1HUQA

1.8a crystal structure of the monomeric gtpase rab5c (mouse)
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
164
structure length
164
Chain Sequence
ICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNTDTFARAKNWVKELQRQASPNIVIALAGNKADLASKRAVEFQEAQAYADDNSLLFMETSAKTAMNVNEIFMAIAKKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RAB5C
publication title Structural plasticity of an invariant hydrophobic triad in the switch regions of Rab GTPases is a determinant of effector recognition.
pubmed rcsb
source organism Mus musculus
molecule tags Protein transport
total genus 55
structure length 164
sequence length 164
ec nomenclature
pdb deposition date 2001-01-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1huqA00
4II7A 4US1R 2QAJA 5UKDA 1GNPA 2IYSA 1BIFA 2VHJA 3X1YA 2IUUA 5BYKA 2WWGA 3BH7A 2GETA 4B3GA 2AN9A 1HTWA 4V02A 3T35A 1T4GA 3F5FA 4BRUA 2IC5A 5TVKA 1XFAA 5F3WB 2VL7A 1KYIA 1W7AA 2ODNA 4GZMA 2A7QA 1NLYA 2H17A 4FD2A 1ZYUA 1XMVA 2P5TB 4R71A 1XEWY 4TLBA 1YR9A 3Q85A 2LKCA 1VIAA 2Q3FA 1DAKA 1NN0A 4EJSC 2QM7A 4R9UC 4YDSA 2YKGA 3TE6A 5CK4A 2OSBA 4I1SA 3LLUA 1WBDA 1KJWA 1KO4A 1P72A 3CF2A 5EP4A 3EASA 2G83A 4Q9LA 2ZAMA 2HJVA 1SVOA 4Q48A 2O8BB 3SI7A 3NIBA 5FBWB 3KXIA 3FFAA 1FUUA 1XP8A 5SZHB 1LV7A 1RKBA 4TMVA 4DLVA 1OFIA 1AN0A 3EWAA 3EPHA 3NBXX 4HB0A 3L43A 4LJ4A 5CLLA 1S9HA 3B7GA 4C0AC 1ZC3A 4FCVA 5B64A 2D4HA 3U6KA 1OIWA 2FSFA 1I2MA 1G64A 1GM5A 3B9QA 1O3YA 5TARA 1W47A 1CRPA 1GL9B 1P62B 3H2YA 1YU9A 2RHDA 5B30A 3THYA 5L3QA 5FUXA 2L0XA 2O0HA 1VCIA 4XD7A 4DRZA 1JXOA 2MMCA 2ZI4A 4FCTA 4L9SA 1XPUA 1NBME 3SBDA 3KJHA 4JKYA 2RGGA 3W9YA 4A0FA 3A1UA 5DO9A 3PENA 2ZS9A 2QBYA 1X8JA 2IEYA 4LDJA 4PZZA 3K70D 2GF9A 1E0JA 1U0JA 1KTVA 3BJIC 1W4RA 4EPRA 4C0BA 1DTSA 2ZJOA 5TY0A 2ZI3A 2QAGA 2R44A 4AWXA 2QTHA 1N5LA 1CULC 5JSZA 1KI3A 3J81k 2DB3A 3E70C 1T5IA 3D31A 5G3ZA 2GF0A 4TLEA 3ZGXA 4JLMA 4B33A 3TSOA 3TR5A 4B47A 1EFRD 1JB1A 1L4YA 2FFQA 3DKPA 5KDDA 4V0KA 1DAHA 5KUTA 3NHAA 3AKCA 4Q1EA 5DI3B 3PUWA 3W6OA 2ZYWX 1GTVA 1NN5A 2WWYA 2B21A 2DFTA 4NMMA 5EXSA 1MV5A 2BIFA 4NYMR 4KXFB 3K09C 4P32A 4DLRA 1R0ZA 3I92A 4XSHA 2ZREA 3GQBA 2CK3D 5J4YA 2PMKA 4MQBA 3OE7A 4W9MC 4KVGA 1ANKA 5DGXA 4G5RA 5L3SB 2C95A 1G8PA 3X1DA 1YR7A 5J47A 1D2EA 2BJVA 2VLIA 4HB3A 2O8BA 1KOFA 1NKSA 4A2QA 3ICEA 2HXSA 1P73A 5FPTA 2ZRHA 3MAAC 4CZ2A 5HKKD 1GUAA 1XEXB 5IT5A 2CHQA 2ZEJA 3CLVA 1B23P 1AS0A 1JJ7A 1G20E 4NPHA 3O8RA 2RCNA 3UMFA 3B78A 2YOHA 4KU4A 4A6PA 4PHFA 3JZAA 4E5UA 1CRQA 4WXRA 1JQJC 4QGHA 4Q18A 3ASYA 3CRMA 3B60A 4QNMA 1ZNWA 3FKSA 3NEYA 1XCPA 3PEUA 4FI3C 1C1YA 1U98A 2DWOA 3OIUA 1E2GA 4D25A 4MUAA 1CR0A 3UK6A 1IHUA 3MUFA 3SQXA 2PT5A 2IL1A 3VAAA 1V43A 4JL6A 1R5NA 1E2IA 5FH9A 2ZI7A 3N5CA 3L0OA 3DL0A 2BMJA 4MDFA 4DCVA 5CB8A 2JJ8A 4A36A 1Q22A 1Z3IX 1G6HA 2VHCA 3SJZA 5JWRA 1Q1QA 1R5OA 4ZKEA 1CIPA 2A5DA 4GPTA 2ZSBA 4MGIR 1FQJA 1E9AA 4MITA 5FOVA 3CRQA 1E4YA 4CEHB 2BCJQ 4TWZA 4OL0A 2REOA 1G3UA 3RS0A 4J0QA 3KUDA 3OESA 2QSZA 3SEAA 4KJZA 2OV2A 1OF1A 1UKYA 2ERXA 4I81A 1N0WA 2DBYA 2WVJA 3DM9B 1QVAA 2G6BA 4LI0A 3DZ8A 4ZDJA 1ODFA 4TL8A 3MWYW 1XMJA 1G5PA 2OCPA 2QROA 4XOIA 5BN4A 1SHKA 1ZP6A 1RIFA 4KCGA 3FMPB 2W0SA 4C0SA 1Q20A 3N2EA 3Q5DA 2AR7A 1OPXA 3BH0A 3GLHB 2KSQA 4YMVA 4FN5A 5L3SA 1G8YA 1VMAA 2RGDA 1W46A 1IAQA 1T3SA 2GCNA 1G8FA 1N0UA 4B71A 1ZW6A 1G8HA 2F1RA 4AG5A 4DC9A 4GFDA 3RS3A 2ZRLA 3QF4B 4NDZA 4F4IA 1XEXA 4Q9JA 4A82A 5KO2A 2Q3MA 4CYMA 2IS6A 3P26A 3HU1A 3MCAA 1OIVA 3CH4B 1HURA 3DOEA 4GOKA 5E7MA 3TVDA 2CE2X 2C9OA 1P2SA 4QKQA 5FOWA 1S8FA 2ZRNA 5BN5A 3CWZA 3RRYA 2XTNA 3ZZUA 2RGCA 5J4KA 4QHSA 4Q4JA 1F6BA 4HDCA 2FEMA 1U8AA 2J41A 4PC6A 4HZIA 2FG5A 4FW9A 4PFSA 5A0FA 3X1ZA 1WB9A 3DVLA 3TUJC 4DIEA 1MO6A 4LJ5A 4B2LA 1DAIA 5FBVB 5K8LA 3LNCA 1EX6A 2WAXA 1TEXA 2FOLA 2NG1A 2UKDA 4EPTA 2OXCA 3CF0A 3CR8A 2GZHA 3G82C 2AXNA 4CEIB 2D7DA 3AF2A 4G0NA 3VQTA 3VR1A 2XJ9A 5JMTA 1UM8A 1TPZA 3BK7A 2PJZA 1A2BA 1J99A 4IOLA 1IXZA 1X1SA 4BFUA 4EDHA 5HCIA 4CEHA 1XZPA 2QQ0A 1JEDA 3MD0A 4H1VA 3IKJA 2OZEA 2GBLA 4WA7A 4Q9KA 4XJXA 4BFYA 1XBTA 4YMTA 1YZKA 3K70B 2YHSA 3U4QB 3ZS9A 4H9GA 1UBCA 2F9MA 1NF3A 1T8UA 1XZQA 3KTAB 2FZLA 4Q4LA 3MWJA 4PAOA 3AF3A 4QGAA 1FNNA 2IXGA 3SJCA 1E2LA 2F43B 3M6AA 3RAPR 4Q1DA 4XIGS 3LVRE 1U8YA 1ZD1A 3GLGE 3KQUA 5HR5A 2QSYA 4IFBA 3GLHA 4LRWA 1SXJD 4K81B 4BFVA 4WVFA 3CRVA 2J9RA 5JECA 3SHFA 4JYCA 2XZLA 1KSGA 1P75A 2UZ3A 4XH9B 2OLJA 3U60B 3PR1A 3QF4A 4LHZA 1VCNA 3ZH9B 2WSSA 4AYTA 3LV8A 1NIJA 1VECA 5IK2D 2BWJA 1TUEA 2BKEA 3IO3A 4A92A 2QORA 2ZANA 4NTZA 1QHNA 3MG9A 5EP3A 5HPYB 4EFLA 5AJWA 1RRGA 2ORVA 5KTYA 2ZJZA 3CZPA 5DYGA 5JS8A 1XU4A 1RZ3A 2CCGA 2E9SA 5K8TA 4B6FA 3WP0A 3AP3A 4PXAA 4C0QC 3TKLA 2YWGA 1NN1A 2C9CA 2QZ4A 5FTLA 2Q3HA 2W2TA 1IQPA 2BMEA 4L4UA 1DAGA 1E2DA 3A1SA 4G5GA 1T91A 4FMDB 2Z0MA 3I62A 1KO7A 3K0EA 2EWWA 4CEIA 4DHEA 1EWQA 2CL0X 2CBZA 3IEUA 4ASUD 1JBKA 3BB3A 3GJ3A 1KI4A 4DSNA 2PH1A 1W5TA 2F1IA 1SULA 4G1UC 5FOSA 4KODA 2F1JA 3HR7A 4QC2A 3U3RA 3AVYA 1JR3E 5DE3A 4H1UA 1NP6A 1KGDA 4PPNA 3I5XA 4LPSA 3LXRA 3IO5A 4UXIA 2ZPTX 3R8CA 3VR4A 3K0CC 3GLFB 2O0JA 2AFHE 4IFEA 3EAQA 3U4QA 4M4SA 2QRNA 1TF5A 1I2DA 4RD2A 2W83A 3KTAA 4TT3D 4C0LA 2ZSEA 3QPUA 5TV2A 3G0HA 4LBVA 1VG1A 4DB2A 2EWVA 5G41A 3NTUA 1P2VA 1EFRA 3R7WB 2F43A 4Q4AB 4TSFD 3ZS8A 1CLUA 1FL9A 5EUQB 2CVFA 3CKLA 4NU0A 2C9YA 2ERYA 1NY6A 5FOTA 4OI0A 2V8OA 3E1SA 5EQTA 2DCUA 1Z6XA 2ZRDA 4M1TA 4GZLA 5J4HA 1LB1B 3BGWA 2JJ1A 4JLKA 4Y0VA 1VG8A 1Z28A 1OIXA 2RGAA 2ORIA 3AKDA 1W36C 5EXXA 2QI9C 3SJAA 1AKEA 1KO8A 4ZIRB 5GJCA 1K5DA 1KK0A 3LY5A 2GCOB 1M6NA 2R6DA 3B1ZA 2ODEA 4OK5A 4CEJB 5CJ2A 1QRAA 1XTSA 2G3YA 1OXUA 4LBWA 2AXPA 3JZMA 1DG3A 5JRJA 4XD7D 2GXQA 3TSZA 4UJ3A 1AQYA 4R2IA 3B85A 4JLOA 4WAUA 4GSYA 2H92A 4JLAA 2D74A 5LB2A 4U02A 2ZS8A 2ZRBA 2B7CA 4CVNA 2IUSA 1G3IA 1JEEA 1G41A 2AWOA 2CE7A 4FMCB 2GKSA 4NP6A 4DT1B 4G5OA 3QI2A 1X8KA 1RRCA 4DJTA 3RLFA 4OQNA 4IDQA 3TRFA 4V03A 4LC1A 2ZXUA 1JALA 1IBRA 4QBIA 1WRBA 3HR8A 4NH0A 4MYHA 1XD8A 2YNMA 4BLQA 4CW7A 3QKRB 2GAAA 1HQYE 1LFDB 3SFZA 4UXHA 3GLFA 1OYWA 4E03A 1OV4A 4DLXA 2Z43A 4B48A 1VYTA 4LC0A 1MRNA 4ZO4A 2J46A 3WXMA 5EXPA 3DZDA 4PANA 3PQCA 3H4MA 2B6HA 2GWHA 4EPYA 2WJGA 3CNOA 3QKSB 4AK9A 1WMSA 3R7WA 1XXHE 5BW8A 3CPJB 1HT2E 1MABB 2PZEA 4Q4AA 2VEDA 1TQDA 1MRSA 3OE7D 2KB0A 4QHYA 4NYJR 3V4FA 2JIZA 1XWIA 4TYWA 1EK0A 3L82B 4QHTA 1NMZA 3DOFA 4GRAA 4D80A 1E94E 3IQXA 5EE3A 4JVSB 2FX3A 1LTQA 3SE0A 4HAXA 1KHTA 2QMEA 5LD2B 1J7KA 3UANA 2QAGC 1G3RA 4GNKA 1KKMA 1T3LA 1DAEA 4ZIRA 4AD8A 2ANCA 2Z5FA 1N5IA 2P65A 1HQCA 2J3EA 4OQXA 2GCOA 4CEJA 3OF5A 1KSHA 5K8UA 1NIPA 4OQLA 2ZU0C 3GLGB 3GP8A 1KIMA 3TJZA 4QXAA 3KX2A 2E1RA 4P4SA 4BFWA 2F7SA 1R6BX 3T1TA 1SGWA 2JLRA 3C8UA 2VBCA 2B8WA 2HCBA 1JAIA 3NDBB 4B43A 2OUKA 4QOSA 2BM1A 1IOZA 1VIYA 4D0NA 2BBWA 3WNCA 4DT1A 4AURA 3VFDA 2O0KA 2CHVA 2DFNA 2VP9A 4BFXA 1J8MF 2OAP1 4KAXA 4Q1BA 1SVWA 1G5TA 4OHYA 4AIIA 1P60A 2J0SA 1TNDA 1M74A 1W4CA 2ZITA 3PG5A 1YR8A 3OIVA 4PSAA 4LJ6A 4MKGA 3QKRA 4M9SA 2F55A 2ZRAA 3EA5A 3T61A 4MKHA 4UJ5A 4WZAE 4GT1A 3CZQA 2VP2A 2V1XA 4V0NA 3TH5A 2JEOA 4B3DA 5FR2A 1GNQA 4LHXA 1ZM7A 3QUSA 1E6CA 2BKUA 4R2HA 5FI0B 1G7CA 3VNVA 3T1VA 3OIYA 5FUYA 4BPBA 3QKSA 3TUIC 2QMUA 2P3SA 3HP1A 3SBEA 4DDTA 2V3CC 1GP2A 2RGBA 3A8TA 1D9ZA 5CM9C 4ILEA 1UFQA 3ZD7A 4TQAA 4TTQA 1I4DD 1ZMXA 2R2AA 3THWB 1BH2A 3ECCA 4E22A 4CT5A 4B35A 2JLXA 4OKSA 4L15A 4MDEA 2XNDA 3Q7PA 4IDOA 5JHGB 3KDSE 5EE1A 4DDUA 1FP6A 3D6TB 3ZZ0A 1KI7A 3Q9LA 3WMGA 3VNUA 4K46A 2FDCA 3TUZC 3C5HA 1ZD8A 2J0VA 1ZD9A 4Y0AA 3QXSA 5FBQB 2GJ8A 3Q8XB 3KFVA 1AGPA 4IVRA 4MRNA 1OXTA 3AF1A 1SXJA 2WV9A 3FOZA 1Z29A 4CT4B 2BCGY 4NCKA 5P21A 1QVRA 2Y8EA 2FPKA 2AK3A 2WMOB 2EFEB 3GLGA 1WA5A 4DCSA 4C7OB 721PA 821PA 2WKRA 4GL2A 1RPZA 1J70A 5IK2A 4AC9A 4N0EA 3OIWA 1COWA 2IEZA 2IYTA 1E4VA 1Q12A 1OYYA 2VSXA 3PUZA 4V0ME 1Q1EA 4YMUA 4Q7MB 4DLYA 4JVMA 4A1FA 3PFIA 1TMKA 3ND8A 2HLDA 2QP4A 4JVNA 5JI3E 1OH5A 1L2TA 2OO7A 3LAWA 4LWZA 1VDZA 1SVSA 2BV3A 1Z6YA 4W5WA 3LBIA 2Q6TA 1AJEA 2JLZA 2YC2C 2HCJB 3MWLA 1CR4A 2VSFA 4I1OA 1E96A 4HUTA 5IHPA 3U7HB 1AQUA 4FMDF 4YC7A 4IRUB 1EESA 4MRSA 4GOJA 4QBFA 1OSNA 3LFUA 1Q57A 4HSEA 4LY6A 1IN8A 4O2RA 4URUR 5AWFC 2P67A 1BMFD 2IYRA 4A4DA 2G0TA 1X1RA 3R9IA 2QL6A 4JS0A 2GK6A 5KSPA 5C46F 3EPKA 1U81A 3E5HA 2ANBA 3EZ9A 4JT2A 3ASZA 2Z6VA 3AGPA 3RDPA 3GPLA 1DAFA 4F92B 3PEWA 2CMKA 4UNQA 3MSXA 2OLKA 3THWA 3AM1A 1N6KA 2EFDB 4KO8A 3T1OA 2FV8A 5SZKB 2RAPA 4O25A 2FFBA 3P4YA 1H65A 3GJ8A 2XB2A 1W0KD 4TT3A 3B13B 2C2HA 4NCHA 2WSSD 3HU3A 4BLTA 2GA8A 3BBPA 1ZU4A 4TSFA 1SVLA 4KBFA 3UATA 2ZI5A 5C2JB 1G3MA 2J7KA 2CJWB 2OXRA 5JS7A 4YXWD 4MKFA 3PITA 1KDPA 3D8BA 2VF8A 1QHYA 1CP2A 2XOKA 1XXHB 3LA6A 5E3HA 4QG7A 1E9SA 4YMSA 4PPQA 3VKGA 3FHOA 2PCLA 3GMTA 3BXZA 3OHMA 3TBKA 2RH5A 2RGEA 3AF0A 1YZTA 2V55B 2NPFA 2DYKA 3UWKA 4DZZA 4C7OA 1D8TA 3Q3JB 1XPRA 2WWWA 3TMKA 4L8GA 1TQ2A 5AUPB 5DNYB 1JPJA 1VCOA 3NHBA 2CCJA 4GMDA 2VP6A 4KBGA 3TAUA 1KO1A 1XD2B 1W1WA 3KUCA 3IIKA 4F4JA 4RFSB 2ZJBA 2ZRKA 2GRJA 4URVR 4F91B 4YDHB 4I4LA 3L0IB 1FX0B 3CX7A 4ZCMA 3GJ0A 2YOFA 4B44A 2CDNA 4UNPA 2GAOA 3RRMA 1FW6A 2IYWA 4MRVA 2QE7A 5CLQA 3K9HA 3TR0A 4AYWA 2HT6A 4IW3B 1UADA 2IYXA 1N3BA 1NJGA 2GZAA 5LBIA 1NBMD 2ODWA 4HB2A 4RVCA 2QN6A 3K53A 3OAAA 4B76A 4PC1A 2GESA 2WM9B 2C5LA 1BOFA 1Z63A 1DVRA 1E1RA 1TAGA 3KQKA 1FNMA 1IN5A 5EUMA 3KB1A 1PVOA 4M9QA 1G3QA 4XSGA 1SQ5A 3M0EA 2C77A 2P2LA 4F38A 3RS4A 1U9IA 4U7DA 3HPRA 4XVRA 3WNDA 3IGFA 2JJ1D 2JLUA 1N0VC 2AK2A 2ZRMA 3DDCA 4HZUB 1XB2A 3QJYA 4JJZA 4S2EA 2ONJA 3V00A 3VKWA 1FMLA 4G3XA 5JWHA 1E2QA 2AWNA 4DEYA 3PIRA 3C4JA 5FL7A 4OHXA 4F7WA 4DDWA 5KSOA 3U6BA 5F9HA 2EYUA 2BBSA 4Z8YA 4D82A 2AX4A 2CJWA 3SYNA 4Z51A 1R5BA 3RWOA 4AG6A 4NHOA 2ECKA 2NQ2C 2WZQA 4W5HA 5HZHA 4AKHA 1P9NA 2AD5A 3K70C 3GLIB 5CDFA 4LV8B 4L9WA 1DBSA 1MKYA 4OYHA 2V7QA 1QHXA 2JAQA 4LHVA 2IHBA 3A36A 3CR7A 2NPIA 1W5SA 3QVVA 2XJ4A 1N5JA 2ZRJA 1HYQA 3C16C 2MMGA 1NL3A 1IY2A 1Z07A 1CJVC 1K6MA 4I1UA 2JGNA 3KL4A 2IX3A 4C3ZA 1XD2A 1G19A 4M1SA 2R8RA 1NVUQ 3AQ4A 1ZINA 4KFUA 4KYUA 4RFSA 3VHXA 1DEKA 3SQWA 1Z6AA 2WJJA 3VX3A 2WPDA 4MA4A 1IONA 1FX0A 4NONA 4EUNA 4ESHA 2F3TA 2ZIAA 5TXGA 2JATA 2EFHB 1QZXA 3VKHA 3FHTA 1G17A 3KKMA 2ZI6A 3SHWA 1KY2A 3FPAA 1KZ7B 2P5SA 4IDNA 3TQCA 1ESMA 2QPAA 2GXUA 4LOAA 4P3YA 2I3BA 3GFPA 4BLSA 2YWFA 3PVSA 5JLJA 3PJRA 1CR2A 1G4AE 2N46A 3NBYC 2ZR0A 4TYQA 4KITB 1ZRHA 2XNSA 1OFUX 1NMYA 1R7RA 2A5JA 5E7IA 3VX4A 4EFMA 2JIZD 1GAJA 3AV0B 1DO2A 2WICA 3SN6A 1W4AA 1FZQA 4OK6A 3AVVA 3B5JA 4D2IA 5DI3A 1M2OB 1HE1C 3QXJA 3W8RA 1G7TA 1LS6A 3BWDD 4HZUA 1VYVA 4UNNA 3TW8B 4MRRA 4JL5A 4EJSB 5FPYA 2QTFA 5B2ZA 1F48A 2PCJA 3ZVMA 5A4JA 2NO6A 3A37A 4Q01A 3I8XA 5DIFA 4S35A 4TTRA 1MO4A 3B6EA 1A4RA 4C0HA 3QNUA 2ZI9A 3GLIA 3RC3A 3GEIA 3PEVA 5GADl 4GOXA 1Z2AA 3X1WA 2RGNA 2AFIE 1II0A 2MSCB 3PCRB 1UDWA 3T5DA 2TMKA 3QEOA 4BZXA 1R8SA 3RANA 4JSTA 3AVUA 1CEEA 3WP1B 3PXGA 3KKPA 3CONA 5DN6A 3NC1C 3Q72A 5AJYA 4NZYA 1E0KA 1OLOA 1PJRA 2IW3A 4HDOB 4OJQA 3U3MA 1E2FA 2XSZD 4RD0A 3ETLA 5DYIA 2FN4A 1G1MA 1J90A 3RABA 2ZE5A 1N6NA 3FB4A 4JZKA 4RZ3A 4B3FX 3I32A 2QG6A 2X77A 1ZUHA 4KLZA 3F3YA 4RD4A 1ZCBA 3EW9A 3CX8A 2FSHA 3I8SA 3SR0A 2G0NA 3MJRA 3K0FB 4XTRA 2H18A 2A5GA 4Q1AA 4NYIR 4UXJA 2B92A 1KKLA 2HDNB 1WF3A 2ZJ5A 4DLTA 1XPOA 2GJ9A 2QQEA 4GP6A 1TF2A 1US8B 1F2UB 2IYYA 3ZZTA 5KU1A 1WBBA 2E87A 1XJCA 1QHHB 621PA 5EZ6B 3CUEF 2W00A 4BECA 2XGJA 2FFHA 2VQSA 4HAZA 4M1YA 1ELOA 4QGFA 2YYZA 2W2VA 2J87A 2GJSA 5CK5A 4NL4H 3KXKA 1H8HA 1TF7A 4BRWA 4MUBA 2R62A 3FDIA 4C9BA 4DLZA 2C99A 5GVSA 1UJ2A 4Q02A 1GIAA 2XNDD 1LNZA 4X8LA 2HYDA 2QA5A 3AP2A 3IPXA 1BMFA 1E9BA 2CHGA 3DMNA 1KI8A 3ZVNA 1UEJA 1G9XA 4EJSA 4MGYR 2IXEA 2PJRA 1R0YA 1OFTA 3ZYCA 2A78A 5BYJA 3QEJA 4CIDA 1UF9A 1JAHA 1KJYA 1FTNA 4DUGD 5BXQC 3AF4A 4M9ZA 5EP1A 1S9DA 1KI9A 3H84A 5AJVB 4LHYA 4RKEA 2VHTA 2BDTA 1W0KA 3ZIAD 5KSZA 2WWFA 5FL3A 1ZC4A 4OQFA 2A5YB 3EC2A 3A6PC 2Z4RA 2BMFA 2MSDB 1YZUA 2OAQ1 1PUIA 3EWSA 1COWD 3RSOA 4M1KA 1GILA 4YXWA 5CIQA 5EXTA 4B74A 2HJGA 1W49A 1A7JA 1NLZA 1AGRA 3ZVLA 1VYUA 1MT0A 2VHUA 4TYNA 3OEHA 2HLDD 3F0TA 1SKQA 2VP4A 1RVDA 2AL7A 2J5XA 4A8JB 1AS3A 1P7CA 2QPOA 2WAYA 5EP2A 5LDDC 3VU9B 1PLLA 4P33A 3EARA 4ZDKA 4M0LA 1KJZA 1NVVR 4LJAA 4TMKA 3SU8A 1YZLA 4HYYA 3AB3A 2ZJ8A 5LB4A 4BQSA 5AUNB 2FE4A 3B1VA 4IHQA 2ZE6A 3IIMA 3TGPA 4LUCA 1KZGB 2PX3A 1GKIA 2VTKA 1SXJC 3SYKA 1W4BA 1RC8A 4D26A 1US8A 1F2UA 3EZ2A 3PUXA 4JJKA 1D5CA 2OESA 4Q9HA 5GVRA 3ZQJA 1XTJA 4PHTA 1QHHA 4B32A 1II9A 1Q3TA 1U0HC 5H68A 4HAYA 2J45A 4LV5B 3O8DA 4QBHA 4P0TA 1KO5A 3A1VA 4Q9IA 5FTJA 1IY0A 1NBMA 2KJQA 2ZUBA 4G01B 5HTKA 4URWR 3K09A 1Z22A 4HLQB 2J0QA 2PL3A 1TL7C 4D4JA 1GFIA 1UBGA 1Z0IA 1NMXA 3NBZC 3RRNA 3O8CA 1UKVY 4JLVA 3T15A 3IILA 5C4MA 2O52A 1W2HA 4R7ZA 4FCWA 5FOXA 3HYTA 4LK2A 3IBYA 4Q00A 1R10A 2K5UA 4TMZA 1SKYE 2A3RA 3QG1A 1GZSA 3THXB 1E2HA 1G4UR 2XOKD 4PAQA 4PR0A 2PEZA 2VP0A 4EPVA 2J7PD 1TQ6A 5JCPA 2ZJYA 2GEVA 4YLGA 5B58C 4Z8XA 5H8WA 1UBFA 4JMPA 2OE2A 4F4CA 3U44B 2FZ4A 4GMXA 1AA9A 3TVTA 4LBZA 4B3XA 3QIAA 2X8AA 1GRRA 3FMIA 4OJKA 4B3BA 5KDOA 1Z0KA 3SS8A 1S3SA 2GNOA 1L4UA 2HF8A 3B2EA 5GJWC 3DKVA 4XWOA 2GHIA 3LX5A 4XTCS 1XDBA 4NYMQ 4TQUS 2PT7A 1X8LA 2QT1A 4B2IA 3OEED 4A8JA 5E7JA 3CIOA 3NVAA 3VU9A 1CTQA 4DVGA 2FU5C 2A30A 5AR1A 2GEUA 2Q9CA 2QE7D 3I61A 1FUKA 4JL8A 4LYHA 4BASA 2OM2A 3HDTA 3NKVA 2AHOA 3BERA 4C0JA 2AKYA 4X8OA 5CIWA 3VR6A 4A0HA 2QU8A 4FXPA 3IHWA 3OAAD 3SYLA 3WMFA 3WHLA 3WYGA 5SZJA 4CF7A 5KNDA 1WQ1R 1L7VC 1E1RD 3R8FA 2XZPA 3AKYA 1HV8A 1YZGA 2WWHA 4BWYA 2CL6X 2FF7A 5HE8A 2FPLA 4B3CA 1GOTA 5FPKA 2IK8A 1P6XA 3EX7C 3T5GA 1NRJB 2I1VB 1P3JA 3RVBA 1Z47A 3CNLA 4ACAA 1XEFA 4PPFA 2IWRA 2QY9A 1CJTC 4NCJA 2C98A 3C41J 3QPWA 3PUYA 2ZE8A 5FL7D 5JBQA 2RB4A 2FPMA 1E9CA 1XMSA 3EZ6A 3ADCA 1ZM3A 1YE8A 1E2MA 2OCBA 3P27A 4I99A 4HLCA 4XVUA 5J4VA 4KFSA 4US0R 4L16A 2QUZA 3THXA 4C2UA 4TMTA 2JLSA 4HAWA 1NLFA 1T8TA 3W34A 3MLEA 4W5JA 3LRPA 1DARA 2V7QD 1XTKA 4TLCA 3B9PA 2KI5A 5JJKA 1NKTA 1ZIPA 4WW0A 1GL7A 1S2MA 3T1QA 3CBQA 3IUYA 4EPWA 3U44A 1F3OA 3PV0A 2QRZA 221PA 1YQTA 2QENA 3O47A 3QBVA 4FMBB 1II8B 2JA1A 3LBNA 2FEOA 6Q21A 2X1VA 4IVPA 2NTYC 3U3KA 3CW2A 1BYIA 3NH9A 5D3MB 1CKEA 1U9IC 4DCTA 4I1VA 4PQYA 2WPDD 2BVNA 2NO9A 5G3YA 3X1XA 1KY3A 2WIAA 1HEIA 3GCGA 3P1JA 421PA 1SVKA 3AEZA 1CJKC 1M7HA 2CXXA 1YHNA 4PQFA 2IUTA 4BEBA 3A4NA 1TU4A 5FUWA 4ABYA 1E2EA 1KSFX 1FPMA 2XSZA 1HUQA 1NSFA 1MO3A 1OE0A 2NIPA 2OFXA 2V6JA 1LF5A 2ZYTX 5ANRB 4QJ5A 3H86A 3LXXA 2WSMA 2A5FA 2ZUCA 1M7BA 3Q5EA 1N25A 4PHHA 4Q19A 3A4MA 3I4LA 4C2TA 1TU3A 3F8TA 4PX9A 3VR3A 4DLUA 1U90A 3TIFA 2UZIR 4LGMA 3LBHA 5CYOA 4RD6A 4ZKDA 1XNJA 2D62A 3I73A 3BH6A 1T6NA 4UNRA 1OXSC 2ASEA 3EXAA 4LZZA 1Z0JA 1NI3A 4IEIA 1RE0A 4XVQA 1MABA 1L8QA 5F98A 4Z54A 2EFCB 4DIDA 2BEJA 4BFTA 4CGZA 4BEJA 1LW7A 4P4UA 4AKEA 3QKUA 3U61B 1OH8A 2NZJA 4Q4HB 4RKFA 2FH5B 1GDDA 2VHQA 5KSYA 3WYFA 2ZRGA 1W36B 4TLAA 1C9KA 4PC7A 4HATA 3T34A 4PO1A 1QHIA 1NG1A 1N6LA 1Z6GA 2OCAA 3UG6A 2ZU6A 4N3NA 3CO5A 4FIDA 5DN6D 2CLSA 4D4LA 2QMHA 1KI1A 2WJHA 1MOZA 1Z83A 2R6AA 1II8A 3U5ZB 1I4TD 4RD3A 4DUGA 1JXMA 1Z0AA 3GJ6A 3L0PA 4A2WA 4IXNA 1HH4A 4E09A 2PBRA 2R6FA 5D3MA 3IDQA 3ZIAA 2BM0A 2KBEA 1HT1E 4FWIB 1ZM2A 2Q21A 1TADA 1U0LA 3KJEA 4WZBE 2R6GA 1KK2A 3P4XA 4WOPA 4YQFA 2C04A 4JBXA 2GDJA 1D2MA 4RCZA 4PPGA 2GXAA 4JVLA 4LHWA 1HE8B 5CYPA 4ZI3A 2ZRFA 3QKTA 2WKQA 4OBEA 5JCZA 3QY0A 5D3QA 1B0UA 1PV4A 5AK0A 3KJGA 4NKRA 3BFVA 3BAFA 3GFOA 3K8YA 1A82A 3DO6A 2D06A 4ITRC 3B1WA 1U8ZA 1Z6TA 2C03A 2XAUA 2DR3A 1JECA 4DLWA 3ZVRA 1H8HD 2I1QA 4TL7A 4ZDWA 4TZ0A 4WBSA 3JVUA 3V9PA 4EIWA 2IS4A 2HEIA 2OG2A 5JJLA 1KAOA 1HY3A 4X8HA 4FINA 1AM4D 3THYB 3SDZA 2XITA 4IOKA 3CRW1 2VO1A 1ONBA 1Q1BA 1G291 2IYUA 4QFMA 3D3QA 4B73A 2WIBA 4ZCLA 3AVQA 4W7SA 1OB2A 1P2TA 2AD1A 2JDIA 4ARZB 1JR3A 3MMPA 1BS1A 3FYHA 5JWOA 3WBKA 2OFWA 3C15C 1BKDR 4Q4HA 2QAGB 5B57C 4PZYA 2D7CA 5IDVA 2CEAA 3B1YA 4TYPA 1OKKA 2FJUA 2NZ8A 3K9NA 4EFNA 4HLDA 2FGJA 2WOJA 4ZDIA 1XD9A 2F1HA 4V0LA 3SNHA 1N6PA 1VG0B 1MR3F 1S0UA 3K0SA 2GBLC 1DELA 4DXAA 1Z0DA 2WWXA 3KJIA 4IOMA 1S1MA 5DHAA 5C1BA 2J7PA 3OEHD 5FBRB 3QXXA 1PZNA 1W48A 2RMKA 1TQ4A 3MGCA 5AJZA 3W8NA 3W90A 4P31A 4HAVA 4URXR 2ZVQX 1Z06A 1CJMA 4O3MA 3GEHA 1DO0A 1QHSA 1SVMA 1T9HA 2JCSA 5FOUA 4DSTA 4DKXA 4JLDA 2DWQA 2QT0A 3AVOA 1QHGA 2ZTSA 5KDLA 2NO1A 3HWSA 4D0GA 2WBLC 3OEEA 2B8TA 1Q0UA 2GTPA 3W6PA 2C8VA 4E07A 5DLQC 4G5SA 1A2KC 1TEVA 1J8YF 2WOOA 4MYCA 3RHFA 4A2PA 2WJIA 3L0SA 3GJ7A 3FWYA 4FMCF 4LJ8A 4Q21A 1SHZA 3QPVA 4RFVA 2XB4A 3FVQA 3RNLA 2IBMA 4MGZR 3WRXC 3CRRA 4KHZA 4TL6A 5L3RA 3T12A 3BOSA 1W2GA 3E2IA 4RY2A 2ZAOA 5EE9A 4CDGA 1FFHA 3RRZA 3KB2A 5C18A 4PQRA 2QNRA 2JLYA 4ARZA 3BFKA 2IYVA 4MYUA 3R9WA 2FGKA 1A5TA 4OHZA 4N1AA 4OQMA 3SOPA 3IQWA 3AH8A 2QMOA 1XMIA 4GDFA 3S1AB 2JASA 3CWQA 3QENA 1BYUA 2P0EA 1ZM4A 2ZRCA 3BS4A 1A1VA 5JJIA 2Z4SA 3EPLA 1T0JB 1NNEA 2P6RA 4DB4A 3UPUA 1ZCAA 3WRYC 2QM8A 4A6XA 4P4TA 1G21E 4B6EA 1E2NA 1S3GA 2CLCX 3UXMA 4DSUA 3CH5A 1N2CE 1XXHA 2RKOA 1YKSA 4U5XA 1JPNA 3AUYA 2YJTD 4KLNA 4TZ6A 3ZQ6A 1TX4B 2YWEA 1MO5A 2ATVA 2A9KA 1VKJA 1XCGB 3QVUA 1W0JA 4DWJA 2BBOA 1XF9A 2FA9A 2O8CB 4JLPA 1P5ZB 4NYJQ 2OFOA 1RJ9B 5G53C 1GRNA 1U99A 4M1MA 5FPHA 3WY9A 1G7RA 1I4LD 1XX6A 1ZM9A 2GVDC 2X2FA 1KSJA 3BC1A 4KVAA 4JLNA 1JQLB 1ETUA 1FQKA 3X2SA 2AKAB 5E4FA 5L3VA 5J5CA 3L8ZA 2XZOA 1R0WA 3IEVA 4ON9A 4M22A 2CCKA 2GXSA 3RYTC 3UIEA 1UPTA 2BOVA 5BN3A 3EIEA 1NG9A 1NY5A 1G7SA 3UMSA 3C14C 1NSTA 2F3RA 4KV9A 4PC3A 4Q4JB 1JNYA 5J4LA 4BFZA 1UKZA 2YOGA 1WCV1 4RZXA 2H7VA 1Q3HA 2W6IA 3GLFE 5DHFA 1RRFA 5DI9A 2C78A 2EVWX 3SFVA 1AKYA 1RYHA 1VPLA 5CJPA 2ZSDA 3I72A 1LVGA 2CVHA 3MWKA 4A8JC 4EAQA 5KNBA 4TMXA 1KI6B 1SVIA 1VHLA 2EQBA 3CB4A 2JLWA 2FSIA 3GFTA 1UKEA 1KNQA 1EX7A 1VTKA 5FBLB 4ACBA 1XJ0A 1EFCA 2V54A 1ZU5A 3FKQA 5FUVA 3S1AA 2GVZC 2KBFA 1R8QA 1Z08A 1EFHA 4LYFA 4QBGB 4OI1A 2IF2A 5FTNA 4U00A 3W3AA 4JLBA 4OI2A 4X8MA 3LVQE 4MRPA 2JJ2A 1M34E 4L5BA 1KMHB 2JLQA 3ND9A 1E9EA 1E69A 1ZVQA 1CU1A 1YJ5A 1C4OA 3VHLB 5TB5A 5IRCD 1IN7A 2FNAA 4JKIA 4XWKA 1ZNZA 1WE2A 5FR1A 1QG2A 1OXVA 3G5UA 4KYIB 3N2IA 4HLUA 1PLKA 1HA3A 2PMDA 1E79A 4HAUA 4N0DA 5DH9A 3QSYA 2O8CA 3EG5A 4CRWB 3U2QA 1E32A 2ZJ2A 4TQ9A 1RJ9A 3M4YA 3AKEA 2QGNA 3IIJA 3VR2A 2WWIA 4NCNA 4MGKR 2W58A 4TMWA 2MSEB 4Z1MA 4C4PA 3K1JA 4ZI2A 2HT1A 5KOYA 1DE0A 2ZR7A 3LH5A 3CX6A 3B82A 1GVNB 4LYJA 1KMQA 2IF0A 4XWAA 3TNFA 4JBWA 3CNNA 2EW1A 3U3JA 1G6OA 3NEJA 3AVTA 1FP7A 121PA 1GSIA 2D2EA 1IM2A 4FWTA 3MFYA 4DDVA 1UAAA 1GRQA 1YRAA 3NDPA 2Q9AA 4QM6A 2FFAA 2NGRA 3QOFA 4V0MA 1EXMA 2XTMA 1KDTA 1RYFA 2DPXA 5KPJA 1OHHD 3FTQA 2IWHA 2VH5R 3ICQB 1G5RA 3SC3A 1Q44A 1EWRA 1GG2A 3GD7A 1E0AA 2X19A 1KI6A 3GJ5A 3GEEA 5L8VA 1R2QA 4UNSA 3BE4A 4D4KA 2NMVA 1T3HA 1ZIOA 2ZR9A 3DEFA 3L2OB 2X2EA 3OFNA 5KYKA 3LLMA 5IF9A 3O8BA 1YRBA 4M1WA 4URYR 1IXSB 1UBEA 4D0LB 3W6NA 4KSBA 2O8EB 3HJNA 2OHFA 5C4GB 2FWRA 3KKQA 3P20A 4RSGA 4PSKA 1KDRA 2CNWD 1EGAA 5F2EA 1J2JA 2G88A 4BFSA 1IXRC 2O8FB 3H1TA 2GCPA 3CPHA 1ZNXA 3GJXC 1KMHA 3ONWA 1W44A 1MH1A 3BRWD 2N1BA 2JLVA 2XXAB 2IYQA 1EFTA 3V4RA 1Q1ZA 4PAMA 1GL6A 1E0SA 1QDEA 1SXJE 2D2FA 3QBTA 4LSGA 4YMWA 1CBUA 3WMEA 3LWNA 2ZQ5A 4HEJA 3CF6R 5DSZA 4ERNA 4O2LA 4ZV4A 5FTMA 2A2ZA 3WHKA 2DFLA 2NOAA 1F2TB 1SZPA 4AY2A 2CL7X 4JYBA 4LX0A 2WTUA 2ZSAA 8OHMA 5A5GA 4LV6A 3P32A 1P9WA 3NWJA 2ZRPA 3ZDQA 5LPNA 2F6RA 1H8ED 5LD2C 2G77B 3IHLA 3TAHA 1RW4A 1T0HB 4HUQB 2HYIC 2EFGA 2VA8A 3JVVA 1E1QD 1OXXK 3K0FA 3QE0A 4PTLA 4TN1A 521PA 3KQNA 3REFA 2W6JD 5JHHB 5EZ5A 3ZD6A 3MRSA 4JIMA 3BB4A 4ZPXA 2IXFA 3LQRA 3NG1A 4TL9A 5JRZA 2YWHA 2J0UB 2RHMA 4IVQA 2PLRA 4D81A 4LBYA 4IDHA 2C96A 3DM5A 1DOAA 2ODBA 3FHCB 4F93B 2V1UA 1EFUA 1AZSC 2OBLA 3CPEA 4LJYA 1OW3B 4QNRA 3WBJA 3KQHA 4JT4A 2LWIA 2JDID 1XCMA 2HUPA 1JR3D 4Q66C 2G1JA 3BORA 3LQQA 4RD1A 4Q7JB 1CXZA 3UMRA 1E3MA 2OILA 1W36D 3EC1A 4Q5IA 4Q47A 1KNXA 4PHGA 3I5YA 1OKKD 4PSVA 1S1CA 3HYRA 4EPXA 3A4LA 5JEEA 4NBSA 2VF7A 4JBYA 4OK3A 4ZCIA 2O8EA 3AVPA 3AP1A 3RS7A 2REXB 5EE0A 1JI0A 1P61B 1TUIA 1N5KA 1YVDA 1Z0FA 4B34A 2O8FA 4M9XA 4D6PA 4DSOA 3AUXA 5GJBA 4PZLA 4KFRA 1Y63A 4BLOA 1UDXA 2XXAA 4M8NE 1N6HA 4QJ4A 4OHVA 1OH7A 2ZRIA 1IY1A 3I3SR 2H16A 2WKPA 3RC8A 2R65A 2DY1A 1S96A 1ZUIA 4EKDA 1PLJA 4ESVA 1IJFA 2IYLD 1K8RA 3KXLA 3KQLA 2REBA 4IOJA 3FGNA 4QM7A 2J1LA 3FFBA 1F5NA 4YONB 1OH6A 1F2TA 1KAGA 4A9AA 1NN3A 3C7KA 2WMNB 3R9XA 2W2XA 2RGXA 2IT1A 1LS1A 2H8KA 1VG9B 2D3WA 3A1WA 3TQFA 1M1YE 3NC0C 5JEDA 1OT3A 2P6NA 3LO5A 1T5LA 5H70A 1X6VA 5TDHA 4AI6A 1LY1A 2G1KA 4HUQA 2GZDA 1WXQA 2CK3A 1ZUNB 2WJYA 3EA0A 2VSOA 4MYTA 4KI0A 4IXMA 4LPKA 1Q21A 5EJEA 5JFGA 4OHWA 2W0MA 1F60A 3RSLA 3H0KA 2DHRA 2WHXA 4A15A 1E2PA 3AGQA 2Q9BA 2J0UA 1GKYA 5EE5B 2ORWA 1N6IA 3BFXA 4P4SB 1QBKC 1IN6A 5HKKA 1YR6A 2BC9A 3K9LA 4TTPA 1D2NA 2VIIA 2ZE7A 2R6CA 1O87A 1CJUC 2YC4C 2YZ2A 2IA5A 2WJVA 1IJEA 1G18A 2GEDA 2LCFA 2PEYA 1P9RA 5JI2E 1XJQA 2YVUA 1R4AA 2ZSFA 1E9DA 4UQOA 3ZJYA 1D9XA 5H1YA 4POAA 2GJKA 5BQ5A 1OFHA 4IKEA 4IJMA 2IHYA 3QF7A 4URZR 1VHTA 2BBTA 2ZJAA 3KKNA 1CF4A 2EU8A 3RS2A 5HCNA 1ZBDA 2OEPA 1DPFA 2KWIA 2ZYVX 3EZ7A 2ZETA 1XEWX 3M1IA 2O8DB 3FMOB 1UEIA 1OJLA 4PC2A 3EZFA 2PX0A 1GKUB 3A1TA 2BHRA 1NVXQ 4DCNA 4IEEA 1AS2A 3DPUA 3LD9A 2QPTA 5FFMA 2ATXA 5DISB 4BE7B 2PLFA 3K0AB 4AYXA 5E95A 2QTVB 2XX3A 3KZ1E 5FI1B 1W0JD 3EPJA 3I1FA 5HE9A 4O0MA 1N6OA 5CDFE 5ELXA 3BIFA 5JZVA 2N42A 4RCYA 1CS4C 2F9LA 2ZYUX 3ADDA 1E99A 4C30A 1LF0A 1N6RA 2Q0HA 2OT3B 5HZKA 2PZGA 2ZS7A 4RJLA 5FPSA 3WNBA 4GBMA 5CM8B 1GWNA 2BJWA 4G5QA 2IYZA 3AVXA 4GI7A 4RZ2A 2Z83A 4MKIA 4EQ6B 1SXJB 1EG7A 3FKSD 3W5IA 2B7BA 1YZQA 3UG7A 5F9FA 4KSCA 3GJ4A 4LCBA 4US2R 5KPDA 2W6ID 3MJHA 1D6JA 1GNRA 1QF9A 1OB5A 4UKDA 1NJFA 3UKDA 1XTQA 1KK1A 1AIPA 3NXSA 3EIHA 4DEXA 5CB6A 4M53A 1E9FA 1Z8FA 4WXPA 3QXHA 4JLJA 1X86B 4QL3A 2NO0A 1E98A 4K8OA 3TLXA 1KK3A 2LKDA 1JJVA 2O5VA 3LDAA 5CITA 2OBNA 2NO7A 4M2LA 3W5JA 2HF9A 4PO9A 4WZ6A 3VTKA 4BGDA 2ZVPX 3REGA 3HPQA 1ZJ6A 3R20A 4LYAA 2VPPA 4QRHA 3KKOA 2YV5A 1OHHA 1VCMA 3ADBA 1RFLA 1FTSA 2BMDA 4HDQB 3WYAA 2OBMA 2O8DA 4HI0E 3RWMB 3Q7QA 3HU2A 3DHWC 2JJ2D 3OZXA 4MH0R 2H1LA 4NYIQ 5TMPA 1M7GA 3A58B 2HXYA 2R9VA 2UVQA 3B1XA 2GILA 4V0OA 5GJVC 2V6IA 4BZQA 4DBLC 2QEQA 1P4SA 1ZNYA 1WP9A 2OCYC 5K8IA 1XRJA 2FMXA 3U3OA 1DS6A 1KDOA 3K0AA 1KI2A 2ZROA 2H5EA 4A0GA 3LX8A 4AKGA 5AUQA 1FMJA 3BB1A 1E79D 4QJ3A 4D4MA 2CNWA 3GLIE 3UWOA 1IN4A 4B75A 4BLPA 3LW8A 4IDPA 3PUVA 1E2JA 2SHKA 5G40A 2G9NA 3D7MA 4KFTA 4M21A 4RZUA 4Z1MD 2DFKB 3IBGA 1JR6A 3SJBA 1SKYB 3BD9A 1R0XA 3LW7A 2H57A 1Z5ZA 4DCUA 4OI4A 5KNCA 1AK2A 5SZIA 2KE5A 1DG1G 1G8GA 1Z2CA 2VP5A 3NBFA 4HB4A 1WDTA 1S4QA 4LJ7A 3RS5A 4BZPA 4WIAA 3AVWA 4AKIA 1X3SA 3U7FB 2XTZA 3IPYA 2ZUDA 3K9GA 4EQ6A 1RRPA 4TYYA 3VMFA 3N70A 1XTIA 3QXCA 3B8HA 1G16A 3NH6A 4LJ9A 2I4IA 5FTKA 1E9RA 3QG5A 4BLRA 3DMDA 1M8PA 2CLDX 2ZM5A 4Q7LA 2IS2A 1H8EA 4R98A 2V9PA 3K0CA 2VYFA 4Q1FA 3C5CA 4C0KA 3PEYA 2IS1A 2RGNC 1E2KA 2FSGA 2VRWA 2QP9X 1BO6A 2HV8A 3TK1A 3VR5A 2XEXA 2QGZA 1DAMA 1E1QA 1DADA 3TW4A 3W3ZB 1FOEB 2V4ZA 1NVWQ 3FE2A 3L8YA 4HLUC 2W6JA 2YINC 3CM0A 5AUOB 1ZAKA 4Q7KA 5J40A 3OFND 5L3QB 3FMFA 1Y3AA 1P2UA 4NCIA 1GITA 3ZLJA 4QGGA 2GJAA 1PUJA 1ESNA 3TSWA 4Q03A 4BUJA 2DWPA 1AZTA 1K5GA 1XTRA 4TLDA 2GK7A 3U7EB 1QG4A 4Q1CA 4A0RA 4DLSA 4NE2A 2ONKA 5M04A 2J59A 1NVVQ 2QBYB 2BEKA 2PZFA 4PO8A 4B2PA 3ADKA 3QQ5A 3SZRA 2EYQA 4M1OA 5AJXA 3U7GA 3EIQA 3KFXA 2QP3A 3THOA 1TTTA 1U94A 3T06B 5JSZB 4ASUA 5BWMA 4JSYA 2P6UA 5KHOC 1YZNA 1V5WA 1U2RA 1CR1A 3GLHE 4GP7A
chains in the Genus database with same CATH superfamily
4WY8A 1QS0A 4XB1A 4B7ZA 4EG1A 3F3SA 4US1R 2Y6UA 5UKDA 2VYND 1GNPA 3KZXA 1BIFA 1KU6A 3NDRA 3OCUA 3GJZA 1N3YA 5AM1A 4I7EA 2G6TA 2WWGA 4MIYA 3X2FA 3ET5A 2AN9A 4V02A 3T35A 1NVMB 4QDXA 3WWZA 3CHYA 2P79A 3IT2A 3F5FA 4ZJPA 3R6WA 1YB1A 1ZHOA 1W30A 3DW1X 2DULA 4G63A 3HYCA 1D4AA 3F5QA 1BROA 3PHBE 1QTNA 4OLFA 3LF1A 4L08A 2A7QA 3STVA 1NLYA 4AKSA 3HCOA 3QHQA 4IG9A 2OLEA 2P5TB 5J63A 4R5HA 3FCCA 1AD2A 4K3UA 4TLBA 3Q85A 3GQBB 3WGOA 2LKCA 2YUTA 4N76A 3LFHA 1VIAA 1DAKA 3IR6A 1JZSA 1PT7A 4LOIA 4C20A 1ZH6A 3C39A 3AW8A 5I7OA 5LXTF 3C3BA 3AKZA 4ER5A 1IFXA 1Y3DE 2ATEA 1KJWA 2ZQYA 1P72A 3LLUA 4Y2UA 3SSOA 3G0BA 1IOVA 2W2QA 3UGTA 3EASA 3A11A 4Q48A 2HJVA 2JGMA 2VDKB 3NIBA 1GQQA 4BB9A 1CY0A 4KQWA 5AHOA 1C1XA 1SPBS 3H9EO 1RKBA 4ZCPA 1OFIA 2J9ZB 4QATA 2WJAA 3MVEA 4J49A 4U7GA 3EPHA 3NBXX 3I5MA 4MJ3A 4LJ4A 5CLLA 3B7GA 3JQ9A 1ZC3A 1D2HA 1S7GA 1TT5A 3EVBA 1JGTA 4FCVA 1JDZA 2DAPA 4RCVA 4FYWA 1G64A 1V1RA 4I5EA 3D1JA 1D07A 3H2YA 1M2HA 1YU9A 4GECA 3T9CA 5L3QA 3ZHCA 2FPGB 3IT1A 3OM8A 5KTOA 1V7PC 1XZFA 3QVOA 3FWPA 4BQIA 1E5XA 3P52A 2MMCA 4D9JA 4NBNA 1RRVA 4HQLA 4BVBA 4D8TA 4WZZA 5CNKA 3TW0A 4IZHA 5HS4A 1NBME 3VA7A 4HV4A 3SBDA 2VQ3A 3DXYA 4A0FA 2RGGA 2OZVA 4PEVA 3AJ8A 3PENA 3MJDA 4R2XA 3HVIA 3ICVA 5DO9A 7AT1A 1RI2A 3F9IA 1D1PA 4LJLA 3BWEA 1KTVA 3IALA 4B82A 1FYFA 1UXHA 1VL8A 1YB2A 3R76A 4AWXA 1A7UA 4BEVA 3CLUC 3NETA 1CULC 4F8JA 5JSZA 1SUIA 4R1TA 3D3JA 5JCOC 4FFOA 3TPFA 1N4DA 4P22A 4S1VA 2GF0A 4TLEA 3IIIA 4MGHA 5G3ZA 3VVCA 3ZGXA 3KEFA 2QHXA 4B47A 3FDXA 3TGLA 2D59A 5EQDA 1BE8A 1UPAA 3ENKA 4INPA 5FNVB 1C1DA 2Q1YA 2VJYA 3U4IA 1NLMA 2ZT5A 1FNCA 4C7XA 4MEAA 1XAHA 2ZWMA 2AC7A 5F7XA 5IVKA 4BGVA 1D2GA 1DAOA 5FI3A 4UMFA 3W6OA 5TQ0A 1GTVA 1C4KA 2HF7A 3D8HA 4FJ0A 3NDIA 5AXBA 5H80A 4NMMA 4EBFA 3F4BA 1RWWA 2FOIA 2WP8J 5EXSA 4ZEOA 4F3TA 3K09C 3RREA 4KIJA 2EIHA 3I92A 5BN4B 4XIYA 3RRJA 4MYRA 2P2CA 3H1GA 5DMHA 3ZJ4A 1NF8A 2Y77A 4RNDB 5DTIA 4C5AA 1JQDA 2PMKA 3L1UA 2JHGA 3R5FA 2ZSJA 3L93A 3M83A 4W9MC 1ANKA 3ESQA 3MAGA 4UHCA 1IULA 3WMXA 5DGXA 3DLBA 3GFBA 3HEBA 2C95A 5FLKA 5LJIA 1ZVVA 3T41A 3RT1A 4IV0A 5J47A 2VLIA 3ILSA 1MUUA 5J2UF 1PDOA 2HA0A 2V0NA 2GPSA 4QRDA 2ZRHA 3MAAC 2C4UA 2EBWA 2HI0A 1Z7GA 3L6UA 5JS2A 1UM9B 4ENVA 1H94A 4YT2A 1G20E 4Q0MA 3DB2A 3IVMA 2VRCD 1J06A 4L3WA 1FE8A 4A6PA 2H9IA 4E5UA 4PHFA 5AM4A 1CRQA 3W9SA 4QGHA 1ADYA 3J7AC 2VPQA 3ASYA 2YMQA 1SQ0A 5HP4A 1SCJA 4F9FA 1ZNWA 3BMNB 3NEYA 5NLLA 4NH4A 1PJTA 4PV7A 3PEUA 3L4JA 1L1QA 5FLXA 1A98A 1YIOA 2DWOA 1E2GA 2XMPA 3E48A 4TV9B 4ES6A 4JCOA 2IP1A 1IHUA 3DVQX 3MUFA 4FK8A 4OUDA 2XIJA 4ZMBA 1QO0D 1RTKA 2PT5A 2IL1A 4NENA 2PFGA 1P1JA 5KYYA 1R1DA 3FTCA 1J8VA 2I29A 4M8KA 1XZMA 3VYRB 4MX8A 2R86A 3RK1A 2BMJA 4HN4B 4RV4A 4WDQA 4R0NA 3ZX5A 3AR7A 3LIPA 1UBOS 4E7PA 4A36A 1E66A 3CLTD 1G6HA 1AUPA 2PUJA 1I7LA 5D5HA 2AG1A 4GPTA 3NRBA 2ZSBA 4MGIR 1YDFA 3JAWA 4PYQA 3V1KA 1CY7A 1DEAA 1ZGGA 4FYMA 3BTSA 5JO9A 3TL3A 1YVPA 4CEHB 2J5BA 1E3JA 1SD5A 2IPLA 1CVIA 3HCDA 2P4QA 1V9CA 2NUPB 4NJMB 3FFWA 4OL0A 2FMTA 1G3UA 4L5AA 1JEAA 3ZD9A 1TEHA 4AMZA 2GASA 2QSZA 4JH0A 3OY7A 1QC5A 4UOZA 1ZZGA 3PD7A 4ERXA 2H11A 4JMLA 3KHTA 3JASA 2ERXA 1T29A 4I81A 4KC0A 1OTHA 2ODPA 4MW9A 4BNYA 4TZKA 3MPOA 5JVDF 4LQDA 4M38A 4I0WB 1BGXT 4FGKA 4RZIA 1BDIA 4ZDJA 3FWHA 3LC2O 3T7TA 2QROA 1Y81A 3IUQA 4FOPA 1V71A 1SHKA 2PKWA 1SHLA 3FMPB 4I6GA 3HYNA 1KZHA 4G37A 1WXFA 1UJMA 3NP9A 1EDZA 2AEMA 2KSQA 3R3SA 3CH7A 3QYJA 1Z0ZA 2FZWA 1G8YA 3BTVA 4ND5A 3HE3A 3R5TA 1AKWA 2GCNA 2ISQA 3ON5A 3D43A 2IX9A 4TTAA 3BICA 1G8HA 1BWPA 2F1RA 2GNAA 1I7NA 3FVRA 5JADA 4N7MA 1BE0A 4NDZA 3RFFA 3L7MA 2VXBA 3R3XA 4ZPJA 1XEXA 4Q9JA 5F78A 3UN1A 5KO2A 1GT6A 1GN9A 5E7MA 2BGKA 3DOEA 4YJKA 1D8AA 3G2JA 4QKQA 2C9OA 2R8PA 3BMOA 3MINA 3G0DA 3FWKA 1TGYA 5TEVA 1WV1A 3RRYA 2XTNA 5BN5A 5EWMA 2RGCA 3ZZUA 5DNWA 4QHSA 1DEHA 1VKHA 1ZN9A 1NR7A 4E2FA 1JG1A 3GGJA 2FEMA 1U8AA 2MYUA 4PC6A 4PFSA 2FG5A 3UPTA 4ZGGA 1ZN2A 1Z68A 3OTHA 4PQEA 3NAGA 4C3VA 4DIEA 1RYZA 4MV6A 4AF8A 3KVNA 2XKKA 3D81A 3PPYA 3GDHA 1EX6A 3I6ZA 4CM3A 1YQUA 3LRTA 1Q7TA 2BD0A 2N3ZA 3MCVA 1SKMA 1NR1A 3K9FC 4XJSA 1DEXA 2C5FA 4WGFA 5FA8A 2NG1A 3FRIA 3UWDA 4QPZA 3M81A 4KRXA 3URMA 2GX6A 3T5AA 3WA7A 1DKMA 3OLXA 2D7DA 1JIJA 5DCYA 4G0NA 5DM70 1L8OA 3DXXA 3ER6A 4I9NA 5LA6B 4NFYA 1X92A 3OKCA 4XLZA 1B0ZA 2DBRA 3IPAA 1G1AA 3KOUA 5HXAA 3E9CA 5K4GA 3ERCA 3GVXA 2XBLA 1GV0A 1V3UA 3EEOA 1UFKA 2AOTB 3KHSA 3KEQA 4QXPA 1JEDA 4MI1A 1F0NA 4WA7A 3QVLA 5IEBA 1I3NA 1V35A 1KQ3A 3DBIA 4F2DA 3DMGA 1P33A 2OTCA 4G8BA 4TPKA 3HJAA 5TS2A 3ZLUA 2F9MA 4N12A 3FCYA 4AUMA 4LZJA 4AJ9A 5B36A 1DAPA 4TUYA 4XUCA 3MILA 2PRJA 3MWJA 4KXLA 4Q4LA 5JS8A 2G17A 4MLCA 1XLWA 3CH6A 4A73A 2IXGA 2SECE 1VP9A 3ANSA 1JH9A 4M3NA 4PFJA 2P4UA 1GZUA 1OX4B 1UMKA 1MOQA 2QX7A 2FPXA 2O8VA 3BMCB 3I5UA 1VSUA 4FX5A 4B46A 1OX6A 1U8YA 1ZD1A 3HSYA 4HYTA 1AKNA 5AVRA 5JAOA 2QSYA 2H9YA 3GLHA 1FNBA 1SXJD 3F7OA 1NOJA 1THTA 1U28A 3AJDA 4K81B 4MW4A 4DMLA 3NV9A 3EVDA 2J9RA 3EGVA 1UAYA 4G1CA 4G0QA 5J58A 2XZLA 2TMYA 4F3CA 3UTDA 2ZTVA 3M5WA 4NZ9A 1YJXA 2FZCA 3OTIA 3HB1A 1M5TA 4X95A 4KMMA 2LCQA 3RO7A 3QF4A 4LHZA 3SC2B 3ZH9B 4AYTA 3LV8A 1R4NA 3H9CA 4TXHA 5DHPA 1SELA 1VJ5A 3VR5D 3WR5A 3KTFA 3ZHOA 4LNAA 3ZNOA 1Z6QA 3K0HA 1IZYA 3ZKWA 1IHPA 3E22B 5EP3A 5HPYB 2HNKA 1NV8A 1KYZA 3PICA 4PPYA 4M0EA 1L7NA 1ZO8A 3IBSA 4E70A 1XU4A 2Z98A 2CCGA 3FLBA 1SXIA 3RU9A 5K8TA 3WP0A 5COQA 3ET4A 4ETIA 3AP3A 4OSOA 4G1BA 2HN9A 4RKQA 2ZAGA 3KQYA 3F8SA 4OH1A 3TKLA 1R00A 3NKFA 1NN1A 2LDBA 5U9CA 5TPZA 2QZ4A 3NCTA 3OLWA 2J5QA 1B8PA 2AQHA 2BMEA 4PGMA 1L5ZA 1JWAB 5HBRA 2LPMA 3ZI0A 4D1YA 4G5GA 2I9KA 2O57A 2CXHA 5GV7A 3K6RA 1FBTA 1DPGA 4DMHA 3K0EA 4CEIA 2ZK7A 1WOYA 3W6ZA 4ARUA 4ASUD 3IEUA 2PRYA 3LOUA 2PH1A 3IFSA 5FOSA 2F1JA 3SZ3A 4E32A 3OBBA 4QC2A 2H2FA 1KFKB 2VPIA 4PLGA 5DTQA 3TD6A 3GRUA 3D7RA 1KGDA 2FPIB 1N4AA 2QTRA 4PPNA 3I5XA 4LPSA 3R8CA 3K0CC 5DULA 3R4CA 4MHSA 4X93A 2AFHE 4N40A 3VOBA 3BXFA 1IRXA 1E4OA 1HYGA 4V2IA 3S2FA 1T9GS 2WJPA 4DILA 1TF5A 5KIAA 4JI2B 3M70A 4FR5A 1P2DA 3DQQA 1OU4A 1XVVA 4IWNA 1XTTA 3ZY4A 1JI3A 1G63A 3QPUA 5TV2A 1X9IA 4LBVA 3RROA 4LDQA 4MS1B 4QTUB 3LGAA 2EWVA 3N58A 2BGMA 4IHJB 4WCFC 1P2VA 2QJOA 3R7WB 2F43A 4Q4AB 3ZS8A 4LMPA 4W5TA 1HNZB 2VDWA 5EUQB 1RPTA 2EARA 1U3GA 3VPDA 4NU0A 5CJJA 2C9YA 4R8KA 1NY6A 2XVZA 4IZIA 4R41A 4ZVNA 4BNNA 4OI0A 3HDJA 2DCUA 2VHXA 2DBVO 2OV6A 2ZRDA 4M1TA 4GZLA 2BE7A 2P40A 2P9TA 3BGWA 3C6BA 1NQXA 1MOSA 3GEBA 1K7EB 3B48A 4WNYA 2ON6A 1M34B 2MSNA 3PQEA 1EX1A 1SAYA 4O8ZA 1CNFA 1W36C 3IDZA 1ND5A 1NA5A 3JY6A 3NJ4A 3F9RA 3MS7A 5IBQA 3V1UA 2HBZA 4C88A 4MV5A 1KO8A 4GI3A 5DNCA 4YRFA 4ENSA 1K3TA 1JSZA 5C53B 3L1KA 2VSQA 4GEKA 4EYSA 3OZRA 5JQGB 3WAGA 5CJ2A 4DABA 3RCBA 1F3LA 3K1ZA 3U7RA 2WUWE 3B52X 4NJOA 3GNTA 3C48A 3CZ4A 5CAEA 3OMLA 1M2WA 4RH0A 4GUDA 3KLNA 4O59O 1E7QA 5FX2A 1ICIA 1W5FA 1I3MA 4ZOLB 4YYZA 3ED1A 1OBOA 3EISA 3OFKA 4P93A 3NT2A 4R2IA 1QCCA 4YJHB 4WAUA 1D0IA 2H92A 3WGZA 4ND2A 4ZVOA 4H1WA 5LB2A 1QGDA 1XPJA 2HJRA 4EATA 2ZS8A 2ZRBA 2PS0A 4L5CA 3S40A 2P9QA 3Q1KA 4IBOA 4FMCB 3PLRA 2GKSA 1T2DA 2OCLA 3TTTA 1UMBA 3JZIA 5I9TA 3RLFA 4MQUA 3WNQA 1DQNA 3KO8A 3N7AA 4CFZA 3TRFA 4ZAXA 2PV0A 2VDPB 1HKUA 1MLDA 1QB8A 1JDTA 1WRBA 3EF3A 2GPWA 4M7WA 4MV1A 5AIAA 1XD8A 1J2UA 5DEIA 7REQB 2VQ6A 5KMGB 4RAOA 3RR2A 3B51X 2VT6A 1QFXA 4CW7A 3QKRB 1A5BB 4ER6A 1T25A 4QELA 1OYWA 4Y7DA 2X9NA 2Y68A 3AT1A 4E03A 2Z43A 4B48A 2ZAYA 1EMDA 4LC0A 3UUGA 1FYVA 3D8UA 1SWWA 4ME6A 1QONA 5HYVA 4WX2B 1YD7A 1J97A 1XZLA 3PHLA 3H4MA 1JH8A 5K0CA 2WJGA 3QKSB 4DIMA 4E14A 1MQAA 1O2DA 2QR2A 5GIOE 2VEDA 3OCXA 1ZKDA 3ESXA 2KB0A 3MXOA 3BULA 4LSWA 5H9WA 4RKWA 5JC8A 4TYWA 1EK0A 1IUKA 1MDBA 3L82B 5FI5A 3DOFA 4UD6A 3A06A 5ALLA 5CIYA 4WHMA 3IQXA 4D80A 1NVFA 4L57A 3R5SA 1WQ3A 1U0TA 5DCWA 2HQ1A 3FCSB 1PR9A 1ZA2A 1SZCA 4KWCA 3NDJA 1Y4DE 4TUYF 3UANA 4YRLA 1T1RA 3F98A 2P4EA 4EY7A 5JZSA 1D3AA 2YJ3A 5CVEA 2MYNA 1L7XA 1OZGA 1KKMA 1C7ZA 1T2EA 2C00A 3EULA 4M1OA 5KNCH 2P2GA 3FD8A 4GQBA 4AD8A 1UXOA 4OQXA 5PGMA 1LLDA 2JGJA 1B4DA 2GN6A 4C2BA 2GBPA 3I34X 2O9JA 2VLBA 1M6EX 2YFQA 3CUVA 1D0VA 1ZOSA 2F4NA 5HHTA 5HJEA 5F1PA 2YASA 4O1IA 3GLGB 4R2WA 4OO3A 1KOJA 1QP0A 1TKBA 5BWLA 4QXAA 4BFWA 1R6BX 2EKBA 5E1MA 4DBLE 3CNBA 1UBTS 4L1KA 2VXOA 4QSHA 4X24A 2GBIA 1EK5A 3DVSX 5EYPB 2JLRA 1DDOA 3RG2A 3UKOA 1TTQB 3C8UA 2VBCA 2B8WA 2B4KA 3HKEA 3FGZA 1PZXA 1JAIA 1Y1KE 1AVTA 3B3FA 3EZGA 4GPD1 5DXJA 3NDBB 2CD9A 5TNXA 5CT8A 3NOXA 3NWBA 5B3LA 1UFVA 2BM1A 1IOZA 3G2HA 3VR5H 3SVTA 3I9V6 1ECFA 3A3KA 3LFTA 3MJCA 4DT1A 5KS2A 2NU8A 1JHPA 2UUBB 2DFNA 3GQVA 4V2UA 4BFXA 4F9GA 1GCIA 1KAMA 5CDSA 2OAP1 4KAXA 3OZTA 2R3SA 4H3KB 5HGJA 4EG6A 4Y67A 4OHYA 4D9MA 1P60A 2J0SA 1KVUA 1W4CA 1M74A 2ZITA 3KG2A 4MDHA 3GLQA 3IQHX 3Q9SA 3UM9A 3RTCA 5DNDA 3FNGA 3ZCUA 5FADA 4DQKA 4CCWA 2IBTA 1PJBA 3G9QA 1PJCA 4WK4B 4KWIA 2C7VA 3DLIA 4IJUA 4WZAE 4CM6A 1Y8AA 2UVDA 3B53X 4OMFG 2XGSA 3BWCA 3C6XA 1Y6FA 2XDQB 3SR4A 2JGAA 4RHYA 3TFOA 2ACEA 3CB2A 3OZFA 5FR2A 2JFZA 3COSA 3UVEA 5CMLA 4MB2A 5DBHX 4BATA 3VNVA 1FRZA 3F2VA 3OIYA 5FUYA 3TL2A 1PR2A 4BPBA 1B6RA 1P5RA 2OO5A 3TUIC 3UAVA 1EUDB 3O73A 2JAXA 2P3SA 3GRVA 1MB2A 5DHUA 5H4GA 2JAUA 3KSDO 2FE1A 1KPGA 1D9ZA 1RAIA 1SUDA 2AR0A 2O3UA 4HDKA 4M8SA 4TQAA 5JO0A 1ZMXA 2R2AA 3EW7A 3I0MA 5IAJA 3ECCA 2XCUA 3ONDA 1FMTA 3KVOA 4B35A 3EXHC 5I5EA 5KOJA 1PR5A 1YOVB 3JQPA 4OMCA 1RYDA 5EIHA 5HFAA 3WK8A 4OQQA 1XRSB 1YZ3A 2QM3A 1Z2NX 2ZUUA 4IQGA 1M0SA 4BNKA 1OZ0A 4FE3A 2O0LA 3Q9LA 3WTCA 1Q7RA 2VH1A 3LHDA 4K46A 5T6BA 1ZD8A 3R2JA 1ZD9A 1SBCA 3OZEA 3QXSA 1ODJA 4G81A 5FBQB 3Q8XB 1W5AA 4E33A 3KFVA 1AGPA 4ZVVA 2Z8XA 4IVRA 3AF1A 1AH2A 5ESWA 1Z29A 4B45A 2BCGY 4KO1S 1A97A 5HMMA 5JZ9A 2Y6VA 3LLSA 3G2NA 1Q16A 1F38A 1VKRA 2FPKA 2Y8EA 2XE7A 3O9ZA 2GUGA 4G65A 4DEVA 1WA5A 4E30A 2E5LB 3FCXA 4GKVA 4PICA 1YWGO 2W6NA 2VA9A 3HZZA 5KSWB 4DPLA 1GAQA 3R1IA 721PA 2RFLA 1J70A 1NXSA 4AC9A 3OIWA 4IGFA 2IEZA 4N7RA 4FFVA 1E4VA 3LDFA 1JYEA 1OYYA 3PUZA 3B12A 3Q2KA 3S2YA 1Q92A 1Q1EA 2RIRA 4F86A 1KETA 3NNNA 5FUQA 1M2EA 3CLSC 5FD8A 4ML3A 3WJAA 4MICA 1LKZA 1Y4UA 1ZH2A 2QOEA 4LWZA 4ZXFA 3SHOA 1RXUA 4MWOA 4W5WA 1AGYA 1YI1A 4JENA 4RZSA 5F73A 5ALFA 5I9MA 1FYWA 2R60A 4L6IA 3RH0A 1E96A 1V8FA 4HUTA 4B3RB 1IDOA 1AQUA 3NXKA 4PIMA 4YC7A 3LCUA 4HX9A 3LCJA 1UXJA 2QAIA 4LHSA 2D1SA 4URUR 3I64A 5LU8A 1DB3A 4A4DA 3I76A 4JC4A 3SBXA 8ATCA 1A71A 2G71A 1C4XA 2QRUA 3EJWA 3JQ7B 3OA2A 3P9XA 2R85A 4TRJA 1HZJA 1RQPA 4DA8A 4BVJA 1L9KA 1HMPA 2W7TA 3ASZA 2AVNA 1YRWA 4RJIA 2PMBA 3KZVA 3WIUA 4D79A 4F92B 4QT4A 2CMKA 1OR8A 1T4CA 3AHIA 3BTOA 4DBVO 4L74A 5G1PA 1N6KA 2GI4A 4DJAA 4LY0A 3OPNA 1GA4A 4GW3A 3GJ8A 3V4SA 5KWJA 1W0KD 2K6GA 1GFWA 2G72A 1Z2EA 3L0ZA 2YW9A 1UJ5A 1XNRB 1VHDA 2FP4B 2PZKA 1OBHA 3TW6A 4BLTA 1E3QA 4UUAA 2VJMB 4DA7A 2B7LA 2X40A 4TSFA 3QX8A 1S2OA 1EFAA 4D44A 2J7KA 4YJDA 4EHHA 1GTJ1 1JJFA 4YXWD 4MKFA 2HRDA 2FXIA 1E58A 2VUIB 4FDVA 3C97A 1OGYA 1QHYA 2ECOA 4X7BA 5T64A 3GH3A 1K89A 1XXHB 4LDPA 5EKDA 1NAHA 5TC4A 3OIGA 3RBZA 3ORHA 4J03A 3OHMA 1SUBA 3TBKA 2RH5A 3DKIA 3EMBA 3I52A 4LXGA 4ZAYA 2HLNA 2DYKA 5E6RB 3ZBUA 2G28A 4CMBA 1HDEA 4MWGA 3OE4A 4BQEA 1LLCA 4BGIA 1XMXA 2UV8A 2WU4A 3WLSA 1XI2A 4GX5A 3TDKA 1O6ZA 2WFLA 1LSUA 2Z1DA 3C3MA 2Q62A 1TT7A 4FOTA 1M1YA 3HI6A 3H99A 3S27A 3UQZA 1O6CA 3DC2A 4N3AA 3FNRA 2ZIZA 4KQJA 1J8FA 2VP6A 4O4LA 2H29A 1XD2B 4L95C 3FYCA 5J43A 5LU9A 1W1WA 3DNMA 3KUCA 4RFSB 5CR9A 4BV8A 5IXYA 2ZJBA 4IMPA 5CUQA 1ULSA 5IJZA 3NRCA 1KH2A 4YDHB 5K9ZA 4I4LA 1PWEA 1NOKA 1ZSVA 3GJ0A 4TKVB 2YOFA 1L5LA 5B4TA 2CDNA 4F6RB 2HV9A 3CZMA 3FNFA 1K06A 2XUQA 3OF3A 4XVHA 5JNUA 5KQPA 2B3TA 3UBTA 3TR0A 3TJRA 2HT6A 4IW3B 3HRHA 2IYXA 2EZ9A 1H6CA 2YQ4A 2JGFA 3ACBA 3HN7A 1NI4A 1NJGA 3JZDA 5DLPA 2J3IA 1MORA 3MRVA 1TK9A 5LBIA 1NQUA 2Y71A 4LDZA 3OOJA 4UEJA 3WLJA 4CV1A 4DA6A 5EIWA 2QN6A 3LP8A 3PXEA 2NQ8A 1WB5A 4ZQCB 1X1EA 2G1UA 2OXFA 2O1SA 2HZ7A 3OQMA 1OILA 2NZVG 2PPVA 4Y0NA 5C5EA 4RPHA 5CVVA 1SK8A 4XRRA 1MDFA 1XDGA 1R6TA 4QUDA 3U3DA 3GJRA 5A4IS 2AUMA 2XMZA 3A6KA 4EY3A 5EUMA 5L45A 4AQYB 1URPA 4XSGA 1A4XA 1SQ5A 2CSXA 5AVSA 1PEKE 4W9NC 3WA6A 2BISA 5BV8A 2ZUVA 5JARA 4XVRA 3IGFA 3E7DA 2ORED 4CKZA 2AK2A 1VLJA 3DDCA 4ZZIA 3I42A 2YWDA 2QG4A 2Q46A 4JJZA 4KQ9A 5F2OA 5JWHA 4G4IA 2J9XB 3QI7A 4DEYA 2IU3A 3HWWA 3C4JA 1J1UA 2AGVA 2B36A 2DH5A 3C70A 1GRCA 1RXSA 4OB8A 4YUYA 3U6BA 5F9HA 1V1MB 1X70A 4PS0A 2EYUA 4D82A 4W1PA 3H9JA 2CJWA 4CCSA 4UTZA 1CEYA 1R5BA 3RWOA 4NHOA 3FYUB 3KPVA 1IY9A 3OOSA 4RFLA 4W5HA 5HFJA 1P9NA 3U4MA 4HGZA 2R11A 4LV8B 1V2GA 1DBSA 3ZWOA 5A9SB 1OI2A 1QHXA 1L9XA 2JAQA 3HXTA 3DLCA 4G9BA 4EG0A 5CBPB 3GB9A 4RL4A 1WQ4A 2Y05A 1FSSA 2XJ4A 1RHRA 5EJ5A 3C16C 3BD8A 4K0RA 1IY2A 3CT4A 3DEHA 3HNPA 3CVXA 1I24A 5I7HA 2HBQA 2QD4A 3KOWA 3KL4A 3VPXA 2W22A 2DZDA 5F4BA 1QBGA 1JAXA 3LK6A 1DLIA 4KYUA 4KFUA 1IATA 1ZINA 5BSHA 2FEAA 1CUCA 1DEKA 4GOMD 3VHXA 1BDHA 4QUIA 3ZDBA 4MK4A 3VX3A 4PYKA 3A7DA 4BO8A 1FX0A 1YBMA 4I6JA 4NONA 4Z0PA 1M2NA 5TXGA 2NM0A 4ESHA 2JATA 3SJZA 4QD3A 1R0BA 1QZXA 4J6EA 4CE6A 5BVGB 4DJJA 2W8BA 4RETA 3JAKB 3FI0A 3FMVA 3ROKA 4M7OA 2BKLA 2XNJA 3FPAA 1KZ7B 3W2TA 4IDNA 2I7XA 1QIIA 1OJ7A 2RHCA 3TQCA 4K9LA 4Y6PA 2PG3A 1SCIA 4MUYA 2PLNA 3UWPA 1OLUA 1SC9A 2DLNA 1MGPA 4BLSA 4DNQA 4BNUA 4K6MA 2IKSA 3D8TA 3JVEA 2RGRA 1EE9A 3RTBA 1CR2A 1G4AE 3PJRA 4KITB 4P7GA 1V16A 2XNSA 3AR6A 4U2EA 3PGJA 1X7WB 4J4HA 5E7IA 3GAMA 2A9FA 2JKZA 3OIDA 3V8MA 3U7IA 3AVVA 4EZBA 5DI3A 3L7DA 3QXJA 3LDHA 5JH7A 1E7WA 3ZDCA 1G7TA 3BWDD 5G4KB 1VYVA 3P9CA 4UNNA 3G9XA 3P4UA 1QIHA 2WNSA 4JL5A 4EJSB 4J0GA 3DVAA 4N8DA 4PNZA 2N9UA 2XMCA 3PYMA 1F8GA 2VQDA 4L0DA 4OVKA 5A4JA 3VI3B 3I8XA 3KYDB 3PXXA 4S35A 1CFJA 4IFIA 1PVDA 2OD7A 2B2XA 1YL5A 3AUTA 3LT0A 4FGZA 4HQ6A 2HU8A 2P7IA 4XIJA 4F21A 4Y6LA 2HMSA 3DEJA 3P71T 4G5XA 4BQFA 5JCJA 4LXYA 1FF9A 3QNUA 1H4TA 2ZI9A 4LZWA 3LPCA 4JQZA 3RC3A 1WXIA 3T5MA 4GOXA 5GADl 1Z2AA 3EFBA 3X1WA 1RMYA 1K92A 3NHZA 2GPNA 3F1LA 3GT0A 2MSCB 3PCRB 1UDWA 4C03A 3M6WA 1ZD4A 1IPEA 1T5DX 3CY6A 3BKXA 3P5BA 4ZHQF 3AVUA 2Q1UA 1QH1B 4JX9A 3FI9A 1CEEA 1U3FA 1JLRA 3NC1C 5AJYA 3IT3A 4XUGB 5HKAA 2GM9A 1XV5A 2YVQA 3GU3A 5GZ3A 3C3PA 1B76A 1PIWA 5K0FA 1E3EA 3KLMX 3QX9A 4HK4A 4RD0A 3ETLA 3I0ZA 3WKCA 2W90A 3RC7A 1PJ2A 3SBOA 2ZE5A 3JWEA 3FB4A 4JZKA 4V3BA 4B3FX 3R5XA 4JI8B 2B99A 1L1EA 3CTMA 2HWKA 1C4WA 2FN9A 3IB3A 1SOAA 3QFTA 1VJ0A 2BKVA 2J6CA 2RK3A 1E77A 4RD4A 1ZCBA 1HOXA 4RENA 4KE6A 3I8SA 2G0NA 4ZYYA 2ZJ0A 2H18A 1ZCFA 3HHEA 3T7AA 4GH5A 4NYIR 5I45A 5HX7A 2PQ2A 5EKTA 4OJYA 3HKDA 4O4LF 2NYVA 1MJHA 1T8YA 2IYYA 2IUFA 3ZZTA 1I2CA 2E87A 4QQRA 1QHHB 3GFGA 621PA 3IMFA 5CFNA 2XGJA 1BCSB 4LMAA 3ZPXA 4M1YA 1PK9A 3QU7A 4R01A 2BFOA 4EW3A 4RPGA 2NTVA 1PNRA 1QP4A 4AJ1A 4NL4H 1FUYB 5I01A 2EZUA 2R62A 3FDIA 4WOJA 1EP1B 2G8NA 4FBMA 4DLZA 1UDBA 1W0CA 3W2HA 1RHJA 5KWIA 2Y66A 2VF4X 1KEPA 3AM5A 4QQNA 5A7GA 1FSZA 2QA5A 3GCDA 4M99A 3RJZA 4A03A 6REQA 1E9BA 3FNQA 2J9YB 3ZVNA 3ZOZA 3B3JA 1UEJA 1G9XA 1E89A 2FWNA 4L78A 2DLDA 2PJRA 3CURA 3ZEIA 1R0YA 1FFEA 3G5AA 2A78A 3OZIA 4QEDA 4PG6A 2O1XA 3I9MA 4CJXA 1MXFA 3ISVA 4KMRA 4X20B 3EXFA 4XQEA 2X3YA 3L92A 4DMKA 1S9DA 5ALTA 3V1YA 3AQIA 3EIWA 3H84A 4I08A 4BVGA 4B4DA 4D9HA 5I7UA 4N01A 4GEGA 2DT8A 2VHTA 3FAKA 2BM8A 2WWFA 3EUFA 5FL3A 4OQFA 2A5YB 4G1EB 4HFRA 5EJ9A 1R88A 3FSEA 4BPRA 4F1WA 2QN8A 1DNPA 1KJ8A 3PQ7A 3T4XA 5L53A 4YP7A 1VP3A 1L5NA 2R5NA 2OC9A 4YCJA 3PJDA 3M2TA 1USWA 3PPIA 5CIQA 2L69A 1EGVB 1VPTA 2D8AA 3QQPA 2WJZB 4G86A 4HCJA 1YFZA 2DKOA 2EDAA 4YP1A 2R66A 1HBJA 1VYUA 4IIVA 3ZVLA 4TYNA 5KU7A 2BONA 3R9XB 1KORA 3ADOA 2YWCA 2JIDA 2VP4A 3P0IA 1NBIA 2FLKA 1X7YB 3K2EA 4NU6A 5A62A 1YTUA 5EP2A 2O7RA 1PLLA 3W05A 3MS2A 4ZDKA 1KJZA 1NVVR 4LJAA 4ZT2A 5LB4A 2FX2A 4GLLA 3L7NA 1WNFA 3HXMA 2E4AA 1JYFA 2GEBA 2O2CA 3QEMA 1P0CA 2J67A 1EFPA 4IHQA 4BAUA 1AMNA 3IP5A 1G20B 3TZBA 5JCOA 2LRHA 1Z16A 4OXQA 3UC5A 3S81A 4X64B 3ZE2B 3E58A 4JLWA 1RC8A 3D4LA 3QM1A 3PUXA 3ZQJA 4Q9HA 1PFUA 1D5CA 2N0SA 2OESA 1O77A 1XTJA 4PHTA 2C1XA 2JNWA 3WADA 3SF0A 1E3WA 2EIXA 1ZLXA 3HY6A 4GXTA 4P36A 2RE8A 1YONA 5H68A 4Z9XA 4HAYA 3UCFA 3AY0A 3H5NA 2GBFA 4D3SA 3BYZA 3KP1A 4P0TA 1KO5A 4Q9IA 1IY0A 1O9BA 3CT6A 2EL9A 3QUQA 5I7SA 2ZUBA 5HTKA 5ES4B 3K09A 3OCYA 4J29A 4JIGA 2XY4A 2IV7A 3V2HA 1Z22A 5FCDA 1WEHA 2J0QA 2ID8A 2PL3A 2WTMA 1RT9A 1MP0A 3KJZA 4G4SP 5AKIA 3VJMA 5D86A 1NMXA 1NW3A 2Q41A 1XQ6A 2VDVE 4JLVA 5BQPA 3SHVA 4JYAB 3V55A 4N5MA 2XBUA 4ARCA 4RQTA 2PE5A 3PJGA 4RMHA 3WV5A 1X1QA 2C4WA 3IVRA 3ZHYA 1IM8A 2G25A 1SG6A 4DJ5X 3FSGD 1GZSA 3V1TC 3H6GA 1G4UR 3MCTA 4R1UA 1YUBA 4AX4A 3N2KB 4Y2QA 2J08A 5HIAA 5E8JA 1KTIA 4LTDA 2G70A 4RMGA 4JNKA 2G9QA 1RQXA 1Z5OA 2HDHA 2A92A 3DT9A 2GEVA 5B58C 3G6KA 3D3NA 4C7JA 5JH7F 2IY9A 3TRKA 3FG9A 5LQRA 4RF4A 4D3DA 4WBNF 5DKFA 3JSAA 3F3MA 4M6WA 4YUXA 2FZ4A 2NVUB 2WE7A 3HLTA 4GMXA 3TVTA 4AJJA 4LBZA 1Z2OX 3N3AC 3WFIA 4B3XA 4GKBA 4JODA 3L6RA 2QVGA 3MJSA 3FMIA 4XKJA 5IKPA 4N8SA 4OJKA 2QLJA 2X2PA 1Z0KA 3SS8A 3ZCQA 5BXYA 3AR5A 1S3SA 3EZYA 2GNOA 1L4UA 2JVIA 3B2EA 2GN1A 3AJAA 4J76A 3C3JA 1OAAA 3DKVA 1KFJB 3LYHA 3NAMA 1OQAA 2GHIA 3LUGA 4XWOA 3WWEA 5CXQA 3MC1A 1B1CA 1XDBA 1X8LA 4LC9A 3OEED 3OJWA 4A8JA 5ITSA 3PBKA 3A3OA 5FYDA 3CIOA 2YHUA 3K1YA 3NVAA 3VU9A 3LCRA 3ZWAA 3FHJA 4G5HA 2BFBB 2WIGA 3E8XA 3LSYA 4MVCA 4C5CA 4JL8A 4BASA 2H5IA 1U9CA 13PKA 3NWEA 2AHOA 3BERA 1GPBA 4K26A 2AKYA 2DLCX 5CIWA 2R84A 1RWBA 3DEKA 3VR6A 2D5AA 2QU8A 4FXPA 1Q83A 5A3SA 3UW3A 5KZMB 3IHWA 3SYLA 3WMFA 6ADHA 1QUEA 1NMEA 4UVDA 3M7IA 3WHLA 4KAAA 4C05A 4KGDA 1WZEA 1IVSA 1Y6QA 1L7VC 3R8FA 2EW2A 2XYPA 3OPYB 5EGSA 3AKYA 4BWYA 4KOAA 2AJCA 1Z2DA 4EA6A 1J24A 4B3CA 1GOTA 4RW0A 1H3NA 3TZCA 4E31A 2L82A 2OHJA 4HQFA 5AOBA 1FLDA 1WCWA 3TECE 1A8QA 3KHKA 2I1VB 4MAAA 3X3HA 4D43A 3M33A 4RXUA 2WV7A 2ISSD 2XYQA 2GKGA 3VNQA 2HJHA 4JASB 1WJGA 4NCJA 1U7WA 2V0GA 4R6XA 5KYWA 4NEQA 4NI5A 4A6DA 4IIBA 4MA5A 3TTXA 3MGAA 1XMSA 4GLJA 3ZWYA 4XGKA 3ADCA 4EA9A 5FRDA 2I3AA 4HLCA 4XD7A 2A8YA 4Q6WA 3KEGA 3QX7A 1BMTA 3SF8A 5CURA 1USUA 3THXA 1Q19A 4HAWA 1NLFA 3NOQA 1T8TA 4Q15A 3MLEA 4W5JA 3PKIA 2AYYA 4MVJD 4EHFA 1ORWA 3AX6A 4TLCA 1YZFA 2JHPA 3CLRC 4M98A 2KI5A 3ABSB 4EMSA 1E9VA 1ADCA 2YZMA 1ZIPA 1OWNA 3D4BA 4X41A 5KI6A 1S2MA 2V96A 1Q0HA