QKSB 1U9IA 4IFEA 1UPTA 4DDUA 3L2OB 1Q57A 4FW9A 4OHXA 3BH7A 1FPMA 1GTVA 5KUTA 3KXLA 5EE1A 1KK2A 2E87A 3GJXC 4BFYA 4OQXA 3WRXC 1CJMA 3R20A 4DCTA 1KDOA 4X8LA 5CB8A 4Q1FA 2GNOA 2YOGA 5FOWA 3UANA 4A0FA 1NN3A 2JJ2A 4AKHA 4LBZA 1O3YA 4MUAA 3KKNA 2PMDA 4P4TA 4PQYA 4LJ9A 1HE1C 4HB3A 1FMJA 1E9CA 2J0VA 4NBSA 5BWMA 3AEZA 1SVKA 5IRCD 1A7JA 1KI8A 2G1JA 5H70A 5SZKB 4ACBA 1HT1E 2B6HA 4LCBA 1ZVQA 2ANBA 2ONJA 1S4QA 4ITRC 1AQYA 1PLKA 1VIYA 3EIEA 2R6FA 3ADKA 2IK8A 2QSYA 2ZJ5A 3B78A 3VR5A 4YLGA 1JPNA 2J1LA 2Q9CA 2ZRJA 3LXRA 4UJ3A 4HLUA 3X1DA 2B92A 1ZD8A 4A8JA 2FDCA 5KTYA 4UNPA 4TLCA 2A78A 2OFXA 4MRVA 2D74A 4HZUB 1TL7C 2WIAA 1M34E 2AD1A 2J45A 3E5HA 1ZUIA 4JYCA 3WBKA 5DI9A 1GOTA 2BMEA 1UKEA 3CH4B 3MGCA 4XVUA 1P60A 4JLOA 1MO5A 4S35A 1ZYUA 3GLHA 5TXGA 1E0KA 3CONA 4IOLA 1LS1A 5BN5A 3RNLA 3U6KA 5EXTA 1LF5A 4LJAA 1GVNB 1JR3D 4JLNA 4JLAA 4JIMA 5CB6A 4A6PA 2R9VA 4WOPA 4L9WA 4LJ8A 1OFUX 3P20A 3SHFA 4M0LA 3K09C 4DUGA 2QL6A 2BIFA 3HU2A 3PCRB 1XTQA 2GXUA 4IVRA 4AWXA 5JI3E 4NPHA 5AUNB 1F2UA 3NBYC 4JLBA 2ZYWX 3CM0A 1OPXA 3U6BA 1IJEA 1G16A 1NP6A 2HUPA 3U3JA 3T1VA 4Q00A 1OKKA 3BD9A 2CBZA 3Q5DA 1KNXA 1P5ZB 4GPTA 4DSNA 1G8PA 2OCYC 5K8IA 1KI9A 5KSZA 5JHGB 2GKSA 2J41A 2XGJA 4I1SA 2JGNA 2QP3A 4IW3B 3LD9A 3KKPA 2FOLA 3T35A 3WNCA 4Q4AB 4C3ZA 4OQFA 4QL3A 1XTKA 1ZU5A 4G5SA 1HE8B 4AK9A 1K6MA 3QE0A 2WJGA 1N0UA 3T1TA 5BYJA 1AZTA 4DLSA 1OH5A 2Z6VA 1E94E 1S9DA 1ZJ6A 3OIVA 4FD2A 4XD7A 2A5YB 3I3SR 221PA 2C77A 3ASYA 1S2MA 2J9RA 1VMAA 1OFTA 3ND9A 3AUXA 1DOAA 2G9NA 2DY1A 2R6DA 2NO0A 4ZI3A 3BH0A 2DBYA 3B8HA 1KZ7B 3CLVA 4RFVA 4Z54A 4TTPA 1WE2A 1NJGA 3UMSA 1NLYA 2QMEA 5BN4A 1OSNA 1N6OA 5GVSA 4POAA 4C0SA 1JECA 1T91A 3NTUA 2HXSA 2GXAA 2Z4SA 3AF4A 1S3SA 1W49A 1W5SA 3K0SA 3K8YA 1E2EA 2H18A 4RY2A 1M7GA 5FL7D 4DLZA 2VSOA 3DKPA 3ZLJA 2IYXA 4K8OA 1NIPA 5TY0A 4OI0A 3PIRA 3K70B 2FZLA 4IHQA 3ZGXA 3W5JA 1US8B 4LYFA 5JI2E 2WVJA 3L0OA 4CEIB 1T8TA 5FTKA 3VMFA 4BPBA 2CHQA 4Q4AA 1IQPA 3AUYA 3I4LA 1WBDA 5DSZA 4QBIA 4XWAA 2WICA 2NZJA 3SC3A 3CF2A 3SI7A 4A0RA 1P75A 1G5RA 1GL6A 1NBMD 1IXZA 3HWSA 4NP6A 1W4CA 4DCNA 3HJNA 2JLZA 3TLXA 1KSJA 5CK5A 4D6PA 3IO5A 4LC1A 1ESNA 3B1ZA 2V4ZA 2PH1A 2FV8A 2QNRA 3QUSA 2CEAA 3LV8A 4FMDB 3KQHA 1CJKC 4B3XA 3VKHA 4JLVA 1XTIA 4HB2A 4M1OA 4Q47A 3C4JA 2H5EA 4IDHA 3ZZ0A 3Q9LA 3AVUA 3CW2A 4U7DA 2ZUBA 3LAWA 1ZCBA 3R8CA 3KDSE 1YHNA 4XTRA 4MUBA 3A1TA 5KYKA 4KFRA 2VP6A 2Q0HA 4HI0E 5FTMA 2A9KA 4ZDIA 2QAJA 1SVWA 2Q3MA 3BIFA 1E2LA 2QT1A 4ERNA 5FFMA 3KXKA 1XD9A 1Z8FA 1R0XA 2PZEA 3OAAD 5FOVA 621PA 1NY5A 3L0PA 2IHBA 4JLPA 5FTLA 1MH1A 2QEQA 3REFA 4HB4A 4X8OA 3RRYA 4N0DA 5DYGA 4V03A 4WXRA 3W8NA 4D80A 4QBHA 4D2IA 2FNAA 4OK3A 5JWHA 4LRWA 4IVPA 5FOTA 1OIWA 1OXVA 2YNMA 1XP8A 3NH6A 4LJYA 1BMFD 1XMIA 4BE7B 2IL1A 5EXSA 1NBMA 2TMKA 4CT5A 3SNHA 2XZLA 1D2NA 2FU5C 1Z07A 5G40A 1KMHA 5CITA 4MYCA 1FTNA 4PHFA 1P2UA 3CRRA 5K8UA 3LDAA 2BJWA 3AQ4A 3GLHE 2VP2A 2C04A 2OFWA 2QUZA 3F5FA 3MD0A 4B2LA 3U44A 3I73A 1JEEA 5BW8A 3FKQA 2XTMA 1E9DA 4ZV4A 2FG5A 3GJ8A 1CBUA 1LF0A 1ETUA 1HT2E 2JJ1A 4P31A 3RHFA 1L4UA 1GRNA 2WTUA 1QHYA 1Z6XA 1RC8A 3K70C 4JVMA 1Z2AA 3SFVA 2W6JA 4I1VA 5P21A 421PA 3IHLA 3QXXA 3P1JA 3TR5A 4TMVA 1UBCA 3EPKA 1NF3A 1XEWY 1XEXA 2CJWA 2GF0A 1L2TA 4L16A 2V54A 4DSTA 3NEJA 4QG7A 3EA0A 4A92A 2Z5FA 4PC1A 1T0JB 5J4HA 2VHUA 1YZQA 2OM2A 2AL7A 2NPFA 1NN5A 3IO3A 3Q5EA 3K9GA 3P4XA 1GKUB 1OXUA 1M74A 1ZM4A 1GNRA 2JDID 4M1SA 4XSHA 1I2DA 5C4MA 3GLFE 5JHHB 3BORA 4XD7D 3AGPA 2F9LA 3NG1A 4V02A 3K1JA 1KOFA 1N0VC 1VCNA 2J59A 1JPJA 2QA5A 1XF9A 4LWZA 3CO5A 1KMHB 4EPYA 3OIYA 4UXHA 3KQUA 1D2EA 2JLUA 3FFAA 1CXZA 4CDGA 3TIFA 1BKDR 2W2TA 4RD1A 1C1YA 1QHNA 3A4NA 5FPTA 3EPHA 2XB4A 4ARZA 4GT1A 1SXJB 1OHHD 3AVPA 5HZHA 1GM5A 3N5CA 3K70D 4HUQB 4CIDA 3G5UA 1MR3F 4O2LA 1AJEA 4LC0A 1I4LD 2YYZA 2ZJAA 1NLFA 1OFIA 2CXXA 4I99A 5JLJA 3ZD7A 1ESMA 2W2VA 2C99A 1E1QA 3WYGA 2IF0A 1P2TA 1GNQA 4A0HA 2GZHA 1WCV1 3K0FB 3RAPR 3VU9A 5JBQA 2H17A 1E99A 1XXHA 1G8FA 3BB1A 2CNWA 1COWD 1TADA 4M1YA 4D82A 1RVDA 1CULC 2ZTSA 5CYOA 2OO7A 1A82A 2Z4RA 1DTSA 2V7QA 1X8JA 3EXAA 1XJCA 2ZYUX 1KY3A 4TMTA 3IEUA 1SVOA 4OHZA 3CZQA 4CGZA 5KPJA 5DIFA 2G0NA 2RGBA 4Q9KA 4D26A 3QVUA 5CYPA 3WMEA 4PC7A 1EWRA 2R2AA 4PFSA 3IIJA 2HXYA 4Q4HA 1E2KA 3AVXA 4W5JA 1OJLA 4LV8B 1KHTA 1T6NA 4GDFA 5DISB 1XPUA 2BV3A 3NC0C 1Q44A 2FX3A 2FSIA 3QKRA 3OEHD 5LD2B 5L3SA 4Q1BA 4ASUD 3KX2A 1U2RA 2CMKA 2QGZA 2OBMA 2WM9B 3Q7PA 3KZ1E 1BMFA 1ZUHA 2GJ9A 2WJIA 2CCKA 3PVSA 4RD4A 4DLWA 3WY9A 3UXMA 1VHTA 4KFUA 3NBZC 2GHIA 2BBOA 2F43B 2SHKA 4URXR 2C78A 5KDDA 3N2EA 3K0FA 4XSGA 1G3UA 1KI6B 2B8WA 3RS7A 3VAAA 1XWIA 2E1RA 2IW3A 5E7MA 4TZ0A 1E0AA 2IWRA 2ZUDA 4DZZA 1OW3B 2WJJA 1KI4A 1T3SA 1E79D 3W9YA 4XIGS 2H16A 2JDIA 2C95A 3QKSA 4PO1A 1SXJC 3V00A 3HYRA 2EFCB 2JLYA 4MA4A 3SJBA 4DLXA 2ZRGA 3CPJB 3PEVA 3SBEA 1XD8A 3ZVMA 1E1RA 3QXJA 3TQFA 4XWKA 2QRZA 4Q4HB 1A5TA 1UFQA 3BB3A 3MUFA 3SYLA 2ZE7A 3CWZA 1G20E 4PPNA 2EFHB 4HLQB 5H68A 3SE0A 1DAGA 1DADA 1QHIA 2IUSA 2GCPA 1KIMA 4LPSA 1NSFA 3A4LA 3FMIA 4C0HA 1OYWA 4BGDA 4U5XA 1Z47A 2P5SA 3KB2A 4EIWA 3NC1C 5JEEA 3KUDA 1DG3A 1AS0A 2OLJA 1CP2A 4NYIQ 3W6PA 3EARA 3B82A 4OYHA 3X2SA 1EWQA 1F5NA 2OCBA 1XRJA 2WSSA 3H2YA 3HDTA 2X19A 2ZSFA 3O47A 5AJXA 1U90A 2AN9A 5DHAA 2VEDA 3KKMA 1U8YA 3E1SA 4PZYA 4B3FX 3IIMA 4CRWB 4C0JA 3NEYA 2HJVA 4JLJA 2NO9A 1R6BX 1KI6A 3NKVA 1QVAA 2MMGA 1KDRA 4GOKA 3B1XA 3E70C 5JJIA 3C16C 4LHYA 1W1WA 3RLFA 3CRMA 2DHRA 1XB2A 3MLEA 2PJRA 2VPPA 2C96A 2H57A 4RCZA 5H1YA 3RWOA 2XTNA 3NDPA 5J4LA 4A8JB 5FR2A 1HURA 4BFSA 2ECKA 3KXIA 1KTVA 4HZUA 4Q4JB 3X1ZA 1F3OA 2WWYA 4MGYR 5A4JA 2OBLA 3BK7A 1UDXA 1IY2A 4FIDA 4LYJA 2WV9A 3LQRA 5F9FA 5DNYB 1Z0DA 2OCAA 4HDCA 3CX6A 1UKYA 4QHTA 1OXTA 3VNUA 4RD0A 1NSTA 3NDBB 1UJ2A 1EFUA 5J40A 3B6EA 1E69A 4B73A 3IUYA 3CBQA 3QBVA 4DLVA 1V5WA 1AS3A 1QZXA 1N5IA 1NI3A 3AV0B 3UMRA 4RVCA 3LNCA 4BLQA 2VLIA 1Z29A 1H8HD 4MGIR 1XZQA 2NOAA 2C03A 3B2EA 1PV4A 3B9PA 4R2HA 3NBXX 4EFMA 3PJRA 1YR6A 1VYTA 1P9WA 2G3YA 1KKLA 2B8TA 2X8AA 5EQTA 1SXJE 2V1XA 5EP1A 3A1SA 4M9QA 3BAFA 2DFTA 5EJEA 4Q4JA 1GKIA 3BJIC 1B0UA 3AVOA 3B5JA 4WVFA 2VBCA 3KFVA 2QAGB 1HEIA 1JR3A 1UEIA 5JSZB 2WWXA 1X8LA 4DHEA 3CX7A 3DZ8A 4M9XA 4RSGA 1MT0A 1QG4A 2GBLA 2ZRPA 4V0LA 3M0EA 3IQXA 4AG5A 4ZKDA 2C9CA 2P0EA 1F60A 4HZIA 2RGCA 4PO9A 2D7CA 2GK6A 2JJ8A 3AH8A 4PPQA 2QM7A 2IYZA 4US0R 3TSZA 4P32A 1X6VA 2YC2C 4LY6A 5DGXA 4IOMA 4EPTA 2V8OA 3QPUA 2FPKA 3BERA 1J70A 1W2GA 2GDJA 2RB4A 1HA3A 3OFND 1G7SA 1Y3AA 5E7JA 4A2PA 4JSTA 5C18A 2ZRNA 1W0KA 5CDFA 4HLUC 2XJ9A 5GVRA 4A8JC 1EESA 2AX4A 4NYJR 4AD8A 4PZZA 1Z0FA 1W4AA 1GKYA 1NVUQ 1UADA 4QGAA 4D81A 3EZ7A 2F1JA 3K9HA 2W2XA 1ZU4A 4KLNA 5C1BA 2OZEA 4JLDA 1G9XA 1EXMA 1NLZA 1E2PA 3TVDA 2F55A 1F48A 1US8A 1WP9A 4NYMQ 4LYAA 3RC8A 1AA9A 1VYVA 2F3RA 4NCKA 4Z8YA 5BYKA 5DN6D 1XMSA 3KJEA 2CLCX 2IS4A 3WHKA 2AWOA 4FINA 3QPVA 5JJLA 1NBME 2QENA 1KDPA 2IYVA 2BBWA 1Z63A 3WXMA 1CS4C 4RD6A 4E5UA 3EX7C 1ZC4A 4JBXA 1OT3A 3QOFA 1RZ3A 3I92A 2QQEA 4Z1MA 3VKGA 1BYIA 2ZJYA 3LLMA 1M1YE 4DEXA 4QJ5A 3F0TA 3VR3A 1G21E 2FSHA 3KUCA 2ZJZA 4FN5A 1DAIA 3DOEA 1E9SA 1TQ6A 1UKZA 2WSSD 3EWAA 2P2LA 4KVAA 3AVWA 1TMKA 5FI1B 2ZIAA 2BKEA 2OE2A 3W6OA 2HLDA 2WBLC 1HQCA 1XPOA 4NZYA 1U0LA 1W0KD 5B64A 4C0AC 1KAOA 2GJKA 3D8BA 1QBKC 2QPOA 2Q3HA 4IOJA 3OFNA 5KSPA 1VIAA 2KSQA 2CE7A 3ZYCA 2WKPA 1GAJA 3NBFA 1XNJA 2ZRHA 2V1UA 2AK2A 3P32A 2GRJA 2A2ZA 3ZVNA 1WXQA 2PZFA 3L8YA 3UG7A 1NN0A 3FMOB 4XTCS 5K8TA 2P3SA 1J8YF 1Q21A 2Z43A 1A4RA 1ELOA 1Q1ZA 3THWB 1DELA 2F1IA 3GLFA 2C5LA 3AKYA 4DT1B 1FMLA 4YC7A 2IS6A 2C9OA 4RKEA 4BLRA 3GLIB 1IN6A 4PHTA 1OE0A 3K09A 2FH5B 3D6TB 2JASA 4FWIB 4PHHA 2QN6A 3VFDA 4B35A 3PR1A 1KSFX 3IHWA 1OV4A 2O0HA 3RRMA 3THOA 4Q02A 2CLDX 3CH5A 3LH5A 4IOKA 1E96A 4MDFA 1DAFA 3NH9A 4EFLA 5FBVB 1DO0A 2EWVA 3DM9B 1KO8A 3U44B 3A8TA 4MDEA 1ZBDA 1GP2A 4RFSB 4B71A 4YMWA 4OQMA 2JIZD 5CIQA 4QNMA 2O8DB 1NL3A 3AB3A 4JVSB 3DPUA 1JBKA 1CR2A 4AURA 4CW7A 1M8PA 2QMUA 3IBYA 3FYHA 1H8HA 3D7MA 1E1RD 3QJYA 1XEWX 3SEAA 4LBYA 4LSGA 1PLJA 5KNCA 2XB2A 4HAXA 2V3CC 4XVQA 4JKIA 2ZU6A 1KI2A 3KJGA 3TUIC 4GP6A 2BWJA 1A1VA 3EW9A 1HY3A 1XXHE 4IDQA 2G0TA 4PX9A 5FI0B 1G1MA 1MO4A 4HAWA 5JMTA 4A9AA 4QHYA 1VTKA 3U7FB 3CRVA 4GNKA 3S1AA 3DMNA 2W6JD 1Z6GA 2QTFA 3A1UA 3B85A 2BEKA 4Q7KA 2CHVA 2ZVQX 1T4GA 1YU9A 1PUIA 1OIXA 2PZGA 5B2ZA 4BRWA 3GLFB 4EUNA 2JJ1D 1VPLA 3CB4A 3TSOA 1Q22A 1P4SA 4DT1A 2JIZA 2ANCA 4PSKA 2HCBA 2BOVA 3RVBA 3GLIA 1PLLA 2BC9A 3WYFA 4QGGA 1EG7A 3PUZA 2ZRFA 3IPYA 5KSOA 1VECA 1Z5ZA 2AK3A 2A5DA 1GILA 4M1TA 4Q1AA 3M4YA 2XZOA 4G5OA 4OQNA 4ARZB 2J7PD 3WYAA 3RABA 1E32A 4MYUA 4HUQA 1ZM9A 2O8CA 3LFUA 3H4MA 4PR0A 4OK6A 4RD3A 3ICQB 3U61B 1XPRA 2QAGC 2ZE6A 4YDSA 1IJFA 3RRNA 4Q66C 5A0FA 1G4AE 4V0OA 1ZM2A 1NIJA 2OCPA 4RJLA 2OEPA 3TK1A 3FHTA 2F6RA 3SYNA 2OLKA 1L8QA 3DKVA 1W2HA 4QRHA 1YRAA 2A5JA 1HV8A 4M4SA 3VU9B 1Q12A 5AJVB 5DYIA 4E07A 1M7HA 1XXHB 2CCGA 1G3QA 1S9HA 5EP4A 3AGQA 4EDHA 1UAAA 4PXAA 5HTKA 4KVGA 2ZI3A 2ZPTX 4D4KA 4AY2A 1KO7A 1VYUA 4UXJA 2GAOA 5JCZA 2D62A 4C0KA 3QF4A 3K0AB 4BZPA 1WBBA 1KMQA 4Q19A 1NMZA 2IHYA 2P6RA 1RW4A 1EFTA 1XJ0A 4LGMA 4DB4A 1E2IA 4F91B 4QBFA 1JB1A 5IK2D 4WZBE 3T61A 1N2CE 1QDEA 4RZXA 1WRBA 2WIBA 3ZZTA 3BBPA 3PUWA 4Q9HA 3B1VA 1OXXK 5HZKA 3LBNA 3QKRB 4TSFD 5EZ6B 4JBYA 1EGAA 3GFOA 3HPQA 2PBRA 3LRPA 1FQKA 5F9HA 4MKIA 2QE7A 2ZRDA 1L7VC 5HPYB 4Q4LA 4LK2A 2O8CB 1SKYB 1DVRA 2VP9A 3OEED 4B3GA 1JR3E 2H7VA 4GOXA 4TLEA 2OILA 3R9WA 2AWNA 1VG0B 1RRPA 2F43A 2CL7X 1FFHA 3W34A 3V4FA 1EFRA 3QEOA 1LS6A 3L0IB 3B13B 4PPGA 2PX0A 1P9NA 4D0GA 4URVR 4A1FA 4B32A 1SULA 2GZAA 4D0LB 4PPFA 1DBSA 1J2JA 3LBHA 3K0CC 1SZPA 3VHXA 3WNDA 2QGNA 2G77B 5IHPA 121PA 1FX0B 5B57C 5M04A 2ASEA 5FOXA 2YOHA 2WZQA 2EFDB 1OIVA 4NKRA 2ZRIA 1AGRA 5HKKD 2ZS8A 2ODWA 3K0AA 4OI4A 1XU4A 1RRGA 1KJWA 1TX4B 5FBRB 2GA8A 1S1MA 4M9ZA 3ZH9B 3OHMA 3LLUA 1TNDA 1QHGA 3OESA 4NMMA 2BCJQ 4CVNA 3JZAA 2ZE5A 2BDTA 2IYLD 3IIKA 3W90A 2VP0A 3W8RA 4IDNA 5FBQB 3QXSA 4LUCA 2R44A 5FPYA 4BEJA 2LKCA 4EAQA 3RC3A 3MSXA 4HATA 4M2LA 4BZQA 4TLBA 1I4TD 2ZS9A 1P2VA 1IN8A 2ODNA 2WJHA 2WMNB 3CNOA 1GITA 1IN5A 3C15C 5FUWA 1XFAA 2O0JA 4H1VA 1MRSA 5C46F 4FCWA 1KYIA 5SZHB 4TYYA 1J99A 4TSFA 3TUZC 4JZKA 3SYKA 3D31A 5G41A 3BH6A 1X86B 3W6NA 4KYIB 1BH2A 5GJCA 3AP1A 1KK0A 1DAHA 1E0JA 1GRQA 2AXPA 2OESA 5AK0A 3ZQ6A 2R8RA 3BGWA 3R7WB 2RHDA 3U7GA 2WMOB 5EUQB 4DDVA 1NG1A 4B76A 3NHAA 5AJWA 2P6NA 1FP7A 3WRYC 1CIPA 3OZXA 3RYTC 5CLQA 1P72A 4ZO4A 3H84A 2YWGA 1W36B 1HQYE 2LCFA 3EG5A 4BEBA 4GOJA 4JS0A 3GLGB 2BKUA 2ZRMA 4HYYA 2H92A 3CUEF 3FB4A 3WNBA 2QI9C 4E22A 3LW8A 1N0WA 1X8KA 4DLRA 3AF2A 2AD5A 2EWWA 3PUYA 4ZDWA 1YE8A 3HYTA 3PEWA 1T3LA 1VCOA 4GRAA 3I5XA 5FOSA 1G8YA 4WXPA 4RKFA 2NIPA 1S1CA 2J46A 3SJZA 4AG6A 4AC9A 4KFSA 3CRQA 2C8VA 4S2EA 3VX3A 3EC2A 4QBGB 1RKBA 4URWR 2UZ3A 1E2JA 2KWIA 2XNDD 2ZEJA 4NCNA 1LVGA 2EFGA 4OHVA 1D5CA 3MWKA 3Q85A 3I61A 3FKSD 4M22A 2IXGA 2HYIC 2QU8A 1KKMA 4N1AA 1R5OA 4BQSA 4C9BA 3B60A 3Q7QA 2PEZA 3P27A 4YXWA 2HT1A 3B1YA 4QM7A 3DZDA 1KNQA 4C7OA 3VR1A 4A2QA 3EAQA 2A3RA 4TL7A 3T06B 2H8KA 2FFBA 2YHSA 2ODBA 3V9PA 4IXMA 3W5IA 1E3MA 4KLZA 4UNQA 5FTJA 3EZ6A 3GJ5A 3SHWA 2FN4A 5DO9A 3KL4A 1KO1A 1XCPA 2XSZD 3OIUA 1OH8A 2QAGA 5JSZA 1KJYA 1ZM3A 3GLGA 3I8XA 1YZKA 3TUJC 3IKJA 4HB0A 1TEVA 2NTYC 1CJTC 2QTVB 2WWIA 1E79A 1P73A 2ZROA 3WHLA 4TYNA 4DRZA 4O3MA 4R98A 4PAMA 3ZD6A 1I2MA 2NMVA 1SKQA 3VHLB 1WB9A 2KI5A 3AKCA 3REGA 1MO6A 1XCGB 3HU1A 2FFQA 2V55B 1IY1A 3THYA 2V6JA 4V0MA 3KJHA 2C9YA 2QY9A 4R71A 1G17A 5JJKA 4W9MC 2QRNA 3ONWA 1CR4A 1U8AA 4TL6A 4TLDA 1Q1BA 3KB1A 4TMZA 4UXIA 2VL7A 4FMDF 4PZLA 4QHSA 4DJTA 1ZNYA 2FEMA 3O8RA 2JLQA 3LX8A 1VG9B 5J47A 1Q3TA 2RGNC 4KXFB 4F93B 1NG9A 3RANA 4IDPA 4F7WA 3HR7A 3L43A 5FTNA 2X2EA 5E3HA 2YWEA 4YXWD 2LKDA 3QKTA 4HDQB 3T1QA 1Z2CA 1RRCA 4NL4H 1KK1A 2IX3A 1Z22A 1P62B 1U0JA 1E9BA 5FH9A 3GEEA 3ASZA 4LBVA 3I8SA 4RZ3A 2JAQA 3MFYA 3U7HB 3MJHA 1Q0UA 4A36A 1VHLA 2WJVA 5TVKA 2O8FA 2QQ0A 1C9KA 2CDNA 4UNSA 4BASA 1T3HA 2NO7A 4NYIR 4GMXA 2CHGA 3GCGA 4JJZA 1DO2A 5DLQC 3GFPA 1TU3A 4PC3A 2QG6A 3CR7A 3QI2A 2OUKA 1P2SA 1PUJA 4AKIA 1KI3A 3BFXA 1S0UA 1A2BA 2PLRA 1P7CA 2ZI5A
chains in the Genus database with same CATH superfamily
1CKEA 2CKDA 4HEA1 4HH4A 4W5TA 5ELLA 2NV0A 2RC5A 2H1FA 2QZ4A 3OZRA 5JROA 2XUGA 2G6BA 3F9IA 1EM8A 5LBTA 3HYSA 2DFKB 2KW5A 4D44A 1TF2A 3KLPX 1Z6YA 2OV3A 3EC1A 4FX2A 1EXNA 4HQ0A 1NURA 4NCJA 2IOFK 4XUGB 4ZEVA 4U7WA 1E2DA 4Z3KA 4PZAA 2ZRLA 3QZUA 1INLA 1QHEA 4WN9B 4UE2A 2AFIE 3MJRA 2I5PO 3NHSA 3RFFA 4A0QA 4KXXA 4J4TA 4M0CA 2FJ0A 4NEQA 5FR1A 4OI1A 3OE5A 1M0EA 4GQAA 4H1UA 3L8FA 1L4GA 4MUKA 3PGJA 3V4OA 5LMNB 5CM9C 3L0YA 1JR6A 1AN9A 3EXIA 4MVJP 4OQEA 3SX2A 1X7YB 3TPFA 4C6TB 1EFPB 2X7HA 2E5FA 2H2GA 4LDQA 1V25A 4BNUA 1JIJA 3Q8XB 4Q7QA 4H1WA 4EQ6A 4KIFA 3THWA 4O29A 2BMFA 2Q1UA 2HMSA 1UL1X 1V4NA 1E2NA 4TXJA 5JQGA 1CNFA 4QBKA 4CLDA 4YONB 1K4YA 4QARA 5JBNA 3ZVRA 4RHEA 1U0NA 1NATA 4L4SA 1U8XX 2V6FA 1FLAA 4HMOA 4M7WA 2EYUA 3HJHA 4BX3A 2AFHA 3IB3A 4J4HA 4N3CA 3AFGA 5DK6A 3OSUA 2IYEA 4QUJA 3QBEA 3TTTA 5KJCA 2MINA 3O74A 4FFPA 2G5TA 3IV9A 2IOHA 3UENA 3G6KA 4EEXA 1LNZA 1AXRA 4JB8A 5KAPA 2UUPA 4CBVA 5JNUA 3H1TA 3CMCO 4N48A 2BKXA 2ZWAA 4EH1A 5EP2A 3SX0A 4CYMA 4I2NA 3P9YA 4QGFA 2X22A 5GOTA 2ZXEA 3IHKA 1JDTA 3LPLA 4PC6A 4BLTA 4DB2A 4HDOB 2Q0QA 3FZGA 4A8HA 4WPGA 1W4ZA 1R4AA 1EFCA 2I6FA 1XF1A 3PXGA 5ICEA 1CUSA 2NT3A 2QJOA 3DTTA 3KJIA 1U2PA 1V7QA 3DJFA 4DDKA 5HOQA 3BFKA 1L7MA 1WHTB 4ABYA 2NTEA 4AJKA 1ECBA 1AS2A 4J0QA 1NWHA 1Q84A 4L51A 1RJ9A 3HKCB 1OU0A 3C4QA 1GDDA 5EIEA 5LKRA 5GIOE 2C3OA 5H0IA 3O8CA 4DUZB 4N9QA 2D4HA 4NENA 3ADDA 3S1AB 5CXUA 1KFCB 1JNYA 1E6KA 2Q5FA 5SZJA 4H9GA 3U7EB 4M9CA 1H1LB 1PR3A 3IVAA 3M8KA 4X6UA 1M2KA 4PYOA 2VJLA 5CG2A 5HKLA 2WHRA 2L0XA 3D5EA 2BMJA 2IITA 4OI2A 4JLKA 3TS1A 1KWGA 3V80A 1KOGA 2PT7A 2Q2OA 2BBSA 4KU4A 4P33A 3LXXA 5CAEB 3T6KA 4NCBA 4AY4A 2O2JA 3QTTA 1EB8A 1QS0B 1G5TA 1ZCFA 3QP9A 4IDGA 4GICA 4B2PA 5CCEA 3TSYA 3VO1A 4HUTA 3SQOA 4R84A 4MKXA 1FP2A 2F2TA 4O2RA 4AN4A 3KSRA 4FYYA 4YO7A 1RTTA 3DBRA 4REMA 2XXAB 1FYWA 4L28A 3GJ7A 4RMJA 3RSCA 1F14A 3UGTA 3SJUA 4CIYA 4JAVC 4M9SA 2HDNB 1Z0JA 2NPIA 5A1JA 3AR2A 1DEHA 1QX4A 2AX3A 3UIEA 4EKDA 3EPJA 3AERA 2J3MA 4DBVO 2FGJA 1YAJA 3HRIA 4JENA 4LN1A 5D00A 2PUFA 3PC6A 3ESAA 3QX3A 3F8WA 4MS4A 5DNAA 3PXUA 4MYTA 1G8GA 2XXJA 4ESVA 4YH1A 3HJFA 1X9HA 1Z7BA 4ZRDA 2VCHA 2R0QC 2DCUA 5BNIA 4P38A 3E22B 5K3DA 3QMWA 4DPMA 5JECA 1Z0IA 3AINA 1ST3A 2REXB 4LQ4A 3T9BA 4J0DA 3DHVA 1F8YA 4BFVA 3FPEA 3OAAA 2ZRBA 2DZDA 3ZHBA 4CKXA 1WP4A 1JF8A 1QP0A 3CUYA 1C4OA 3H5OA 5FQNA 3VZDA 2O8EA 1XRSB 1K4KA 4O4LB 5EKSA 4DC1A 2GFHA 4HPWA 4OHOA 3P4YA 1RE0A 4HQOA 1UDWA 3PGKA 4K26A 3CFYA 2IY8A 2F00A 3Q72A 5EHGA 3CEJA 2ORIA 3SHQA 4Z4QA 4FGLA 3QF4B 2Z5GA 1V16B 4MRMA 4R3UC 1VZ3A 2OFPA 5NLLA 1WKVA 2A9OA 3SYMA 3PFHA 2WSYB 2E18A 4MKHA 4NU8X 1EFAA 3A70A 1QRRA 2UU9B 2CNDA 2R1ZA 3OTIA 4MKFA 4RADA 4QECA 2I80A 3EFOB 5AM0A 3R74A 1HE2A 4Y2HA 1ADCA 3NO4A 2I4MA 2NP6A 3C4VA 2R6CA 1F0KA 1FUUA 1AQUA 4JGBA 3WB9A 5FEMA 4M60A 3GAMA 5LIRA 1RJEA 1TEHA 3HR4A 2QVYX 1DUVG 3UC5A 3IAFA 1YIAA 2IYNA 3W1VA 3K4HA 5IC5A 1BX3A 4DEYA 2FGKA 3ZDAA 2Y0EA 2FF5A 1L5RA 2ZYVX 2BFWA 4QAQA 2PU7A 1VKJA 1MAWA 5HGJA 3SAJA 4IEIA 1JSZA 4CMCA 3T4PA 1U7PA 3FKSA 5KTMA 4M0KA 4V2IA 1J2UA 2VNHA 4KO8A 4E11A 1YQ9A 2Z9DA 3P9RA 4RVFA 3SKYA 3PLRA 1G41A 2AOXA 4C4RA 2HDHA 4AIIA 3KB8A 1OAKA 1UAYA 3RCBA 4JXJA 4WERA 4EYOA 4HS9A 4IWXA 2VHQA 3E3NA 1W1UA 4MV9A 1Y6GA 3ESBA 3ZR4B 7MDHA 1V9LA 1PR6A 3H5NA 4XD2A 4BIIA 1FX0A 1RDFA 1XJQA 2BSQA 2OT3B 4H1HA 2AMLA 1VPEA 1G3IA 3JYHA 5TS2A 1L4YA 4V0KA 3H4TA 3K32A 5DM1A 2UZIR 2WI8A 2WYUA 3VFDA 1V6SA 2OHOA 3TTXA 5TMPA 4HEQA 2W2KB 4PZPA 3E8XA 5G0WA 4OJQA 2HDOA 1N5RA 4NCHA 3W4IA 3WJ7A 4PZ9A 3TDKA 4EL5A 3SR4A 5E6SB 1WDWB 3O38A 1UM9B 5E8RA 1OBOA 5KKNB 4IJQA 2NQ2C 3FUUA 1IY9A 4KRXA 3D4OA 2YN4A 2P9QA 3DVAB 3HBAA 3UYLA 4XGIA 2X2FA 4YJ2F 1JLSA 1I8TA 5CD9A 1VA4A 1SA0B 1GGJA 1G2PA 2X5JO 3VTZA 5LD2C 1SUAA 2QLLA 1AIPA 5LYJF 1HTBA 4BS9A 4OKSA 3SJCA 3EZYA 1K2WA 3PHIA 1GTL1 1MBZA 5FT9A 2UXBB 1UK6A 1FS4A 3FNHA 2O5EA 3ND5A 2ZSBA 1PWYE 4Y9TA 4ZT5A 1BD4A 3ORSA 4KBFA 1FFYA 1E0SA 1TCUA 2ZAGA 3HUDA 5BPHA 5FPQA 3ZCQA 3K8ZA 3ESQA 4LW8A 3VR4A 3HCRA 4EENA 1N32B 5B5SA 1LTHR 2CSXA 1PWHA 2XUDA 3E3OA 5EUBA 2YZGA 3OSZA 2G17A 1RKUA 3WBFA 2H4WA 1Z28A 2J5XA 4M88A 1PDWA 5I8ZA 3GPCA 1KO4A 4R2XA 2GVZC 2HA0A 1F5SA 3EG9A 1IXRC 2JL1A 4NHOA 4R6XA 4UMDA 1KJNA 3QIVA 1DJLA 4Z7QB 2C9BA 3ZKWB 1E6WA 1U8FO 3R7WA 1RXCA 2J9YB 2NG1A 4D4HA 2WHEA 1OBCA 1IVSA 5E95A 4M36A 1YR8A 3CPHA 2GLXA 2XUOA 2G72A 3CLUC 4LZJA 4Q3OA 4ENQA 3WYDA 3CRZA 1RIFA 1T9KA 3BREA 1SWVA 3CN9A 4JWTA 3TG2A 3PC2A 1Z06A 2GCNA 1N6LA 2OO3A 3AKEA 1N33B 1XKTA 1FNCA 5BSTA 4WNIA 2XTZA 2FK8A 1Z4KA 1KP3A 1PHPA 2VDKB 2W90A 3FX2A 3MUOA 1CQJB 3AVQA 5IUKC 2WD7A 3LUKA 3NVAA 5JCJD 3AF6A 4DUYB 1NNEA 2PR2A 3FCUB 5A05A 4DMMA 3JARA 4J2TA 1P6UA 4OK5A 4B48A 4RTMA 1RI3A 4E09A 4JR1A 4FOLA 4WNYA 3A0UA 1U9JA 3MOIA 4HGYA 4HJRA 3E0QA 5SICE 2HK6A 4TMXA 1FJ2A 4HO1X 4F46A 1N9KA 3QSYA 2QTHA 2K6GA 3G2QA 1NQ5A 1THMA 3HMKA 4NLLA 2PUVA 2NZXA 1YZNA 2GJ4A 3GGSA 1GG2A 3QEKA 3V2IA 2CYCA 3ZHYA 4YAKA 2ZXFA 4R7TA 4G1BA 3RC1A 3ZD9A 1QAQA 3ZTYA 2EZTA 2B4RO 4B17A 2YFHA 4F2GA 2RH9B 3H9CA 4DREA 1UBGA 4X8HA 5AK4A 3WB0A 2DM6A 3EYWA 1QIGA 3GLIE 1ZMXA 2FSSA 3DOCA 5AXAA 2ZM5A 2QP4A 2XA9A 4N0PA 3RADC 3K1ZA 2P75A 4P86A 1UPCA 4H18A 3BDAA 2W8BA 1ACLA 2BR4A 3FOWA 1JJ7A 1H6BA 3HV2A 4LWOA 4TRJA 1JI0A 4JR2A 1CZLA 1VQ1A 2HEIA 2XTAA 3RH0A 1FOEB 2FEOA 1DU4A 1FFGA 2NTVA 3I04A 4O4HA 3BGVA 3QV1A 2ZYSA 1OH7A 3GLKA 4QXAA 3F4BA 3FIJA 2XMDA 4GL2A 2VRWA 3NPMA 3Q40A 4WGGA 1ISGA 3I05A 4JQZA 2F7SA 1F2TB 4RVNA 1QK3A 2PA0A 4OL0A 2D54A 5JLAA 4LY9A 4ZYTA 3ZJVA 4IVNA 2ZVPX 2REBA 4NESA 3RIMA 2W58A 2CUTA 1U98A 1V1RA 2QROA 4BC1A 1F8GA 4HLCA 3PPVA 2V0NA 1YMUA 4PM4A 3SIXA 4EKYA 2H00A 4WZBB 4RFLA 3BE5A 1IB6A 1JG6A 3KJNA 3TJRA 1PYOA 1R9MA 2PNFA 3A1NA 3IBFA 4QTTB 4RVUA 2ONKA 4UDOA 4ZEOA 4PG8A 1M5TA 3L6EA 3ZXUB 1AUVA 2CKMA 2HAEA 3T4EA 1E3TA 4W1RA 5FWXA 4ZTZB 1PT7A 3GNLA 3PITA 5FQOA 2GXQA 4EOGA 4TMYA 3EIHA 3G7SA 4MWTA 1ZWKA 1E6EA 1T6XA 2DJ5A 4V0RA 1JHRA 4JBWA 4MWBA 4B8WA 2M1XA 5AVUA 3II6X 3R7AA 3WL5A 2WYHA 2VTBA 5KNBA 4K8RB 3A1DA 1U5BA 2YKGA 4NSNA 2VA8A 2B5WA 1C3LA 1U1CA 3ENQA 3EDOA 4NONA 4IJMA 2ZJ2A 1PTJA 3K15A 4FFMA 1REQA 3U60B 1V39A 3UBTA 2Z6UA 2OZKA 1IXKA 2J0EA 1IY8A 4G1FA 3ZCSA 3CVYA 3KLBA 1XVVA 3P2MA 5KSYA 3NGXA 4IHKA 5F3RA 1HF3A 3PA8A 1J24A 1SXIA 2OD7A 2MHCA 2R62A 5E0KB 3T7EA 4BYGA 5KYNA 4Y0VA 3C7CB 1QOZA 5CLHA 4I3FA 4ZVVA 1KC1A 1AKQA 4AO7A 4ETWA 1HXHA 1NWCA 2DMRA 4R0NA 3IPXA 4AJIA 2IPAB 4BBJA 4PQRA 1D6NA 1IWOA 1GRRA 3RSQA 3U3MA 3ZDQA 4EITA 4J3NA 1PVOA 1ADFA 1N4DA 2G5GX 2DQ4A 2O3JA 4ZOBA 1CU1A 2CF6A 2GWHA 3A7EA 4G5RA 4L08A 3ML1A 3MHPA 4ND8A 4Z99A 5TV2A 2XITA 2XUZA 3U3ZA 1UWCA 3WOVA 3CNLA 4DRXA 2KBFA 3UJBA 3MELA 1UEJA 3NUZA 3KRTA 4BAUA 1DG9A 4QJ3A 4FQ5A 2C2XA 1YAHA 4CI0B 1IDOA 5J5CA 1GAWA 4TQAA 4C7BA 1NVEA 1NKTA 4ZJUA 2JFUA 2ZI9A 2DPXA 1Z5GA 9ATCA 1EM8B 3CEMA 2WKSA 2PMFA 3EA5A 1QFXA 4PE5B 5KTPA 1NVBA 3VPDA 2HA6A 2PIDA 2C5AA 2ASVA 2JGIA 1IG0A 3AHDA 4LYYA 2EFYA 4OBEA 4DCOA 3IYLW 3GRCA 4AJLA 2P1DA 5COAA 2XE6A 1RQ7A 2FHPA 4Z51A 3A4YA 3T52A 1QYCA 1TQ4A 3BMXA 5J4KA 2IUYA 4BLPA 2QDXA 5B58T 1QM5A 1ZQ1A 2VCEA 4LRQA 3TZKA 2RJNA 3KPYA 4C4OA 2FEPA 2E4AA 1FU8A 1QZZA 2PS9A 3HU3A 4CMJA 3HM9A 4JBIA 3C24A 4MV0A 1G4UR 1KERA 1PEYA 3AP2A 1YS4A 2GF9A 2BRUC 2BM1A 2X15A 2YWDA 3KD2A 2X23A 1TRKA 2DWOA 2GJAA 1EFPA 3AUSA 4G07A 3LGXA 3ZWVA 2NM0A 4M89A 5KTSA 4QATA 1SAYA 1JKMA 1IN4A 1SHKA 2KJQA 1XA0A 2RGYA 2EKDA 2OO5A 3EZ9A 3WGZA 4O25A 4U0KA 1NOJA 3EIQA 1YBAA 5BMVF 1DKRA 3ZK7A 2A9PA 4ZOLF 5JQGB 4NBRA 1MOZA 5DTIA 4B6RA 2ZAOA 3QQ5A 5I8WA 2P9EA 3FFBA 4YV2A 1UOQA 3DLHA 5ENDA 2Q29A 3OOHA 2RH8A 2VYND 1UF9A 3C8UA 3L8HA 1HTWA 1ONPA 2AC4A 3LOQA 4RTLA 4RGQA 3OU7A 4NCIA 2HIMA 4CM7A 2O2GA 1TMYA 2WLTA 3JASA 1IC6A 1CV2A 3PJFA 4B4WA 2ECPA 1YJ5A 3AFOA 4ME6A 1R6AA 1BQ3A 2OB1A 3CF0A 3CINA 4G89A 1T9HA 1CQIB 1N6RA 1YDFA 5K09A 5F3WB 2Z0MA 4YT2A 1A9SA 3JQFA 2WT8A 1QR6A 1JHYA 3DAHA 3NP9A 3RREA 1F12A 1L8XA 4JDPA 1WNFA 3KAPA 2EYQA 4YQEA 2O2XA 4WV3A 1TPYA 1I6MA 4L3OA 4B34A 2D2IA 4ARUA 4EB8A 2CHFA 1IPHA 1TU4A 1QE3A 3DW3X 2ZRKA 3E53A 5C53B 1NMQA 4FB5A 2P3LA 2LPMA 3DL2A 3V4ZA 4HFJA 1BOFA 1GPNA 3ROFA 1JR2A 3BAZA 3PIDA 1G4HA 1VE3A 1CR1A 2WILA 5B53A 3WRYA 3VJMA 3UT5B 1PJRA 3GH1A 3LECA 2RGXA 5TE9A 3N0XA 2R4QA 4TLAA 1UDRA 2CJYA 4MP8A 4LE2A 2JZOA 5JFTA 3ILXA 5CFLA 1BG6A 1T1IA 2IXAA 1EPUA 3SZOA 2C5FA 1A72A 1QS0A 4K6HA 3TLBA 3TQRA 3MB5A 2I78A 3EIXA 2ZT8A 4CT4B 4LI0A 3FR7A 4EZEA 2ERYA 4YP7A 5JCXA 4YT4A 1SQ5A 3GIDA 3H4VA 3K53A 5JY6A 4LJ7A 3IP9A 1XQVA 1E9EA 3JQAA 4G85A 1QAMA 3G0CA 2R5WA 3SIPA 2QRUA 2W9XA 2DGDA 2ZSEA 1BKYA 4CEJA 2F1KA 4HSEA 3BXZA 4M49A 1P81A 2P2GA 5FPHA 3AERB 1KAQA 2CMDA 2V4MA 4XLZA 3GT7A 5CFZA 2H2IA 1E3SA 4C4SA 4J1TC 8ATCA 1QO7A 2PTGA 4MVJE 1X94A 3CT6A 1V2HE 2ECFA 4UREA 2JI7A 2WWGA 1DAEA 3EEFA 3P0IA 3PE3A 3VPHA 1GSIA 2O3RA 4BRUA 5I5EA 1KZYC 1O95D 3CZPA 4OQ4A 4XYBA 2JD1A 3KDAA 1V7ZA 3PLNA 2HU5A 2GBGA 5JYCA 2BDUA 2FAXA 2FQYA 3DOFA 1O77A 1F2UB 2IP4A 2JJMA 4HWRA 1M2OA 3PD0A 1TLLA 4JODA 4PY2A 5AO9A 4TT3D 4RV4A 4WXMA 1SQ0A 1VB3A 5DGIA 3VH4A 3THRA 1ICIA 1QIEA 2Q21A 4WACA 3JPWA 3ZW9A 4EPWA 4ZCTA 1NPYA 1SMKA 5DXJA 5K8LA 1D8TA 3OTGA 1ZRMA 3DOOA 3M6MD 2FF7A 1ZK2A 1T9GR 2XOKA 4HAOA 5F35A 3RKUA 3ZDXB 2AR0A 3KKKA 3P2YA 4O1HA 4D98A 5C8XA 3HXQA 4ASUA 1K3FA 4U00A 4B4VA 2Q99A 2XOKD 3TAUA 1EUZA 5BWNA 5F7OA 2YVQA 2IXBA 4EEZA 1KETA 1AXEA 2GM5A 2XNDA 1SU7A 1RPTA 1XUOA 2P2YA 4FYHA 2AZMA 3R0JA 4GPZA 2GCOB 1RP1A 2XH8A 4Y9RA 4MRMB 2WKQA 5GJVC 1C30A 2W6OA 3ITNA 4HP8A 4ETMA 1JJFA 5CJ2A 3K6KA 4ZAYA 2ZJ0A 4EVIA 3QG5A 3MK31 5HE9A 1R5NA 4B6OA 4JYBA 3EFOA 3GUYA 3GDFA 3M4JA 2VKTA 3KTAA 2W83A 1UBRS 5FAKA 3SBDA 4P4UA 2I8AA 2PJZA 1OH6A 4BFWA 4ADSG 2ZS7A 1ZLYA 3QEJA 4F4UA 2XNJA 3M6LA 2AUTA 2Q6TA 4JL5A 1T29A 1KSHA 4WNCA 2BT4A 3ZS8A 4KUEA 4XFJA 3DEJA 3HXLA 4KAAA 1BFUA 2XOXA 2YXEA 1BCRA 3HY6A 1RFLA 1MW8X 2CVHA 3O1JC 1KOJA 2XZTA 5MN4A 3V4RA 4W5QA 4Z2AA 1C14A 1Y1SA 1NUUA 1WCWA 4QTUB 2PX3A 1YU6A 3DF9A 1ZH2A 4WK2B 3QY9A 4R7ZA 2FUG1 3S40A 4NOLA 3R5KA 3PG5A 1DAKA 4CEHA 1I32A 5ENZA 3RC2A 1FFDA 5CXQA 3I1IA 4GI7A 1K8ZB 4TXMA 3N8GA 5K4GA 1FEZA 3U31A 2ZRCA 1NVVQ 4EWLA 3OLYA 2JAPA 4PCVA 3CTMA 1U9ZA 5IVIA 1YZUA 1BTOA 1K2VN 3HY4A 5AW7A 1ZIDA 3PFNA 5I5GA 1IM2A 2FPIA 3QW4B 3V1NA 2GRUA 3KS9A 1DV2A 4TTIA 2Q5HA 3B7GA 4PRLA 1OLOA 3TD2A 4HDSB 3ONVA 5GOZA 5KAMA 3IL2A 2GYYA 5JISA 4A15A 4E1BA 1NW9B 2HF9A 2R6AA 1RWXA 3DE7X 3OX3A 2X0KA 3Q87B 4MKGA 2V6MA 1E8MA 4N40A 3VVCA 1XVTA 1JAIA 1JDBB 1UPBA 1E3IA 2ACVA 1FTSA 1TUIA 2E37A 3QMPA 4IH1A 3FROA 1TGVA 3O8DA 2WK1A 4M6WB 4N3NA 2NZ2A 1DRJA 1II8A 1ZZGA 1SNYA 2JFZA 1VJ1A 5MFZA 1QGDA 2AOVA 2BONA 5DULA 1Z6AA 3AF1A 1P18A 3M6AA 5E4TA 1J2RA 2G1PA 3LO8A 4EKIA 4U39A 4HH0A 5I47A 1JIQA 1V43A 2J4FA 4IGAA 5CT4A 4D0RA 1R0WA 3GX1A 2NU8B 4F7DA 1CR0A 3O8BA 4FHEA 1PG0A 3B6MA 2X6RA 1BDBA 1SUCA 2YWCA 3PC8A 3RFUA 1PYDA 1DUSA 5AKEA 2OHHA 3JZMA 4FCVA 3AC0A 2GPJA 3FDJA 2FN8A 1B8NA 4P92A 1U99A 4KH1A 4L4XA 3SVZA 3TL2A 4UHKA 4AMBA 4YRGA 5LUAA 3D2BA 1NLMA 1QGED 3EAGA 1MB0A 4WVLA 4F4HA 4QIHA 1XAGA 5CVVA 3JALA 4N3GA 4MLZA 4D0NA 2QV7A 1LLFA 4FK8A 4I4NA 4JP5A 4XX0A 4W5WA 5T64A 1JFRA 1T0IA 1YBMA 4RESA 2GZDA 1PK9A 3W3AA 5AVOA 3RLIA 2IJGX 3A6PC 1E9FA 2C61A 4ZQGA 1EBBA 4K6OA 1RHUA 1Z4JA 2CL0X 2Q4EA 3GCWA 4PONA 5G1OA 5AVZA 3LWNA 3KWMA 4FZ3A 1FRNA 2RHOA 1S2IA 1CQJA 1JDVA 1KMNA 2WZCA 2QD3A 1Q20A 1WR8A 3DR3A 2D3WA 4IGKA 3S27A 3ZU6A 5HFNA 4EHDA 3D4IA 3H11A 3I0NA 4EPRA 3BQNB 2JHCA 3CEAA 5CLLA 3CZAA 4NH0A 1ZMTA 2IEZA 3AIOA 5F23A 3UMFA 5BSWA 5BV2P 2P4EA 4DNXA 3EOBI 3H2BA 3CU5A 5CW1A 1OOEA 6Q21A 1MPTA 1D6MA 4XR4A 3KKQA 3WOHA 5JQWA 4GP9A 3LGAA 1QU2A 1BA2A 2QG4A 3TCKA 5SYNA 5DLEA 4R05A 3ZI0A 2RAVA 1IK4A 5C8VA 2BGIA 4NZOA 1Y34E 4JA0A 3OQMA 1T9ZA 4HAVA 4NU0A 4OXYA 4TTQA 1KEVA 2AJCA 1TYDE 1L7AA 4ATNA 3M3HA 1DAOA 4YRMA 2JCXA 4F4FA 2CJWB 2RG7A 1KAGA 1X38A 1MNAA 3M9LA 3GFRA 5JD4A 5I7UA 2P40A 3HVRA 1COZA 4DMFA 5BV8A 5DMXA 3U7QA 2EV9A 1JAXA 1FFBA 1S89A 1OFGA 1W0JD 2IEGA 2JBAA 2R4TA 3H1GA 1IXSB 5DX8A 1SBYA 3RVKA 1PGNA 1CTQA 4BV2A 3HZOA 4DG9A 4NZMA 3UPTA 4RENA 4DCGA 3R0QA 2Q6VA 2ZBEA 3ZQKA 3BHJA 1BVRA 1P91A 3H0KA 4TS9A 7AT1A 3ZU3A 3W3ZB 3FSGD 2PL9A 3RT7A 4U5QA 3PXAA 1GNPA 4X24A 1G38A 1OTYA 2AEJA 5HK8A 3EJWA 1M2EA 1XZMA 2DPGA 4N41A 1F4VA 3O73A 1MZPA 2WJ6A 2Z3ZA 2ZK7A 2BKAA 1M10A 1DC5A 2I34A 3OH8A 5EJAA 2XSZA 5D7NA 2FPOA 2R00C 2ZREA 3LT5A 2UUAB 4BO2A 5HK9A 3VOAA 1UFOA 4LXHA 5G4LA 3FDZA 1DV1A 1RWOA 3HI4A 3N59A 4HVTA 1SXJA 1WMAA 5AUQA 2JIOA 3N76A 4Y9SA 3ZH2A 4ZDKA 3RS0A 4XGQA 2PZ8A 4TYWA 4QOIA 4B09A 2R3SA 2H9YA 3KOXA 4X84A 4MUGA 4J03A 1H65A 2P11A 5T8KA 1X7ZB 1DTWA 3C7AA 2VYCA 3IXMA 3RIYA 5FTWA 2Q9UA 4IM7A 4O5AA 1U5BB 1FFSA 5CA0B 5JVDB 2AEFA 4NXMB 1QCCA 1TQHA 4B6FA 1BXRB 1ML3A 3G5MA 2WMYA 3KYDA 1ZGBA 2P67A 3AYXB 3LFTA 2H59A 1AUQA 2QS9A 4ROTA 5EQFA 2CCJA 2B8JA 3KB6A 1G21B 1OT5A 1J90A 3NRCA 2X2PA 4ON9A 3R09A 2Q6IA 4H08A 3UMGA 1C8VB 1K3TA 5EVCA 4AS2A 1V96A 1OFHA 1T1RA 2J3DA 3DOUA 3ZJYA 4B79A 4BO4A 3FGZA 1D2GA 4MRSA 4L07A 2FFRA 4HQRA 4XFDA 5FUBA 3OZTA 2P41A 1CF4A 1Q15A 2PXHA 3ELYA 1OVMA 4DC9A 2B82A 1HMPA 4QFDA 3D8NA 1YOVA 1IQ0A 3LSYA 4MULA 2EQBA 3LVBA 4IXWA 2M6SA 3MJFA 1MDBA 1JP7A 3ODGA 4GI2A 4II7A 3IBGA 1OJ7A 1VE6A 3HZHA 5KREA 4GZ3A 3L7JA 4YRAA 3HJGA 3DO5A 5KWJA 2TMGA 2B21A 2C84A 1QRDA 2BLNA 4W9RA 5DLPA 1XVUA 5H83A 3WLMA 4A03A 2AV6A 3A6LA 4DAOA 1O57A 4XIJA 2D1TA 2VSXA 5THKA 1U5AA 2AR9A 3TE6A 1N5LA 4GBMA 3X1KA 4JT2A 3CUTA 2VF7A 3EQZA 1VP9A 1AM4D 1BDJA 3EMKA 1WQ3A 1LPAB 4HEHA 1ZX1A 1UCFA 1UC9A 2QK4A 1UBFA 1E3WA 1X7WB 3H2SA 3PFIA 4G23A 4Q1CA 4YI3A 1MO3A 3PCXA 4JP8A 3I42A 1TT5B 2B3DA 2FG7C 4OLHA 4ZQEA 2ATXA 1H23A 1K9SA 5DYNA 3LUPA 3SEZA 1OLUB 4HH1A 4LJKA 5COQA 2CB0A 3TJZA 5KYTA 3C3JA 3GMIA 1JLLA 1Z75A 1T3ZA 3MCUA 4GEKA 4UZFA 5AVWA 2BJVA 4RMIA 4WDQA 5BXYA 2DR0A 2NU9A 4RDHA 3CPEA 5D5PA 4D74A 3AZOA 4Q3LA 3HXTA 1V5GA 1PT8A 1LA2A 2RC6A 1L5NA 4OXIA 3EF3A 4W9NA 2AZDA 4UZEA 1U1EA 2CK3D 1XZ8A 4BMZA 2XZDA 3GUHA 3ZQJA 4DDWA 4LXUA 3VSDA 3C5VA 2WYIA 5BXQC 3CLHA 5EPUA 1O95A 2Z2IA 3U4IA 3KO8A 5COBA 3RE1A 4AUMA 4I1UA 2GEVA 4FWBA 3DYBA 2YWJA 3KQPA 5IKMA 3IGFA 1FL9A 4RA6B 3DF7A 5BWLA 4RKYA 3HN7A 3FBGA 4JI3B 3ZX4A 5FWNA 4RTPA 4DJAA 1NC3A 1GUDA 2RGRA 3W7BA 1O7JA 2WE7A 5EHQA 4OHXA 5TMEA 4AU1A 4CG1A 4ZO9A 5HJ7A 4JJEA 5KUTA 4F5YA 1XGKA 1CUAA 3CH6A 2J4CA 3NATA 2YW2A 5ALUA 1MW9X 1SRRA 3KAKA 2V7PA 3R20A 4BUZA 5AKHA 3NB0A 2A0WA 3EIFA 3DZHA 5CB8A 4Q1FA 3UANA 2YOGA 4A0FA 5JTTA 5JS1A 3QUAA 4NAVA 1EXWA 2AQKA 4LBZA 3HB5X 1T13A 4S1VA 2O23A 2DKOA 4HK4A 2Q07A 4GSLA 5ALHA 2RD2A 1RZRA 1X7XB 3KKNA 4AS1A 2PBZA 3RBXA 2NSLA 4MVJH 1I1HA 1AK9A 3FCEA 1K4MA 1RJGA 1HE1C 2HSDA 1BD3A 2Q1SA 3N0VA 2A57A 4I66A 2D1FA 1FMJA 3WIVA 5E9QA 1O9GA 2VXBA 3EWIA 3G9XA 3TX2A 5JARA 2YYAA 2OYCA 1H0SA 2PRIA 1A7JA 7MHTA 4FXOA 4XYLA 3VTFA 5SZKB 4LZOA 3HJAA 3UKJA 4QVGA 2HF7A 2C0PA 1QH0A 2H31A 3SHVA 4TXNA 1IHOA 1YVUA 2OBXA 3D6NB 2ANBA 3OLWA 4PINA 2AEMA 1S4QA 3VO8A 1AQYA 1PLKA 4G5FA 4J1QA 3ABOB 1H22A 3ADKA 3DUWA 2ZJ5A 3ILHA 1PEKE 1PJ8A 4GRDA 3ZCUA 3R3YA 1H2RS 1VLMA 1SQSA 5AI5A 4UAUA 2I62A 2GHQA 3PJEA 4HLUA 2FDCA 1ZD8A 3KJQA 5BQOA 4TLCA 2A78A 4YGYA 3F7NA 3PR3A 3CJRA 3GRRA 3P8ZA 4D57A 2JFHA 4JYCA 1TYBE 3KP1A 4JEUA 4OQPA 3UA3A 3S2SA 3K6SA 2H65A 3F47A 5C31A 5DNEA 3ZNNA 3E18A 1UKEA 4XVUA 3VO2A 5HFAA 4P98A 3WGGA 3O9MA 1CR6A 4V1CA 2VHEA 3W79A 2OBFA 2PJUA 4ND3A 1NVDA 5ALQA 1N5DA 3BXGA 4ND5A 3BSWA 5FXMA 5EJ5A 3GRYA 5HBRA 2AG6A 3EPRA 5EXTA 1IIBA 3O93A 3RNLA 5IAJA 4DGQA 1GVNB 1JR3D 1VKRA 1VP3A 1H42A 5C1DA 4A6PA 3R0ZA 4LJ8A 1L3CA 3HFSA 4WNAB 4YREA 1G42A 1OFUX 3SHFA 4AZTA 4D9FA 2HEGA 3PD1A 3OQHA 4DUGA 2QL6A 3HU2A 1U6IA 4HRXA 1XV5A 3PCRB 3W9UA 2VQEB 3FYUC 4Y8VA 2N0SA 4B6SA 3AJ8A 4JI1B 3BCRA 1K86A 3LBFA 3JQ8B 4UOZA 5AUNB 5JQGF 5ARDA 5LWQA 1TM4E 4JYAB 2HK9A 2CXSA 4QBTA 3AR5A 3U6BA 4I5DA 3UH1A 2XRYA 4Q05A 2NAFA 2O6LA 5A04A 2UZ4A 1Z4QA 2QNIA 3KQMA 4JELA 2OO5C 3TLGA 3TSCA 1CNMA 3BD9A 2NV2B 3L1KA 4D9CA 2CBZA 3STVA 5B3JC 3WYNA 1U2DA 1KNXA 1P5ZB 1QF7A 2FZGA 4N5IX 1SG0A 5GV8A 3IBTA 5K8IA 4RWZA 1KI9A 1S8AA 4L6AA 1NFFA 3HKBB 2XGJA 4I1SA 3GUCA 3IT2A 1JFVA 2JZNA 2QQ5A 4CJXA 2JGNA 4R1LA 1VE5A 2Y76A 3FPHA 1U2TA 3WNCA 5BVHA 1WIWA 4OQFA 5DSTA 5IS2A 1XTKA 1ZU5A 1WSWA 3M6XA 3QPAA 4G5SA 4H0FA 1L9KA 2PO7A 1E1CA 4YAIA 4N82A 3MT8A 2QW1A 3SWWA 1V6AA 3TPZA 2IY7A 5HF5A 2VCYA 2GHRA 3D3NA 3FZNA 3P0FA 1S9DA 2XMQA 5BYJA 3OIVA 4J7AA 3WWPA 3TGLA 1FJHA 3ZN2A 1KJ8A 1YCGA 3AG6A 3ZCRA 4IWYA 2NUTA 4PLFA 2DY0A 5EZQA 3TNLA 3G9ZA 2ZIWB 2PKYX 1OFTA 3BWYA 5C1PA 2GCIA 2O57A 3T7KA 2R6DA 4Q0MA 1FXSA 2VG8A 1UQRA 4IRMA 1TM2A 3BH0A 1KZ7B 1MG0A 3HNRA 3R2JA 1ORRA 3CLVA 4ZEXA 1CC1S 2IPOA 3FUWA 4KO3S 5BN4A 2H1HA 2P27A 4LZNA 3PWTA 3ED5A 4POAA 2J32A 3F7MA 1K8QA 4YGXB 2GXAA 2PTHA 2VPTA 2QE6A 4PV7A 4R2MA 3R7BA 1Z5PA 2RK3A 1XL0A 3HLYA 4Y6LA 1C9EA 3K8YA 1E2EA 1DQNA 1YT5A 4NULA 4D97A 3FFWA 4DPKA 5AIBA 4UEWA 1B0AA 5GZ6A 1L4MA 4YT5A 4XIIA 3IR5A 4NH4A 3FMGA 1NM5A 2ZAYA 3G88A 4FYXA 5KOIA 4IHQA 2JGEA 3K1TA 2O4CA 2YL2A 3T3DA 1WY5A 3W5JA 3ZGXA 3OMWA 5ULLA 2WP0A 4WH0A 4BRSA 5BORA 5JAIA 4LYFA 5A6VA 4IQGA 3TF5A 1NVGA 4KKVA 2GWRA 5FTKA 4UQPA 3VMFA 3D3EA 2ZIVB 2WFAA 4Q4AA 1M8GA 4COKA 3NV9A 2PWAA 4U6NA 2AN1A 3L0CA 5CLIA 4YO8A 3U3XA 1FTWA 5K6AA 2FG6C 3FVRA 3SI7A 1OTHA 4F5DA 3ESYA 4NNJA 3T1YB 3HWSA 4ZGGA 3VUEA 2B37A 2B4YA 2JLZA 3IA7A 3D3KA 4JNCA 3TLXA 4J1NA 5AVYA 4D6PA 1M5RA 3M1LA 1NPDA 1ESNA 5DWQA 1X13A 4CR8A 4RANA 2CW5A 2CEAA 5LDHA 4DIFA 4YPVA 1NQUA 3BJMA 4M1OA 2G28A 3JQBC 4MHSA 3UY4A 2H5EA 3ZWPA 4ZO6A 4BO5A 1H0KA 1NSYA 4EW3A 4RHFA 4U7DA 5HIKA 2HSZA 3KG2A 4AAYA 3H5VA 2PVCA 3R8CA 1YHNA 4XTRA 4KFRA 1XZEA 1MJGM 1WMDA 4ZDIA 2PUJA 4WLEA 2Q3MA 1KEWA 3BIFA 4DR5B 3F2VA 2QT1A 4ERNA 1XWFA 5FFMA 3KXKA 4NWIA 4DV7B 2HUNA 1B8PA 2HU7A 3I4FA 3MINA 621PA 1P80A 1E7SA 1NY5A 4MV3A 3B6IA 1CERA 5FTLA 4MEAA 1GQOA 1RU3A 3VNBA 1U0RA 3M3PA 4N0DA 5DYGA 3W5BA 4KREA 5IKPA 3W8NA 1U7WA 2C1ZA 4OK3A 3MS7A 1WZIA 5IJXA 4LRWA 1QVVA 2JHAA 1OXVA 2WF5A 3S68A 1XP8A 3NH6A 3UMVA 1WDMA 3KJFA 4BQOA 1JFTA 1SQFA 1GQSA 3ZWBA 1XMIA 4MZDA 4MRAA 2B6NA 4YQZA 5EXSA 2OGZA 2XZLA 4C7JA 1GKKA 2FU5C 4AFNA 4I9NA 4UAVA 1T3GA