1HUQA

1.8a crystal structure of the monomeric gtpase rab5c (mouse)
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
164
structure length
164
Chain Sequence
b'ICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNTDTFARAKNWVKELQRQASPNIVIALAGNKADLASKRAVEFQEAQAYADDNSLLFMETSAKTAMNVNEIFMAIAKKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RAB5C
publication title Structural plasticity of an invariant hydrophobic triad in the switch regions of Rab GTPases is a determinant of effector recognition.
pubmed rcsb
source organism Mus musculus
molecule tags Protein transport
total genus 55
structure length 164
sequence length 164
ec nomenclature
pdb deposition date 2001-01-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1huqA00
4E07A 3FDIA 3WBKA 4AC9A 3FVQA 2OXCA 3UKDA 2PMKA 1SKQA 5BWMA 2ZAOA 1CXZA 1M7HA 2PLRA 1P4SA 1T9HA 2HDNB 4D0NA 4HAWA 1YZNA 3TUJC 1Y3AA 1PLLA 2R2AA 4AK9A 1IN8A 3ZZUA 3NBYC 3TAHA 1OH5A 1Z83A 2WSSD 1JR3E 1W36D 4M1YA 3BB3A 3DZ8A 2EWWA 4CYMA 2O8CB 2O8DB 2JA1A 4NU0A 1MABB 5AJYA 1WB9A 4C0LA 4PZZA 3BE4A 1YZTA 1OIVA 2F3TA 4JJKA 4EQ6B 3ICQB 1AJEA 4A4DA 1TF2A 5B2ZA 5CLLA 1D5CA 1XJ0A 3K0SA 2A5GA 4GL2A 3MUFA 1GKUB 1GM5A 4HZIA 4DCTA 3B7GA 1Q21A 4GBMA 2VQSA 3P4YA 4IDOA 2DWPA 2W6JD 1T0JB 1QG2A 2A5JA 2XZOA 4D4KA 1QHGA 2FSIA 2R44A 2ZPTX 5DHAA 1ZAKA 4B6FA 3OIYA 2IX3A 2IF2A 2EYQA 1T5IA 3KL4A 3GP8A 3FKSA 4G3XA 4OI1A 4M8NE 4PC6A 4RSGA 3GCGA 1R4AA 1P72A 1EFRA 1CKEA 3RVBA 4KITB 4TYPA 5KPDA 2RGEA 1WCV1 2JJ1D 4PQRA 4EFNA 1WDTA 3HYTA 3MWJA 2HYDA 2MSDB 5TV2A 5GJVC 5GJCA 4ASUD 3AVVA 2VSOA 1RRPA 2Y8EA 4EPXA 4YDHB 1J2JA 4DBLC 2GILA 2WV9A 5TY0A 1Z0DA 4JT4A 4CEIB 1VCIA 4NTZA 1NKSA 2Q6TA 2F9MA 3HYRA 4M53A 2HLDD 4TSFD 4FXPA 2BKEA 2OHFA 4LJ7A 4Q5IA 1RRCA 1ZU5A 3BH7A 1XCPA 3HPRA 2QUZA 4PAOA 2FSGA 4CZ2A 3SR0A 1P9WA 3IDQA 1ZRHA 1KMHA 2Q3MA 3DM5A 1FQKA 2O5VA 2BC9A 3KXKA 3VQTA 1UFQA 4KJZA 4F92B 3LAWA 4I81A 2YC2C 2QAGA 2OM2A 2CL6X 1N0VC 1KSJA 1AZSC 3PEWA 1RFLA 4HAVA 2B8TA 1HT1E 4V0KA 4D25A 4UQOA 3W9YA 5BN3A 4QHYA 2ZSEA 3CLVA 4LHXA 2ZE6A 3I92A 2KSQA 1DG1G 1IONA 3HU3A 3PFIA 3QKSA 1C1YA 4LV8B 4Q4AB 3G0HA 3IUYA 1L8QA 1OIXA 3L0PA 3FB4A 2WM9B 2ZI5A 1XBTA 1ZUIA 1JPNA 3N2EA 3IPYA 4LYFA 3X1DA 5KSPA 1DPFA 3ASZA 4Q18A 2IS1A 3DKVA 1A7JA 3Q7QA 1H8HA 3SJZA 2GZDA 3CIOA 2FFHA 1Q3HA 1H8HD 4Q7KA 1M8PA 1TQ4A 3LXXA 3ZS9A 2QU8A 3EPLA 1E2EA 3MWLA 5FBWB 3DHWC 5JECA 3NVAA 1S96A 4RD2A 2GBLC 2OBMA 4EPYA 1KI6B 4AKGA 2IEYA 4D81A 1EXMA 2X2EA 3QNUA 3WMEA 4ZI3A 2C98A 3OEED 4X8MA 5CLQA 3UK6A 3BBPA 2WJGA 2VF7A 4P4TA 3SHFA 3PENA 4HZUB 1OPXA 3VR4A 3TUZC 4EPTA 3Q8XB 4QBGB 3I62A 3AKDA 3AGQA 5FTLA 2CHGA 4DLSA 2XB4A 1T8TA 1L7VC 2WPDD 4TTQA 5CJ2A 3QKRB 1JJVA 1FMJA 2BEJA 3RS0A 3FHTA 5DE3A 3H86A 2D7CA 4R7ZA 1VPLA 1Q44A 1LTQA 1PJRA 1ZM7A 3CRQA 3L43A 5CM9C 4B34A 1T5LA 121PA 2G0NA 4Y0AA 4XD7D 5L3SA 4MYTA 2PZGA 1TMKA 4M9XA 2BBSA 4BLPA 2XSZD 4JVNA 2C9CA 1KI9A 5DO9A 2ZRNA 1NBMD 1J7KA 4MYUA 2P6NA 2O0KA 3DMNA 3L0SA 3ADKA 2G77B 1LFDB 3F5FA 3U7GA 2ZI9A 1CJTC 3CH5A 1SVMA 4ZV4A 4E22A 4DSNA 4Y0VA 1DAFA 3RSLA 3SHWA 2ODNA 5E7MA 3KJGA 2L0XA 1GL9B 3N70A 3R7WB 4WA7A 4C0KA 1KK1A 3KKMA 2FPLA 5F2EA 2IL1A 4QBHA 4DSOA 2A30A 3RHFA 3VU9B 4BFXA 4AG6A 3W6PA 1EWQA 2FFBA 4LX0A 2VHTA 1E2DA 4OQMA 2CBZA 2G1KA 5P21A 3ZJYA 5K8LA 1HQYE 2H16A 2AFIE 4C0BA 4XTCS 1ZNWA 4DT1B 3EPJA 1G5PA 4ZO4A 5G40A 3OEHA 1PLJA 4YLGA 5FOTA 1D9ZA 2BV3A 5E7JA 4IOKA 4BEJA 3IO5A 4ZCIA 2ZRIA 3R8FA 1W4BA 2QT1A 3AVYA 5C2JB 2GK6A 1II9A 1ZW6A 3AKYA 3T34A 3D8BA 4YQFA 3U61B 3A1TA 1NVVQ 1GRNA 4PANA 4V02A 2FG5A 4AYTA 3C5HA 4FCVA 3H2YA 1Q1EA 2ZAMA 4HUQB 4D2IA 4GP6A 3LW7A 1NG1A 4GMXA 4HYYA 2UVQA 2HUPA 5FPTA 1XMJA 3MAAC 2GJ8A 4EAQA 1XMVA 1XZQA 3OAAD 1D8TA 1RRFA 2GF0A 1W46A 4KFSA 4OKSA 2YV5A 3CH4B 2O52A 3K0FB 1LS1A 2BBOA 4S35A 1U9IA 1A82A 2OO7A 2QEQA 3LDAA 2BWJA 5JMTA 2QI9C 4F4IA 2O8EB 2IYRA 3RNLA 4MQBA 1S4QA 1NY6A 1J8YF 1XJCA 4B6EA 2AK2A 1MH1A 2ZI3A 3B9PA 1DE0A 2QTVB 3K0CA 3WP1B 3IKJA 3CPJB 4PC1A 4A0RA 2IS6A 3GEIA 4A9AA 5KOYA 2VHQA 2ZEJA 2RGXA 1T91A 2H17A 1TF7A 4NH0A 4B2PA 1Z0IA 2IF0A 2J0UA 4B3GA 4GNKA 5LD2C 1PZNA 5JSZA 2QM7A 1E2GA 4NCIA 3QG1A 2JLRA 2RGNC 3HU1A 4GT1A 2C95A 2QPAA 3VR5A 2JLZA 4BASA 1FUKA 1UBGA 3HJNA 3OFNA 1Z47A 4AURA 1ZVQA 3KQKA 3OFND 2FU5C 2V8OA 2XEXA 4D6PA 4A0FA 3FTQA 3PIRA 1KO4A 1SXJA 3ZQJA 2J7PA 4HLUC 5C4GB 1WMSA 2PX3A 4D26A 4JLBA 2CE7A 4R2IA 4Q03A 3TQCA 5L3QA 3NIBA 2F1HA 3ZZ0A 2O8FB 4FMCB 3LBHA 4U7DA 4DEXA 3V4FA 3KQNA 4HB3A 5HE8A 1E0KA 3NEYA 1OH7A 3ADDA 3TIFA 3QXCA 1IXZA 1GVNB 1RYHA 2BDTA 1TPZA 1WF3A 1EGAA 4TT3A 5C4MA 4RY2A 4LI0A 2ASEA 1LW7A 2B92A 5FPSA 1RVDA 5GVSA 4F38A 4DDUA 2IYZA 1H8EA 5FOWA 1GRRA 1OW3B 4JBYA 4XIGS 2OUKA 2Z5FA 2D06A 5CYOA 3PJRA 1F2UB 1NLFA 2YJTD 3A1VA 1ZNYA 5AWFC 3W5IA 2GRJA 1N6RA 1OKKA 3P20A 3GLIA 1CJUC 3GPLA 2HXSA 1YE8A 3A1SA 4U02A 3WYFA 2GNOA 1UBCA 2QTHA 3OZXA 3VKHA 5DI3A 3VX3A 4CW7A 1NI3A 2ZYWX 4HDOB 1NN1A 4KO8A 2DFKB 2H92A 3QVUA 1KK0A 3E70C 4Z1MD 4JLJA 3HU2A 1MOZA 3GJ4A 3L0OA 1BMFA 2QP9X 4G5SA 5KU1A 3X1ZA 4NZYA 1UM8A 4KHZA 3J81k 5FBLB 1OLOA 2R8RA 5EXPA 3GMTA 3LXRA 3CF6R 4TTPA 1TQ6A 5JS7A 2ODWA 5IDVA 1E79A 1KY2A 2WWGA 2ZUDA 2NGRA 3ND9A 2R62A 2PH1A 5LDDC 3C4JA 3T1VA 2QAJA 3OE7D 4XSHA 1ZC3A 1COWD 3ZQ6A 2F6RA 4D4MA 4M1KA 2NO1A 2W00A 2ZS7A 3WMFA 4EKDA 2B8WA 4RD1A 1K5DA 2X19A 3GEHA 3PUYA 4C0QC 4LYJA 2QGNA 5EJEA 5JJKA 3IIJA 3OIVA 3GFOA 1DVRA 2MSEB 4FI3C 5EE3A 3MRSA 3SZRA 3I5XA 1HY3A 1T0HB 3SFVA 4LPSA 3U44B 2C9YA 1AGPA 2JGNA 2NMVA 1SHZA 2J3EA 4CVNA 4DJTA 2XOKA 4Q19A 3A4LA 1KO7A 2ZRMA 3WXMA 2CLDX 4C0AC 4MDEA 4CEJB 1RIFA 3TAUA 1JXMA 4PXAA 3EW9A 2I1VB 4OHVA 4TL7A 4G5OA 3GLGE 3WP0A 4OHWA 1BS1A 1G7SA 4P31A 4JLNA 4MRSA 1QHHA 3RRNA 2AFHE 2CL0X 2Q9CA 4YXWA 2J5XA 3AP2A 4KCGA 1FNMA 3I5YA 4DRZA 3QENA 2Q21A 5EE1A 1N5KA 3U3MA 5LPNA 3FMFA 4DKXA 2PL3A 3BGWA 2GZHA 4MKIA 3PUWA 5DN6D 3O8RA 2HF9A 2XTMA 2PJZA 1XZPA 5EZ5A 1G7CA 2GDJA 1GL6A 3GEEA 1ZJ6A 3C5CA 4A8JA 3BFKA 5H8WA 1S1CA 1WE2A 2EWVA 3IEVA 3AVOA 3KKNA 2A9KA 3BRWD 4Z8YA 1G3RA 1OHHD 2H1LA 5BN4A 2R6CA 2N42A 3PEVA 2GCPA 3R20A 4LBWA 2F3RA 3Q3JB 4JVSB 4DCVA 3R9XA 2IEZA 3TBKA 4B3XA 3RYTC 4ZDKA 3FWYA 5DSZA 4PC3A 4GZLA 1E9CA 3DMDA 2N1BA 1F2TA 4PPFA 3B85A 2C96A 1AS0A 4MA4A 4NYIQ 2V6JA 3H84A 3MCAA 5E7IA 2ZUCA 1W47A 3NC1C 5K8IA 4EIWA 4XSGA 2MMCA 4QM7A 2RGBA 5FFMA 2QN6A 2JDIA 3ZIAD 2QZ4A 3SNHA 1LV7A 1G3IA 5DISB 3RWMB 2IBMA 2YYZA 5BYKA 3ONWA 1UF9A 1N6NA 2WWXA 1EX7A 2BJWA 1XCGB 3KB1A 2HXYA 1Z07A 5JLJA 3C16C 2FGJA 1HH4A 4BZPA 2IA5A 1FFHA 1JBKA 4US0R 3KDSE 5HCIA 2JLSA 3E2IA 3BFXA 2CE2X 3U3RA 2R6GA 4PHFA 4ZIRA 3EWAA 5JI3E 1X1SA 4QM6A 4UXIA 1BOFA 3PR1A 5FBRB 3PUVA 4UNNA 5KDLA 3K9HA 3AVXA 1KJZA 3PG5A 1B0UA 3ZVRA 1S1MA 2EFGA 2AK3A 3BOSA 3IQWA 2A3RA 2JCSA 1KZ7B 4HB4A 1J99A 5SZHB 4DHEA 4RCYA 4PPNA 4WZAE 2ONJA 4PHTA 4NCKA 5GJBA 1VCNA 2PLFA 1JAIA 5SZJA 4CGZA 4LHYA 1NF3A 5FI1B 2YC4C 1TX4B 4IDHA 1I4TD 5HCNA 2CCKA 1TTTA 2JJ8A 2BVNA 3LBIA 4BLSA 3CPHA 4TMKA 3THYA 4DUGA 3T35A 5JHGB 2G1JA 3KJEA 3KUDA 1CIPA 1U90A 4IKEA 4TLDA 3SDZA 2QQEA 2R9VA 3SS8A 3HP1A 2XJ9A 3ADCA 821PA 4C2TA 4XTRA 3LRPA 1ONBA 3SYKA 4QC2A 1CBUA 1PUIA 2JLXA 1A1VA 5KNCA 3SYNA 1XEXB 2ZE5A 2ODEA 1FL9A 2VP9A 3E1SA 1PV4A 2ZRGA 1MO6A 3U7HB 2ZRAA 3GJ8A 3LNCA 4Q21A 1FUUA 2ZRKA 4PC2A 1G4AE 3PUZA 1IN6A 1R6BX 5L3VA 3CNLA 3FKQA 1ZUNB 4XVUA 4NYJQ 2O0JA 3K9NA 4L8GA 3B1WA 1Z0AA 1FP6A 1II8A 5EXSA 2BIFA 2F43A 4RFSA 4W9MC 1T3HA 5KNDA 3A1UA 2J0VA 4M0LA 1GP2A 3LQQA 4PAQA 4Q1BA 5J47A 2ZU0C 4B32A 4R71A 1US8B 4OHYA 2JLUA 5EE5B 1GOTA 1NIPA 3UWOA 1UEJA 4RCZA 4HLUA 4PHGA 3SE0A 3FMIA 5DHFA 1S2MA 4JLMA 4X8OA 2ZRDA 1WBDA 5CYPA 1G3MA 1ZD9A 1BYIA 2ZI6A 2VSFA 1FTSA 4PX9A 5TXGA 3FFAA 1ZIPA 5A5GA 3RC8A 1ZM9A 3KKOA 2J46A 5FOUA 1KI2A 1TUIA 2RAPA 3NHBA 1MRSA 2CLCX 5TARA 1XTIA 3TR5A 2VSXA 1MABA 3VKWA 4LC1A 1S3GA 1EX6A 3DM9B 4TLAA 1CR2A 1OB2A 2IT1A 1X3SA 5H70A 4QXAA 3GJ7A 1QG4A 1CR4A 3UIEA 4POAA 4L15A 4V0MA 1RKBA 3LLUA 1CLUA 1A5TA 4HAUA 1R8QA 2ZUBA 3CRW1 3REFA 1VG8A 1TNDA 1Z6AA 2ONKA 3C7KA 4Q4HB 1DAHA 5SZKB 2ZROA 3QE0A 4PAMA 1DAMA 2BOVA 1L4UA 5J40A 1QVRA 2QBYA 1GITA 4JBXA 4ON9A 5FBVB 1XXHE 4M21A 5DYGA 5G3ZA 4IEIA 5D3QA 3RS3A 3CRVA 4QBFA 5LB2A 1Q3TA 2DWOA 1G41A 1G64A 1KJYA 1HE1C 2FDCA 4EUNA 3TE6A 2VP5A 3ECCA 2W2VA 2E9SA 1S0UA 2LKCA 3A1WA 5CK5A 2IW3A 1JR3A 2GHIA 5ELXA 1ODFA 1TL7C 1W2HA 2QL6A 4KAXA 3MSXA 3THWA 4Q7JB 5IT5A 2J0QA 1QHXA 3EARA 1E9RA 4D0GA 3KJHA 4ARZB 4TQUS 4GOXA 4C3ZA 1XRJA 3FGNA 2IYQA 1MR3F 3LLMA 2DR3A 1NVWQ 2ANBA 3FMOB 3VR6A 1UDWA 2BKUA 4DCSA 2VTKA 1M1YE 1Z06A 3FKSD 1P73A 3K0AA 3UANA 2QG6A 1G8HA 1AKYA 3NBFA 3VR2A 4BWYA 1EFRD 1R2QA 2ZYTX 1Q1ZA 2J7KA 3H1TA 4JL5A 1KDPA 3U2QA 1IBRA 2IUTA 4HLCA 3UATA 1KMQA 5FR2A 1NY5A 1D2EA 1NN5A 4H1UA 4KVAA 2UKDA 4AYXA 4P32A 1W36B 2WKQA 4B74A 1ZMXA 3N2IA 4QG7A 4DLZA 1XXHB 3NDPA 721PA 3NH9A 1XTSA 2E87A 3KFXA 3REGA 3AVPA 3RRMA 2J41A 3WRYC 1D2NA 3F0TA 3D31A 1N0UA 2DB3A 4LJ6A 4A6PA 1JEDA 3MD0A 1JECA 2QMHA 3BC1A 4FMBB 2ZJ8A 4PO1A 4BECA 2P5SA 1EFHA 3BERA 3LA6A 3IBYA 4QNMA 2OLJA 4RD6A 3VHLB 4OQFA 3NBZC 2FH5B 4Q02A 4ABYA 1SULA 5F9HA 4PO8A 1QHNA 2FEMA 1UKVY 4Q4JB 4DLTA 2QSZA 4HSEA 3UG6A 5D3MB 4V0OA 5JWHA 2FF7A 2ZJAA 2YINC 1PVOA 1FP7A 2AKYA 1ESNA 2ZU6A 3PEYA 2AD1A 1W4RA 1AKEA 2IXGA 2OFXA 4KV9A 5KSYA 3Q5EA 1CRPA 2WAYA 1IJEA 1GILA 5HZKA 1KI6A 4DDWA 3G5UA 1G16A 2BBWA 3T06B 4FW9A 5BQ5A 1IXSB 1VYTA 2YNMA 4HZUA 4XH9B 5FOVA 3SFZA 1P62B 3IIMA 3SJBA 3U6BA 1UEIA 3W3ZB 5J4VA 2QM8A 2XTNA 2WIBA 4A2QA 5KTYA 3ZDQA 1CR0A 1X1RA 3WNCA 2I4IA 1G291 1XCMA 1TU4A 1GNPA 2IYUA 2KI5A 3QBTA 4LHVA 3KXLA 1H65A 3ZZTA 3QKRA 4LBVA 2ZE7A 4BZXA 3KX2A 2CMKA 3MLEA 1GKYA 2FNAA 2PEYA 4LHWA 4LJ8A 5EQTA 3QI2A 1JPJA 3DZDA 4LHZA 2OG2A 1VTKA 1R10A 3NHAA 4MRPA 4MRRA 2P67A 1GUAA 3UMRA 4MGIR 1J90A 1FOEB 1W44A 1U0LA 4RVCA 4S2EA 1KI7A 3IIKA 4P4SB 3LO5A 2ZE8A 4KLZA 4A82A 1CULC 4GMDA 1XPRA 1GFIA 2YWGA 4IHQA 1JNYA 1Q12A 4X8HA 4DLXA 2QQ0A 5G41A 1SZPA 1N6IA 3BORA 3O8DA 1XD2A 2V54A 1G8FA 4QFMA 3QEJA 1KK3A 1XDBA 2QY9A 2ZVQX 4TMTA 4X8LA 5JWRA 4IFBA 2LCFA 4TQAA 3R8CA 2NO7A 4JL8A 5ANRB 1YU9A 3MWKA 2GAOA 2GEUA 2O8BB 4R98A 3R7WA 1GNQA 2H5EA 1NRJB 3RABA 1R5BA 1P2SA 4O3MA 1Z0JA 3VU9A 1P2UA 1E99A 2C78A 4XWKA 1EWRA 3IHLA 1BH2A 2X2FA 4PC7A 2XB2A 3HWSA 3IPXA 1NBME 2ZRHA 3CONA 4OQXA 4II7A 4OHXA 4DT1A 2NO0A 5JRJA 4DLUA 5JRZA 2VF8A 4D82A 1IM2A 2UZ3A 2AXPA 1G20E 5FI0B 1E32A 1GZSA 2V4ZA 3KKPA 4BFUA 1AN0A 1OFHA 1U81A 1YR7A 2AHOA 5FPKA 3K53A 3GLHE 4GDFA 4JLVA 1C4OA 1IN5A 1JALA 1W0JA 2ZJBA 2EW1A 1K8RA 1ZP6A 1YZKA 4EJSA 2OBLA 1M6NA 1KNXA 4URXR 5LB4A 4HUQA 4B35A 3KQUA 1T4GA 2AWOA 1E2JA 2V6IA 3EPHA 1Z22A 1SVIA 1EFUA 4NYMR 4Q66C 1IN4A 2ORVA 2YOFA 3OEHD 3QF7A 3CUEF 2BCJQ 1UADA 2EU8A 1G6HA 1XEWX 1R5OA 2XNSA 5FR1A 1P3JA 2J45A 1E2KA 4WW0A 1ESMA 3AKCA 5B58C 2FPKA 2V3CC 1E9EA 1XTKA 2V7QA 4HLDA 5DNYB 3BFVA 3LH5A 3EZ6A 3W6NA 2V7QD 1Z6XA 5B57C 3GLHB 1X8LA 1Z8FA 3TJZA 4MRNA 4A1FA 3AVTA 2HCBA 3EA5A 3NWJA 4Q01A 5B64A 3QG5A 4KLNA 4NCJA 1KOFA 4PTLA 2VP6A 4B3BA 4B3CA 2P6UA 2RCNA 5JS8A 4ILEA 4LSGA 3U4QB 2KBFA 4D4JA 1HQCA 1UKYA 2GVDC 3EZ7A 3T5GA 1NSTA 2JJ2A 4I1SA 4DIDA 2OZEA 3IBGA 3PVSA 4LUCA 2AKAB 3RSOA 5J4KA 2ZRLA 3JVVA 3I1FA 1OXUA 1YZQA 2DHRA 5DH9A 621PA 2V1XA 2GWHA 1GAJA 3K9LA 4TMZA 1TEVA 2F7SA 4KBFA 4D4LA 2CJWB 3DDCA 3Q5DA 5GJWC 2NPFA 4DDTA 2RKOA 2VHCA 5AUQA 1ZM2A 3SBDA 3K70D 2O8FA 2ZRCA 4CF7A 5HKKA 4U5XA 2OEPA 4Q9JA 3QUSA 1R5NA 2IYYA 1NVVR 2V9PA 2ZS9A 3EC1A 1JAHA 1AS3A 5FTMA 3ND8A 3CX8A 1E94E 4CEHA 1KJWA 2FZ4A 4ZKDA 2OCYC 3B1XA 4NHOA 2OBNA 5HPYB 1SQ5A 2B7CA 2QP3A 3B78A 4ACBA 3EAQA 1SXJD 4DB2A 2J7PD 4IXNA 1KI8A 2OLKA 4HEJA 4K81B 4QKQA 4EDHA 2ANCA 3K09C 4FMDF 4LPKA 1G8PA 4LJ4A 1VKJA 4Q00A 2PT7A 2WVJA 4US2R 3AF4A 3EIQA 1L2TA 4LC0A 1T3SA 3K0EA 2JEOA 2Z43A 2RGCA 3DVLA 4TT3D 3T1QA 4H1VA 3TLXA 3CNOA 4F7WA 2IHYA 4ZCLA 2FPMA 3T12A 4QGAA 4Z51A 1A2KC 5J4HA 4KBGA 5C18A 1KSFX 1H8ED 2VP0A 5KDDA 1FW6A 2YWEA 3RC3A 1IJFA 2REXB 4PO9A 1UBEA 5DYIA 5KSOA 1JB1A 1LB1B 3O47A 1Q20A 2DY1A 2ZJ2A 1DARA 1FZQA 1Q1QA 2IYWA 4LV6A 4W7SA 2OE2A 2J0UB 4EFLA 1O3YA 4BPBA 4C2UA 2REBA 4M1WA 4Q1EA 3W8RA 3SQWA 4PQYA 1OKKD 3PITA 4LJ5A 1KDRA 4UJ3A 2Z4RA 3MJHA 1KKMA 4B43A 3AF0A 1KAGA 3FHOA 1G3UA 2FGKA 3QJYA 4HDCA 1IQPA 4UXJA 1KO1A 3QEOA 3P1JA 2ZM5A 5DIFA 4LZZA 1SXJB 5M04A 2CK3A 4URYR 3U3OA 421PA 2F1IA 3TNFA 5L3QB 1ZU4A 1SVSA 4M2LA 2Q3FA 1BMFD 1OT3A 3JZMA 3NC0C 5BW8A 1KY3A 1AZTA 1RJ9A 5FOSA 4EPVA 3ICEA 4WVFA 4B76A 2P2LA 1G9XA 2WJYA 2ZITA 2Q0HA 2BMDA 1W36C 4JLDA 2H18A 3WNDA 3AVQA 4BLOA 1E79D 3WRXC 2AX4A 1G17A 2BMEA 1E0SA 5FUVA 4Q1AA 2PBRA 3WY9A 5J4YA 5JJLA 4CEJA 1CP2A 1E6CA 4LWZA 4B73A 4QJ3A 3HDTA 2IWHA 1YHNA 2P3SA 2YHSA 1U8AA 2CCGA 1YZLA 4Q1DA 3GLIB 3TGPA 2GXAA 2NTYC 1P9NA 1DADA 4MGZR 1E9DA 1SHKA 2OILA 4KI0A 1OB5A 4AKIA 5DI3B 2P65A 4ACAA 3T5DA 2ZJ5A 2ORIA 5H1YA 5KYKA 2QENA 3OF5A 3RS5A 4MUBA 2ZSDA 2PX0A 2W6IA 3EPKA 3SOPA 2XOKD 1SVKA 4QNRA 1XD9A 1QRAA 4GI7A 2GJ9A 2PZFA 3B6EA 3G82C 4MKFA 4M1MA 2VRWA 1GIAA 1L4YA 2FMXA 2ZRPA 1F5NA 2ZR9A 3WYAA 1J8MF 2B7BA 2ZXUA 1SKYB 4EPWA 2G88A 5CB8A 2GBLA 1KGDA 2OFOA 4KVGA 3ADBA 3ZVMA 1I2MA 3QOFA 2W0SA 1MRNA 2PCLA 2F55A 3CRRA 4YXWD 1XTRA 2OCBA 4TZ6A 3Q9LA 4I1VA 4J0QA 1ZC4A 1X86B 3L82B 3C41J 2GEDA 3GLGA 2NO9A 2IC5A 2ZTSA 4CIDA 2CEAA 2D74A 2QRZA 3LVRE 1G1MA 4IOLA 4RD0A 5L3RA 1HT2E 2WTUA 4UXHA 5FUWA 3GLFE 1XPUA 1XD8A 3TSZA 1JXOA 1OYYA 4LYAA 1NVXQ 1N3BA 1QVAA 2FEOA 4WBSA 1N6HA 3ZGXA 4DWJA 2FJUA 1M7BA 2NQ2C 1P2VA 4PR0A 4L9SA 3TH5A 1T3LA 3L0IB 4QGGA 2QAGC 2GF9A 4AWXA 1FPMA 4AIIA 3LW8A 2C04A 2G6BA 1DTSA 2HJVA 5FTJA 2R65A 1IY1A 3TUIC 1KKLA 1VYVA 4UNSA 2IS2A 1E2HA 2VBCA 1I2DA 1G4UR 4ERNA 1AIPA 1R7RA 3B1YA 1J70A 3FMPB 2MSCB 3FYHA 2ZETA 3DL0A 3NG1A 2QE7A 4NKRA 4FCTA 2JDID 1OIWA 3KFVA 3QXXA 4CRWB 2QPTA 4Q9LA 1G3QA 1XMSA 2QSYA 3GJXC 1NJGA 2QA5A 2DFNA 3VTKA 3GLFB 2RGAA 1HE8B 4US1R 2G9NA 5CITA 4NL4H 4HAZA 4R9UC 4F4JA 1VG1A 4QHSA 1FX0B 2AWNA 3BB4A 3LBNA 3MFYA 3ZYCA 4A0HA 1CJVC 4DC9A 4FWIB 1GG2A 1SVWA 2I3BA 4Q48A 1U99A 4IJMA 3X1YA 4OBEA 3UG7A 5JJIA 1KAOA 2GCNA 4TYNA 1N0WA 1E9SA 4W5HA 3AP1A 3SN6A 1NP6A 5C46F 1JR6A 3B1ZA 4DLVA 5DLQC 1NMXA 3Q85A 1CJMA 5IK2A 4NYIR 4JVLA 2KJQA 3KKQA 4TTRA 1KDTA 5FUYA 3QXSA 1W1WA 1E1QA 3TSOA 5EE0A 1OFUX 2QPOA 3OIWA 3KQLA 2YVUA 3LD9A 1N6LA 5J4LA 1RC8A 1GWNA 3WMGA 2CNWA 2KB0A 1W0KA 1K5GA 1Z2CA 2OSBA 4QJ4A 5BXQC 2J9RA 2VP2A 1Z3IX 1Q1BA 3WYGA 2JLQA 2C2HA 1DBSA 1R0YA 3I72A 4YMVA 3B9QA 2BMJA 2LKDA 5FH9A 5TMPA 2WMNB 2HF8A 3TR0A 4XJXA 4C9BA 3CBQA 4DUGD 3OESA 4L16A 2ZVPX 1NLYA 1W48A 1E4YA 3C8UA 4JMPA 4H9GA 3SU8A 5KHOC 2WOJA 1PLKA 5AJZA 2RMKA 1OF1A 3DEFA 5JI2E 5JEDA 4ZIRB 4WIAA 3CO5A 1BO6A 2YOGA 3IEUA 2QRNA 3GFPA 4B48A 4ZDIA 4C4PA 2QROA 1US8A 1NVUQ 4JZKA 1FQJA 3BH0A 1D6JA 3W3AA 3B13B 5JCPA 4IDQA 4D0LB 4KFTA 4ZCMA 2JATA 1YRBA 4R2HA 4W5WA 5F3WB 4BFVA 4GRAA 2QORA 2P5TB 4TLCA 1CRQA 4QBIA 5CIQA 1AM4D 1A2BA 2ZSBA 1YQTA 3X2SA 4G5QA 1TEXA 4WXRA 3I73A 3JVUA 3C14C 4HI0E 3RRZA 2Z83A 1U94A 4P3YA 2RGNA 5JFGA 3GJ3A 3EIHA 4WZ6A 3TW4A 4G5RA 1ZNXA 4A15A 2I1QA 3V00A 1RRGA 1IXRC 1M7GA 4EFMA 1OXTA 1VIYA 5LBIA 4XVQA 2P6RA 2QMUA 1TUEA 4MKHA 4BFSA 4N0DA 4JSTA 2ZRFA 4P4UA 4ZPXA 3HPQA 5IF9A 1AQYA 3KTAA 1UDXA 5AJVB 4BEBA 1HUQA 2WWFA 4U00A 5FL7A 3UWKA 1WBBA 4KXFB 1E0AA 2G83A 1UBFA 2EFCB 2BM1A 5CJPA 2VPPA 2WHXA 4GSYA 4MYCA 4E09A 5CDFE 4Q7LA 3THXB 4C7OB 4Q9HA 1M2OB 3SYLA 1ZIOA 2J59A 1B23P 3TK1A 1Z0KA 2OXRA 3MGCA 3S1AB 1XNJA 2OCPA 4O2RA 2CL7X 2W83A 5EXTA 4AYWA 2EFEB 2IUUA 4UNRA 4ESVA 4BGDA 3PCRB 2AN9A 3DO6A 4PSKA 3I8SA 2O8CA 2ZS8A 2O8DA 4Q4LA 3QF4B 2PJRA 4G0NA 2IK8A 5EP3A 4V0NA 4NYJR 4EQ6A 2CLSA 3FFBA 1DEKA 3R9WA 1E1RA 1Z2AA 2FFAA 1HTWA 1ZCBA 4LGMA 4LYHA 3P26A 2EFDB 1F48A 1II8B 1GL7A 1IAQA 1NN0A 2F9LA 2D3WA 4KYUA 4RFSB 5E95A 1Z6YA 1EFCA 2ZREA 1WP9A 5E3HA 1VIAA 1UAAA 4Q47A 1II0A 3AEZA 5EP2A 3EX7C 2SHKA 1AK2A 2XNDA 3L8YA 4AI6A 3K0CC 2D4HA 2JLVA 1U0HC 2AR7A 3V4RA 4Z8XA 1DS6A 5DI9A 1CU1A 2X1VA 2RB4A 5B30A 1E0JA 3M0EA 3T15A 1E98A 1W5SA 2QNRA 4IVPA 2XXAB 3B5JA 3NXSA 4L4UA 4KFRA 4PZLA 4YMWA 1WXQA 4FCWA 4B44A 1VECA 2MMGA 2RHMA 2GVZC 4JIMA 4NMMA 3UXMA 2GCOB 3VR3A 4BE7B 5BN5A 2WSSA 1JR3D 2ZIAA 2NPIA 1AS2A 3EXAA 4K8OA 3QXHA 2VEDA 1SXJC 1XXHA 2W2XA 3GD7A 3SJCA 4B33A 2HJGA 1KIMA 1P2TA 1UKEA 5TB5A 1XP8A 1ETUA 1JJ7A 2OFWA 4CEIA 4IDPA 3TVDA 2QMEA 1VCOA 2V55B 5A4JA 2W6JA 1N5JA 5CK4A 1RE0A 1Z29A 1KI1A 4TLEA 4IXMA 1E2QA 4Q1CA 4WZBE 2C03A 3WNBA 1OFTA 4JLKA 3QY0A 2Q9BA 3M6AA 3KQHA 2UZIR 4BFZA 4F91B 1G8YA 4Q4JA 5CB6A 1NL3A 3EZFA 3LY5A 4KFUA 3AUYA 1XTQA 5D3MA 4WXPA 1XPOA 2QBYB 4DCUA 1KYIA 1S9HA 1D9XA 4TZ0A 2WKRA 4MYHA 2IYTA 6Q21A 2YOHA 5EUQB 1KTVA 4M1SA 1P75A 3U7FB 1GNRA 2JJ1A 2JIZA 1M74A 4Q4AA 4ASUA 2EQBA 4LOAA 4WAUA 2XZLA 2VA8A 3AF1A 3THWB 2JIZD 4RFVA 4LJ9A 3AF2A 3RRYA 2GJAA 1S3SA 3U3KA 1JQJC 3ZVNA 2XZPA 2F1RA 4OYHA 1V5WA 4Q9IA 5EE9A 2RGDA 5FTKA 4XOIA 3PXGA 3MG9A 3QSYA 2NOAA 4MGKR 3BAFA 2HLDA 4TSFA 3K0AB 4UNQA 3F3YA 1U98A 1XFAA 4OI4A 3A4MA 1G18A 3CX7A 5JZVA 8OHMA 3B8HA 5IHPA 5FTNA 2C9OA 1CR1A 3CB4A 1FNNA 1N25A 2WJHA 3ZVLA 1NG9A 1KI3A 4EPRA 3C15C 4FWTA 4RZUA 2R6DA 2A78A 2IWRA 4A2PA 3H4MA 3U5ZB 1N2CE 4ZDWA 1G8GA 2GK7A 4P4SA 4OQLA 2P0EA 1MKYA 2WAXA 2BCGY 2FZLA 4UKDA 1Z08A 2HEIA 4MKGA 1ZUHA 2GJSA 3IGFA 1IY2A 4DDVA 3QBVA 4JVMA 4I4LA 4IEEA 2YZ2A 2YWFA 1VG0B 3BB1A 3CRMA 1RPZA 4GZMA 3CX6A 4DB4A 4TMVA 1QHYA 1KMHB 2ZJYA 4IOJA 4QJ5A 1AA9A 2YKGA 1OYWA 2A5FA 4DLYA 2H7VA 1F3OA 1UKZA 3BH6A 5FPYA 3BK7A 2O8BA 2HCJB 1ZINA 2ERYA 1KO8A 2IXEA 4JS0A 3T61A 4DIEA 2QAGB 1SGWA 4CT4B 1RW4A 5DGXA 5EP4A 3CF0A 4MGYR 2H57A 2XAUA 4IOMA 3GQBA 1R8SA 3P4XA 2RHDA 4M4SA 1DAIA 1X8JA 3QKSB 4MDFA 1N5IA 4FMCF 4QGFA 1XF9A 3OEEA 2X8AA 3A36A 5K8TA 2EYUA 4NBSA 3FPAA 3RWOA 5AUOB 3RLFA 1KDOA 4A6XA 3VKGA 3AGPA 3ASYA 3DPUA 3LFUA 4RD3A 3TMKA 5JWOA 3IILA 1T6NA 4BLRA 3BXZA 4A8JC 2WPDA 1RYFA 2TMKA 4PFSA 4QOSA 4B3FX 3WHLA 3LX5A 3CR8A 4P33A 3W6OA 4PQFA 4B2LA 1XB2A 4JKIA 4JLOA 2AD5A 4BRUA 3A37A 4XD7A 3EA0A 1XEFA 4O2LA 3TQFA 4IRUB 4OK6A 1P61B 1LF0A 1VG9B 4M9ZA 4NYMQ 4TL6A 1VHTA 3CPEA 3FOZA 2XSZA 2ZI7A 3A8TA 5G53C 3P32A 5AUNB 1KNQA 1NBMA 2FE4A 1MT0A 5JEEA 2K5UA 1E2IA 3U6KA 5H68A 1DO0A 4KU4A 5IRCD 2B21A 3AB3A 2GXUA 4NDZA 1W0JD 4E03A 4TLBA 4C0SA 4PZYA 1XD2B 4Q9KA 4M9QA 1XTJA 5HE9A 4WOPA 2JLWA 1FTNA 4C0HA 5FUXA 3GLHA 1YKSA 2OAP1 1YZGA 4JJZA 5L3SB 1HV8A 3BJIC 2VH5R 1VCMA 3VHXA 3RS7A 2FV8A 5UKDA 2REOA 1N6KA 1CTQA 4RKFA 1W4CA 1MO5A 5KSZA 4URVR 3U4QA 1WA5A 2WBLC 4BFTA 3K0FA 1HYQA 1WRBA 2VHUA 3LVQE 2ECKA 2C99A 2D2EA 2VL7A 1IN7A 2NZ8A 4RJLA 4RZXA 4BRWA 2O8EA 5JCZA 3RS2A 4K46A 1UJ2A 3QQ5A 3Q72A 4LDJA 3V9PA 4I1OA 3IHWA 4E5UA 3OIUA 3AVUA 2CJWA 1FMLA 4B75A 3ZD6A 3K1JA 4QL3A 2OT3B 3SJAA 1Y63A 2ZANA 4TN1A 4KSBA 2NIPA 4G01B 2GKSA 2IHBA 1U8YA 4OI2A 3BD9A 3SBEA 4DXAA 2FA9A 2J87A 3VFDA 2NG1A 5KNBA 1W5TA 4EJSB 2DYKA 5AJWA 4JYBA 3F8TA 2FN4A 1IHUA 3QKTA 1N6OA 1ANKA 2WWIA 4AG5A 2JJ2D 4HAXA 3W90A 2IS4A 4ZI2A 3WBJA 1DAKA 2OAQ1 1U8ZA 3W5JA 2IYVA 1P60A 5EP1A 5F98A 2JASA 1SVOA 3OAAA 4FINA 2G3YA 1TQ2A 3MWYW 1ZNZA 3NTUA 4QHTA 1ZM3A 2FFQA 1P7CA 3M1IA 1N5LA 4Z54A 3QXJA 4AKEA 4A2WA 2EVWX 3M4YA 5HKKD 1U0JA 2A5DA 2OV2A 4TL8A 1OV4A 2GJKA 1AGRA 1HA3A 1QDEA 1TQDA 1DO2A 4LJYA 5E4FA 1KO5A 2CCJA 2RH5A 3X1XA 4AD8A 3D3QA 5J5CA 2A2ZA 2NO6A 1NLZA 4OQNA 1UPTA 2GXQA 3UMSA 1P6XA 4L5BA 2KWIA 1E2PA 3VMFA 1RZ3A 4FD2A 1OH8A 3THOA 1TU3A 4PSVA 1F2UA 3E5HA 4HATA 4TYQA 3X1WA 1OH6A 3TSWA 3TVTA 3AH8A 2BEKA 3SEAA 1SXJE 3W8NA 2J0SA 1DG3A 2Q9AA 5BYJA 1G7TA 4JLPA 1IY0A 3BIFA 2ZJZA 4OJQA 3MMPA 3I61A 4YMUA 2PMDA 2KBEA 3EZ9A 2BHRA 1T8UA 3VX4A 3I32A 2W0MA 3CF2A 4NCHA 3W34A 1HURA 3RAPR 1MV5A 3DOEA 1ZD8A 4YC7A 3K70B 1VHLA 2ZSFA 4LJAA 2IYXA 3U60B 4CT5A 1YR6A 1S9DA 3RS4A 4DLRA 1JI0A 2A5YB 2Z0MA 3EG5A 5JSZB 3I3SR 2ZR0A 4MITA 1V43A 4OI0A 1X8KA 1BIFA 4CEHB 2AXNA 2OCAA 3PV0A 3NH6A 3EC2A 3SI7A 1O87A 1YJ5A 4XWOA 3VAAA 2DPXA 1EK0A 3GLIE 1CJKC 1R0XA 2PEZA 1QHIA 4I1UA 4DSUA 3B82A 2OESA 2B6HA 3AP3A 3IQXA 4Q7MB 1LNZA 2VIIA 1CEEA 2E1RA 3EASA 4AY2A 1EG7A 2XX3A 4DZZA 4JLAA 4D80A 2JLYA 2ZJOA 3NDBB 3B1VA 2CK3D 5EXXA 4IFEA 1XU4A 1F60A 3T1OA 3UMFA 4CDGA 3LWNA 4URWR 2VYFA 3RANA 3B2EA 1OSNA 4F93B 1TADA 3PQCA 4OK5A 1G5RA 1NJFA 2HT6A 3U44A 3KUCA 3GJ5A 2VO1A 3AVWA 1VYUA 2ZYVX 1W49A 3KJIA 4BUJA 4Z1MA 2H8KA 4BFYA 1G5TA 1SKYE 1DELA 1OE0A 4FIDA 221PA 3WHKA 2CXXA 3K8YA 1KZGB 2QMOA 3U3JA 2N46A 3VR1A 4HLQB 1LY1A 4IVRA 3ZH9B 1Q57A 4FN5A 4XVRA 2D2FA 4A0GA 1I4DD 1CS4C 3GFTA 4W5JA 1XX6A 1IOZA 2Z4SA 4HAYA 2ZI4A 1QBKC 2QP4A 3OE7A 2D62A 1COWA 2GESA 4L9WA 1EFTA 1NMZA 1ELOA 1NSFA 1VDZA 4RZ2A 3CWQA 4GOKA 5KUTA 521PA 1E9AA 2RGGA 2W6ID 3L8ZA 3QPUA 5GADl 4LK2A 4M1TA 4V03A 1Z6TA 1OXSC 4MUAA 1RJ9B 4LY6A 3CW2A 2R6FA 1U2RA 1M34E 3I4LA 1PUJA 4V0LA 4KODA 2GAAA 4O25A 2WIAA 1KK2A 4IVQA 1GDDA 4QGHA 5SZIA 2WKPA 1Z0FA 1E2MA 2IUSA 3AV0B 4LCBA 4JL6A 1GRQA 1E96A 2A7QA 2D7DA 1MO3A 4KYIB 1E9BA 1E69A 3CWZA 4YDSA 2BMFA 2WJVA 1GKIA 4LBYA 3JZAA 4GPTA 3K9GA 5K8UA 2ATVA 3AQ4A 3R9IA 5FPHA 4MH0R 3TW8B 5CM8B 5FL3A 4A92A 3CR7A 4QRHA 1KI4A 2QGZA 2HV8A 5FBQB 3D7MA 4N0EA 2CHQA 1Q22A 2FOLA 3U7EB 4KSCA 3KZ1E 1G21E 1XEWY 3D6TB 4YONB 3LV8A 2WJIA 5DN6A 2W58A 4GFDA 5KDOA 2HYIC 3RDPA 1OFIA 2GEVA 1TAGA 2ZR7A 3GLFA 1X6VA 3A6PC 3DKPA 4OL0A 1ZD1A 1AQUA 4OJKA 2WJJA 4OHZA 2JAQA 1OJLA 2DCUA 2BM0A 3IO3A 1OHHA 1FX0A 1DAGA 1QZXA 3HR8A 4M22A 4ITRC 1QHHB 1E2LA 2FSHA 2IYLD 2QT0A 2BJVA 5G3YA 2VLIA 2WWHA 4URUR 2C8VA 3AF3A 4ZKEA 4FMDB 5A0FA 3TKLA 2QE7D 4IDNA 4BLQA 2ODBA 4OK3A 1I4LD 4B71A 1W4AA 3GLGB 2R6AA 4F4CA 1YR8A 2J1LA 2FX3A 3EIEA 1QHSA 1Z5ZA 4A8JB 5L8VA 2GXSA 4HDQB 2X77A 4YMTA 1MO4A 1R0ZA 3ZIAA 1YRAA 2IXFA 2WZQA 3QKUA 3CM0A 3LQRA 2ZRBA 5F9FA 2XGJA 2CVFA 2CVHA 4RD4A 1KSHA 2ZRJA 4JT2A 1GSIA 2C77A 4BLTA 1E3MA 1XMIA 5AUPB 4JYCA 4N3NA 4B3DA 1P5ZB 4TYWA 5JHHB 4TL9A 3LX8A 3P27A 4BZQA 5HTKA 5C1BA 1F2TB 5TVKA 4G5GA 4TMWA 3UPUA 1E2NA 2KE5A 2VHJA 3AKEA 4HB2A 5IK2D 1C9KA 1G6OA 2C5LA 1E1QD 1ZM4A 3SC3A 2CDNA 4JKYA 1D2MA 1XEXA 1W2GA 1N6PA 1W7AA 2CNWD 1W0KD 4HUTA 1NIJA 1NN3A 2BBTA 3HR7A 4DLWA 4NONA 3ZS8A 1JEEA 2Z6VA 4TYYA 4DEYA 3AUXA 1LS6A 2ZSAA 2IYSA 5GVRA 4UJ5A 3PEUA 2WWWA 3AM1A 2WOOA 4DCNA 4NP6A 4AKHA 4M1OA 2DWQA 1S8FA 3ZLJA 1OXVA 3CZPA 3H0KA 3VNUA 2ZQ5A 3GJ0A 4M9SA 3QVVA 1F6BA 1ZCAA 4N1AA 2WMOB 1P9RA 1G19A 3NBXX 3NEJA 4LRWA 3I8XA 4UNPA 3A58B 3Q7PA 3EZ2A 1Z28A 1JQLB 5KPJA 1BYUA 4B47A 1LF5A 1E2FA 4RZ3A 2WWYA 5KO2A 3TRFA 3EWSA 3OHMA 4DSTA 3QPVA 3MJRA 2FSFA 3CKLA 3CZQA 2DFTA 1KHTA 4EJSC 1YR9A 2GA8A 1GTVA 3QIAA 5HZHA 4JSYA 4NCNA 4TWZA 1CF4A 1QF9A 4P0TA 2ZYUX 5FOXA 4A36A 3THXA 4C7OA 2ORWA 4BQSA 4C0JA 2XTZA 4JBWA 3KXIA 3CNNA 4TMXA 3S1AA 4TQ9A 4DVGA 2FWRA 4PPGA 1K6MA 2PZEA 5JBQA 4GP7A 2ERXA 3THYB 1R0WA 2F1JA 4LV5B 3FHCB 3QF4A 1YVDA 1NMYA 1ZBDA 1G7RA 2NZJA 3N5CA 1XJQA 2VP4A 2HT1A 1EESA 2W2TA 3K09A 3ZD7A 2Q3HA 3BS4A 1Q0UA 5CIWA 2DBYA 2WICA 5FL7D 5TDHA 2GTPA 4I99A 2DFLA 1DAEA 1XWIA 5EZ6B 3T1TA 4LBZA 3B60A 3ETLA 2PCJA 3O8BA 4Q4HA 1WQ1R 3O8CA 2EFHB 3GJ6A 5AJXA 1YZUA 4YMSA 3FE2A 2CHVA 1Z6GA 1SVLA 2XITA 3L2OB 1E4VA 4C30A 4B2IA 2QTFA 4PPQA 2WSMA 2O0HA 5CDFA 1KSGA 1DOAA 1LVGA 5HR5A 4URZR 2XXAA 2V1UA 2ATXA 3BWDD 3NKVA 1U9IC 2YWHA 5AK0A 1E1RD 2LWIA 4MRVA 1BKDR 1OXXK 3SQXA 3VNVA 4PHHA 2F43B 5LD2B 1TF5A 1A4RA 1NKTA 4ZDJA 2AL7A 2GCOA 4ESHA 1HEIA 1ZYUA 4XWAA 4Q1FA 4V0ME 2G0TA 3KB2A 1E9FA 4BFWA 4NPHA 4ARZA 3K70C 1Z63A 3PUXA 4G1UC 2XNDD 2PT5A 4GOJA 4NE2A 4HB0A 4PSAA 3QPWA 3A4NA 4IW3B 1NNEA 4O0MA 2GZAA 1VMAA 4RKEA 5EUMA 5AR1A 2XJ4A 2GETA 3KTAB 3DOFA
chains in the Genus database with same CATH superfamily
1YDFA 3WBKA 4XCQA 3PCTA 4AC9A 3FVQA 5KHLB 1SKQA 2C5HA 3GUUA 4BX9A 4KRXA 1CXZA 3S7TA 5JT1A 4FJ1A 3GBSA 1JSZA 3W3AH 1LSUA 2E4YA 2GS9A 4GZ3A 4KXNA 4E13A 5DULA 1FQWA 1E66A 3WLMA 1YFZA 3VR3D 1R12A 4D9JA 1JG2A 2H51A 4KEAA 1OGIA 4TWRA 2J6CA 4UM8B 4X1OA 4DWVA 1Z5WA 3RC7A 4EARA 5FA6A 3ZW9A 3NV9A 2PXAA 3DZ8A 3OY7A 2R47A 4IMRA 2JA1A 1JX6A 4PZZA 1L5QA 2EIXA 4RPJA 4D9EA 4R2WA 5IMSA 4N39A 2WB4A 5ADVA 1MDBA 3ZY4A 1PE0A 1XJ0A 2ENUA 1THTA 4K9NA 2PMWB 4DCTA 1T2DA 1Q21A 4IDOA 3P4YA 1QG2A 3WQSB 2F8TA 4D43A 2VPIA 3N75A 5A5VA 3L79A 5DHAA 1C3OB 4IDFA 4B6FA 2NAPA 3PF9A 4DY6A 3BHJA 3T3HA 3OIYA 4B3RB 3EVBA 2OTCA 2EYQA 3PFNA 2EW2A 3E6AA 3OX4A 3N39C 5AVRA 2JIDA 4CKEB 1L7PA 4YCJA 1PFWA 4RSGA 4PC6A 3GRRA 2QTMA 1R4AA 5AW7A 5FEUA 1M2EA 3CUKA 3WB2A 1YF3A 1YT5A 1EEXB 2XKAA 1LPBB 4QOJA 3AX6A 4TWIA 1E3EA 4BL5A 2ENWA 2R4TA 2DQYA 1E20A 2A1UA 4F5YA 5E0KB 1WCV1 4YRMA 2C9MA 2APJA 1GGHA 1MRZA 4PQRA 2X58A 3II6X 1V3TA 2KLHA 2JIQA 5BN5B 3VPXA 5GJCA 3AHGA 2M2IA 3RSSA 2O57A 1RRPA 3QYPA 5P8WA 2Z3VA 1Z8HA 2V96A 3B36A 3I9KA 4AULA 3ED1A 4ZO9A 2R8PA 2BEVB 4HWTA 4BNIA 4DBLC 3J80A 2BGWA 2UYOA 4JT4A 5TY0A 4CEIB 1VCIA 3OO1A 4Q82A 4NTZA 3ZC3A 3RAJA 3HYRA 1H4QA 4P38A 2FK8A 5D7NA 4TSFD 2G28A 4Q5IA 2PWZA 2Z9BA 3PQDA 3EVCA 1UK9A 3R6GA 2G71A 1LPAB 1LV8A 4KUGA 3MGKA 2FSGA 2X7JA 3RYFA 4KRFA 4M8IA 3IDQA 2DECA 3Q88A 4DR4B 2Z1MA 2O5VA 3GL9A 2BC9A 3VQTA 2WLSA 2PXHA 4F9FA 2DQZA 4LF9B 4I81A 2QAGA 4L7VA 3HRHA 2WILA 2H5LA 1KSJA 2JK1A 4EMTA 1DJOA 1CETA 1PGJA 1WQ3A 3PEWA 1N1EA 2B8TA 5KAMA 4J4TA 2YW2A 4O2AB 4L02A 2C84A 3FXAA 3P2OA 2D1FA 2YFHA 4LDAA 3W9YA 3I92A 2YJZA 3F7OA 1IONA 4Q4AB 4P53A 4EJFA 3HB4X 3IUYA 5K0SA 3DPIA 4L57A 2LGJA 3NV7A 4Q34A 2K6GA 3FB4A 1L5YA 1NYRA 5M3BA 5C31A 3T5BA 1ZUIA 4XA8A 1Q15A 4PZ9A 4FOPA 1Q7CA 4HNGA 1MGPA 2C07A 3X1DA 1DPFA 4ZGWA 3GWGA 2IS1A 4QGSA 1QCCA 2H85A 3DKVA 3OA0A 3EHDA 1J56A 3EC7A 3GFVA 3O83A 4FBGA 3L6CA 1Q3HA 1FFGA 4RAQA 3BQNB 2DH6A 3PLRA 1C1XA 1UODA 3SZLA 3EPLA 2ZT6A 1SCQA 2DGDA 3CRNA 4LQ4A 5FBWB 5K03A 2AUMA 3UMYA 3MGBA 3KETA 1T1JA 2Q5JA 2ZDGA 3T7TA 2GBLC 3ABIA 3HL0A 3NRJA 1ZHOA 3C1OA 2VJMB 4LCEA 2IEYA 2C3OA 4KUEA 5TVGA 5K3EA 2JBWA 1IY8A 2C98A 2CC2A 3R3YA 4RE6A 4B8YA 3HB9A 4PFQA 1YL5A 3BBPA 4KP7A 4R6WA 2E85A 1YA4A 3NZEA 4GLOA 3FCUB 3VR4A 2UZ4A 1KARA 4YPFA 4ZCTA 3MUNA 3TS1A 3DR3A 1KMMA 2OO3A 3QUAA 2AEMA 3HZRA 3TQQA 3JYOA 4R83A 5L7YA 1UANA 3G0BA 2WPDD 3ONNA 3LPDA 5J43A 3OBBA 4Z9YA 3EQ8A 3QKRB 4ES6A 1HTTA 2YRXA 3GN1A 2HWUA 3AWIA 4A5OA 5DE3A 2D7CA 4R7ZA 3BRSA 1VPLA 1KEEB 3K2BA 4KN8A 5LYJA 1ESDA 4P4LA 2VJPA 3E61A 3PJFA 2XYPA 4YRZA 1K3UB 3HGTA 1YS1X 5BSMA 4EB6A 5L3SA 4PLGA 5IP5A 4QQ8A 4ZOLF 4F9EA 1LRLA 2PZGA 3PNSA 4LDNA 1CP3A 1XTTA 3IB3A 2YASA 3BIJA 3RF6A 2HSDA 3RVKA 2XSZD 1DQYA 2CB9A 4JVNA 4I46A 3A06A 1A76A 4QU8A 4A10A 5IKEA 2ZRNA 3C87A 2J4DA 4R16A 4DMCA 1A72A 1I5RA 1XA3A 1OC2A 2XVAA 3DMNA 4Y2VA 4E51A 5CDSA 1CDOA 2AJBA 3DMTC 3PP8A 3PSHA 3AC0A 3RH0A 2R8ZA 2F00A 3QHAA 3TSCA 3CH5A 5C51B 4DA4A 2YZMA 3CU5A 1V11B 4K3VA 4WFIA 3S2FA 3OECA 3QUQA 1EU1A 4JOQA 3VRHA 4YAWA 3NCHA 1DAFA 4DCCA 5JS1A 2E5LB 3MQ2A 3EQ9A 2ODNA 1PCXA 1QYVA 2CFIA 1MJNA 4RPCA 4NEHB 5F51A 3AOEC 4C0KA 2WB2A 4HQ0A 4J6FA 2VBGA 5F2EA 4QFBA 4QBHA 4DSOA 1V45E 3ETNA 1L3BA 2VZ8A 4BB6A 4O29A 4IGIA 4YRNA 1CNEA 4AG6A 5BUCA 3OKCA 1NBOA 3KZVA 1EWQA 1ZD2P 2MWMA 4MO2A 4AF8A 3PGLA 3MMNA 1E2DA 5K0LA 2CBZA 4Y2QA 1NBWB 3JYQA 1HQYE 3EH2A 3H16A 3K5HA 3KS9A 1C3XA 1SZCA 4LWPA 2TMYA 2C2BA 2QTRA 9MHTA 3DMYA 4DR1B 3MWDA 4YLGA 3LCMA 4L5AA 4ZCIA 4HG2A 4GBGA 2WJ4A 2VTDA 1W4BA 4JI1B 1Y9AA 5LKRA 3UUGA 5J1SB 3ACBA 2FW9A 2GBIA 3ISJA 5DX0A 5GOZA 1SCAA 2ZB2A 4D96A 4BQIA 2WP0A 3G2HA 3HI6A 2K87A 2NX2A 3D8BA 1KP3A 1BVYF 3DDZX 3IRUA 1GRNA 4PANA 4L8FA 5ERGB 4D9CA 1OR8A 2OGTA 3EUFA 3IELA 2ZOSA 3K1AB 4NX2A 4RQAA 4CTJA 2P62A 4J43A 1R6XA 2P6OA 1NU6A 1JH8A 1RXIA 1W76A 2Q29A 2QL9A 3C4VA 4G25A 2JGIA 1SU7A 1ZOLA 3M6FA 4D2IA 4WBNA 1QP0A 1W5FA 2QTBA 1NG1A 1MB9A 4GMXA 2HTFA 3U37A 4KSYA 1ECPA 5JZOA 2UVQA 2HUPA 5FPTA 1XMJA 2Q1XA 1LTHR 1NZDA 3L18A 4LTMA 5A4AA 5ITZB 5KB3A 3BDAA 1OWMA 2GF0A 1NPDA 2GZ2A 4OKSA 1ESCA 1JSXA 1Y7LA 1TZMA 2BFCB 3LECA 3P2JA 4P86A 3UWDA 4C0XA 4TOIA 3KXDA 5E1DA 5G1PA 3WZ2A 2OO7A 1PFVA 2QEQA 2UUOA 4RHYA 4M0DA 5ALIA 2QRUA 3RJTA 1Y3FE 2BWJA 1Q14A 3AG6A 3COSA 5JMTA 3S55A 3OWOA 2O8EB 4Z5XA 4NEGA 3VO8A 1L5WA 4JLSA 4MQBA 5K0CA 4ROTA 1D0SA 1J8YF 1R5JA 1XJCA 2OD7A 5C5IA 3EXEB 2ZYDA 2CT8A 1WMFA 4B80A 3B9PA 3K0CA 4QDUA 3W5CA 5KC8A 3HDGA 1W88B 4GQIA 4R31A 4C2BA 1X70A 3K4HA 4N01A 1TM5E 3W2TA 5C1DA 1TF7A 4B2PA 3AY6A 5B53A 2J0UA 3ROEA 5J59A 7ADHA 1U11A 1FTWA 1MG5A 5GZ6A 4C03A 4UQPA 4CDRA 5B7PA 2IGTA 3GFQA 1L4BA 1VIVA 2H9YA 5DOZA 1M0EA 2O8VA 2JLRA 3HU1A 4GT1A 2C95A 2BFBB 1N92A 1WVGA 3FI0A 3VAYA 5K99A 1E9VA 4NFYA 5ISMA 1QTNA 5DPMA 1Z4IA 3FLMA 2C3YA 3PC3A 2BFOA 4GPZA 2EGGA 5KX5A 1CUCA 2V8OA 2XEXA 1P31A 1KO4A 3KUUA 4HVTA 2J7PA 3N0VA 4D26A 4MW9A 1MIHA 3S1SA 1AUPA 4R2IA 1MAVA 1CUWA 1R6VA 3SXJA 3JZFA 3K31A 2FR0A 1TCAA 4JU9A 1GV1A 4RXTA 3ZZ0A 4FMCB 4YPOA 3R24A 4U7DA 5ITSA 2C8JA 4DEXA 2LUOA 3L7CA 2BMVA 1E0KA 3ZDZB 3AR6A 3HKEB 1JQDA 2P91A 4HMQA 4YMIA 1WDKA 3IOCA 4KPUB 1IXZA 1RYHA 4TT3A 4PONA 4UU1A 4U9IS 4UATA 3V8VA 2IVZA 1LW7A 3LHSA 4MA5A 4QOHA 3TD2A 2IBTA 1S01A 4RLSA 3UK0A 1QQ7A 3E7XA 1MZVA 2HZBA 4NZOA 2CNNA 1GRRA 1P0FA 4JBYA 2Q6VA 3PC8C 1R8XA 4DC0A 3C4QA 4ZTZB 1XVVA 4C06A 3HWRA 4FNMA 2VHYA 1FYEA 3HK2A 4IWXA 2Q3EA 3R0IA 1YKFA 5C37A 1JPVA 1K3FA 1ISMA 1T5OA 1OKKA 2GRJA 4OV6B 3LG2A 1WZEA 4MJXA 4WOJA 3GPLA 3IQIX 4WCFB 4DV1B 5KTTA 1C8VB 1V16B 3A1SA 3NNDA 1D7OA 3VI3B 3VU0A 4DBLE 1UBCA 3JAWB 1CSEE 3TO5A 3GJQA 4NNJA 3FKJA 2ZJFA 1VSUA 2ZIUB 2I7CA 3L3BA 4XQ0A 4YI5A 1NI3A 4D92A 4D9MA 5J2TA 1QIFA 2FW6A 5ILOA 5GONB 3BMOA 1PI3A 3E70C 1SCKA 1FXWA 4UPDA 5B4UA 3HU2A 4MRAA 1UJBA 3L46A 4GM1A 4AVYA 1GTG1 3UTDA 2TMDA 4XPIA 2X8JA 2WWRA 3OFKA 3J81k 3UAYA 1OLOA 1TYEB 3BIWA 1TM3E 3LX4A 3MB5A 1VKRA 1VJTA 4TTPA 5IYZF 1TQ6A 3GLUA 4JT8A 4RW0A 4EG6A 1H1DA 4LECA 5IDVA 2HOQA 4IV0A 1E79A 1XEAA 3GHHA 2ZUDA 2NGRA 3QFFA 1IWPB 1ABFA 4ME6A 3S5UA 3ZU3A 2C7PA 2HPAA 3DBIA 4Q9NA 3OE7D 3T4UA 3EVNA 1ZC3A 2HH9A 1UPFA 3MS4A 2GTIA 2NAFA 3QHPA 4OYRA 3UA4A 1NI4A 2ZWVA 2W00A 3IAS1 4GLLA 1VZ2A 5EJGA 4EKDA 5CFZA 3LKBA 3OE1A 1NXWA 2B8WA 1SY7A 4XDZA 2X19A 3FYTA 3ZWVA 3AHDA 4PZAA 4EOGA 3HKDB 4LYJA 1OZGA 3ZGYA 2FFRA 1NDUA 3UMMA 3G23A 3IIJA 3TZQA 3OE5A 3GFOA 2GEJA 3CF4G 3PNVA 4X24A 3GT0A 1HY3A 1O94D 1CERA 2OHHA 3JZIA 1L5KA 2NMVA 1SHZA 3NETA 1X87A 1USGA 3F96A 3H3FA 3IQDB 4XM1A 2XOKA 4DJTA 4Q19A 4R8KA 2ZRMA 4WNAA 1CQZA 2CLDX 3KYDA 1X0XA 1DCTA 4G0WA 3UAGA 4FYIA 4MDEA 4BMYA 4CEJB 1JXMA 3ZWPA 2FZWA 4UHBA 2EHDA 2HMAA 2RFLA 2EERA 1FFSA 3R09A 2NXWA 2X3YA 3AWDA 2Q2WA 4XZ3A 3R7NA 5LFAA 2CLMB 1A5AB 1PJAA 3FCEA 3FIUA 3HMKA 3VKUA 4P31A 3VZPA 4F04A 3K6RA 4PCVA 3D1VA 2WNSA 4JLNA 3ZYZA 1AXRA 3FGZA 2C1EA 4X54A 3STHA 3B3FA 3DWGA 4LQLA 2XTJA 2Q9CA 3AP2A 4W82A 1FNMA 3B1KA 5FV4A 3GGPA 3N07A 1GD1O 3GARA 4M8LA 4UULA 5LPNA 4O6VA 2JW5A 3MD9A 1YB1A 1GCGA 2GZHA 5LA6B 2Z3WA 3L40A 4FFLA 2G07A 2HF9A 4OHCA 1TFUA 3KWFA 1RQNA 5GAJA 3VPAA 5IJ9B 5EZ5A 5EC8A 1W73A 2GDJA 2HADA 1ULTA 3GEEA 3C5CA 5H8WA 4IM7A 4BUCA 1PK9A 3C6MA 3H5NA 3P9YA 3IEVA 2OCGA 2JFFA 2VTVA 3IEIA 1R27A 2MYTA 2P9YA 5DHQA 2FPPA 1GA4A 5BN4A 3DWEX 3PEVA 3OIDA 1H4VB 2GCPA 4F45A 3DAPA 4BB0A 3A2KA 2XWPA 4YJ2F 4L73A 4X7MA 4R3NA 3U5TA 3R9XA 5K3SA 1PTJA 4U5QA 1ZITA 3ZWYA 3RYTC 3ER9A 4GZ6A 3TX2A 3OPYB 5HGXA 2CWDA 3USCS 4QPNA 3UM9A 3ZBUA 4DBZA 1BXZA 2B36A 1IVSA 1BJKA 4AUKA 1AS0A 1PYOA 3DFUA 3HCAA 2AFHB 3KJZA 4MA4A 4DZRA 2JGRA 4YRKA 2P27A 3H84A 5AOBA 1P7YA 1TQ8A 2ZUCA 3M89A 2NSJA 1VM6A 3P2KA 3R0ZA 4WY8A 1YZYA 5L95A 5JG7A 1BEUB 5ALXA 3ZZNA 4UAVA 4GGOA 3IODA 5COQA 5G4LA 3UAWA 3GFBA 5FFMA 4A0QA 3HYNA 1NW7A 3H97A 4K03A 5BMVB 4XGQA 2QZ4A 3SNHA 3MHPA 5LXTF 1LV7A 2CDCA 3JASB 5KKNB 4IUDS 5EJ5A 3ONWA 4F4UA 4UPVA 1UF9A 3C3JA 1PJ3A 2YY6A 4A2CA 2WWXA 3OQOA 4MQFB 4U2KA 1D2RA 3WNQA 3V3TA 1G59A 3OZWA 4D0RA 3KB1A 4LEIA 1X77A 5JLJA 4GOLD 4Z9XA 5DDIP 4D9NA 3PE3A 1VXRA 1FFHA 1JBKA 1YHZA 1O6GA 3AEXA 3MCUA 1WABA 3BCHA 3KCQA 4ZMBA 4MB0A 3E2IA 2E4UA 2Q46A 3CTPA 5EIOA 4ZVRA 5THKA 4BJ1A 3FCOA 4P58A 4IJVA 1X1SA 2EX0A 4KK3A 5LIPA 3RUPA 2QX9A 5L4NA 1KETA 2G7MC 4UXIA 3GLIE 4QM6A 1QK5A 3T41A 2Y1WA 3DFZA 4RHEA 1LKZA 3I6IA 5KDLA 4N5DA 1YUMA 1ARZA 1B0UA 3VDNB 4TRRA 4NR0A 3A6JA 1BVHA 2EFGA 1NUPA 2IZ6A 2Y9PB 3WLSA 2A3RA 4CCYA 2FN7A 5JYDA 5CIYA 3B9BA 2ZBFA 3B6ZA 3I2KA 3CEHA 2E4ZA 4FVTA 3O82A 4NCKA 4ZYZA 7REQA 3R5SA 4MV3A 3R7DA 3W5HA 4UFNA 3DBOB 5ENDA 4CGZA 1K8ZB 2XMBA 2FDRA 1ZGCA 3RROA 1X7DA 4DQ0A 4IQGA 3RUDA 3LYLA 1YAJA 2CCKA 1ISHA 2AMVA 4GDMA 4E94A 1FLAA 4DARA 1TTTA 4EG4A 2BVNA 4BLSA 1FXSA 4JFAA 3T35A 5BQFA 2G1JA 2WR8A 3KJEA 3KUDA 1PR1A 4IKEA 4MV7A 4TLDA 3SDZA 1GSHA 1ACLA 3SKVA 1NQ5A 1Y7IA 1DKPA 3HP1A 4WGFA 1YAHA 2BKAA 2XQJA 5AJHA 1I0ZA 821PA 1GDTA 3SIRA 4C2TA 1NVDA 4DUZB 1ONBA 4LRSB 3SYKA 1Q0HA 1CBUA 1PUIA 3WLNA 4DA7A 2PR7A 2JLXA 2BGRA 1A1VA 2Q8QA 1BHJA 4LCJA 4L5JA 5DIZA 2QJOA 4MLPA 1C0LA 2FP4B 2GM9A 2VUHB 2YYAA 3L6EA 4W9NC 4KH1A 3U7HB 1ISSA 2IIQA 2NQTA 1RBMA 2ZRAA 3FRHA 4TS4A 1HG0A 3IA2A 1QU3A 3N7TA 1IC6A 5FX2A 1HDGO 1OMOA 2OHGA 3FPKA 3KKKA 5T3YA 1ZUNB 3IDAA 4ZT5A 3H5IA 4Y9UA 5SY6A 3A6GA 1OZHA 1WIWA 4L8GA 1EEHA 2IPMA 2PRYA 4PX2A 1GDHA 3MCZA 2QZ9A 5EXSA 3REQA 3TSAA 2F43A 1GPAA 4BWVA 3NONA 1QYRA 2FPUA 4EGSA 3N8HA 5FHRA 1GPJA 3RADC 4N40A 2ALJA 4O4LB 4QQFA 5CMLA 3LQQA 4L76A 5AKGA 4V1CB 3QH4A 4ZP1A 4AT1A 2XRYA 3T5CA 4Y2RA 3FCSB 4IF4A 4L8WB 3UWOA 1KEVA 3FHJA 2HRBA 2RH9B 1NQAO 2WYVA 1MNQA 4HN9A 1WMDA 4I9FA 4JLMA 5CLFA 3LUAA 1A04A 1TJ3A 2DWCA 1QNLA 2ZRDA 3E7DA 1G3MA 3PQ3A 1A7KA 2B5OA 1JS1X 1Z5VA 2R8YA 2VSFA 1FTSA 3AHFA 4K9RA 3FFAA 4RXUA 3GH1A 1IZ9A 1E4EA 3IE2A 4R01A 1SM4A 3JVDA 3ITKA 5ALUA 2XDAA 5A5GA 3EVGA 5JQWA 1ZM9A 5BURA 5FOUA 3TKYA 4EHBA 4Y2HA 2Y1GA 1L5ZA 2QMYA 1RYMA 5A1TA 4UHJA 3QVSA 3R6TA 3ENNA 4N76A 1ZJWA 3GRKA 3NJRA 3MGAA 1XKTA 1XZFA 3WLEA 3GZNA 3TR5A 4BAUA 3FNIA 2JD1A 1PQWA 4LC1A 1EX6A 1FFEA 3GGSA 4I9HA 2DHQA 5EXEA 2XDQB 1QG4A 1V47A 2FMFA 3G0CA 3QK7A 3R5FA 1YK0A 2ONCA 2X0FA 4M98A 5JD6A 5BVHB 1H3EA 3RVDA 4V0MA 4TYYA 4O8ZA 4X1IA 3E8MA 1CLUA 4LYYA 3REFA 1XU7A 3SHQA 3ESYA 4DV7B 4UHHA 4ZZ2A 4PBSA 1ZG3A 3D1JA 1BXKA 3HTXA 3WK4A 1OXBB 1YE3A 4Q4HB 1Z5OA 4OHFA 2Z1NA 3QE0A 4FJ0A 2AOXA 3A3YA 4G84A 2OXIA 5KBYA 2DBVO 3FUUA 4PF1A 1QFSA 3ZE6A 3ZJ5A 4F4DA 1T9BA 5U9CA 1MJHA 2DQKA 1GITA 4XQGA 3JQBA 1WCIB 3WFIA 1BGWA 5C53B 3IT3A 4IEIA 5D3QA 4I4CA 4B3TB 5LB2A 1Q3TA 2VCHA 1G60A 2FMKA 2F3UA 2D6FA 1G64A 2AZMA 3QRWA 3AT1A 4EBBA 2C94A 2VP5A 1WXIA 2PS9A 3ECCA 3OOSA 2W2VA 1XZEA 2XQGA 4R1LA 4YV7A 4JBIA 1O5TA 4N82A 3ROFA 1ZQ9A 2FZVA 2XMSA 1ODFA 5HFNA 3ZIDA 1U6JA 4KAXA 5IT5A 2J0QA 3I9V6 4MS4A 3QVMA 3WLIA 2RBEA 3EARA 4N4AA 1RD4A 1E9RA 2OB2A 2GAIA 3FSEA 3KJHA 4GOXA 4P7JA 1G2PA 4BN0A 2IYQA 4D0GA 1KGSA 5HG0A 4V0RA 2DR3A 3DYBA 3QU4A 4I8XA 4NMHA 3FKSD 4PXSA 5I4KA 3NEPX 3RVMA 2QG6A 1O0BA 3NBFA 4L6AA 2GX6A 4RSRA 1HYHA 1OBOA 2ZYTX 3H5TA 2J7KA 4AZWA 2LIPA 2QW0X 3J7AC 4WEQA 4EFDA 4EO9A 1LA2A 1QH8B 1RAFA 3E8SA 4HLCA 3RJ5A 3N0XA 4K2HA 5GMOA 3SAJA 1OLSA 5LJLA 3F3SA 4KVAA 3PTZA 4P32A 4KMRA 4AYXA 2EKLA 4ZODA 1P80A 4B74A 1XLTC 3SY8A 3NDPA 1L7MA 4QPCA 1AU9A 5AVVA 2XCSB 3IPLA 1EBBA 3REGA 1XLUA 1YI1A 3AVPA 1YCFA 2QLNA 3WRYC 1LZLA 3DJYA 3F0TA 3MSCA 4L5IA 5IT0A 4WECA 1JECA 2Y4NA 3BC1A 1GYRA 3JD3A 1R15A 4D3YA 4D8TA 1HETA 1EFHA 1AHIA 1BXGB 3R23A 1GZHB 4WLFA 1V95A 4GX5A 2JCYA 2OLJA 5JDIA 4HQNA 5KIAA 3SE7A 2AI3A 4AWAA 5IX8A 1SKBA 4OQFA 5GM1A 2JRCA 3QWBA 4ABYA 3O26A 2XT9A 3HHEA 3TTWA 4CM4A 2OXEA 1ZNQO 2FEMA 1B3BA 2FUKA 2YRFA 2AG1A 1M33A 3MS7A 5CM2Z 2NUAA 2XVXA 3UG6A 2GPBA 2PSSA 2ORED 2Q4RA 1MHPA 5D3MB 4MVWA 4KWHA 1A8IA 5A05A 4QAQA 4B3SB 2YINC 3KU4A 1PVOA 1G5FA 1N4AA 4FR2A 4DMHA 1Q6YA 2A84A 4GPIB 2C0CA 4IWYA 4MZXA 3GLQA 5K3DA 3GNTA 5BSUA 3RNOA 5JMOA 1WG8A 4RTPA 3AM3A 4AZ0B 3Q5EA 3ESRA 3IDOA 1IJEA 4N7BA 2O4UX 1UMCA 1Z2DA 1KI6A 2OYRA 1UXHA 3DCNA 4WX2B 1OX4B 3SYMA 4DDWA 2DHCA 3K6SA 4H4EA 3G5UA 4PR3A 2H3EA 1HOTA 2YX1A 4FW9A 4Y6GB 5IC5A 1VYTA 2YNMA 4RTOA 4PNZA 5FOVA 3K6JA 3SJBA 2XRZA 3N76A 3W3ZB 2G9UA 3QEMA 4AJLA 5GGXA 5JQGB 3CX3A 2JFNA 2HNKA 4A2QA 1GXSA 2JFPA 1T9ZA 3CUUA 3LO8A 1M6WA 1X1RA 4MVJD 4QUDA 2I4IA 3D43A 1XDWA 1VB3A 2IYUA 3NAGA 3KXLA 1H65A 1DINA 2PPLA 1UXGA 1YONA 2ZE7A 3CN7A 2AA3A 1K4MA 3DE3X 1G6Q1 3KX2A 2BE9A 2IE0A 3OM9A 4JR2A 4URFA 5K09A 4UVIA 3DZKA 2CLFB 4YCBA 1JPJA 2O7RA 1VTKA 2OG2A 1J24A 4MRRA 4R84A 4KOEC 3SF0A 2JH8A 3OFSA 3GAAA 4MUGA 1MX9A 1TOAA 3UMRA 1V0JA 4RVCA 1WY7A 4S2EA 5HIKA 4JGIA 3LO5A 1U9YA 4A82A 1CULC 1XPRA 5A9SB 3OEYA 2C4TA 3FMGA 4F9GA 1Z5NA 1ADCA 3HY3A 1EUCB 1W4ZA 1ZHHA 4EB0A 3JS5A 1N9ZA 1GPDG 4X1YB 3SBOA 2Q2VA 2P2ZA 2W8BB 4ZQIA 3QLUA 2HA7A 1G8FA 1PR6A 2V54A 1ZX1A 1YCGA 2YUTA 5GV7A 1KK3A 1FU8A 2QY9A 4K9QA 4PYLA 4X8LA 4A7PA 2RHJA 3M5CA 4LZNA 1F9EA 5I9MA 1IUOA 2G63A 3A3OA 2RG7A 4JL8A 4E5NA 1YU9A 4ZC1A 1AV6A 1L7NA 2GAOA 4OFWA 4D0SA 4JGGA 4K9LA 1NRJB 3RABA 1R5BA 4ENTA 3T4XA 4JP2A 2XYRA 5G4KA 2XADA 2UZ1A 3VU9A 5ALGA 2EV9A 1EWRA 1X7XA 3MJ4A 4IX1A 4MR8B 3KPUA 3R7LA 4WKGA 3TI9A 4UTVA 4RANA 2B2CA 3VPGA 4DT1A 2PRKA 2PNJA 1W5EA 4BV2A 2H2FA 1UM9A 1MX5A 3LFTA 2OV6A 2W6QA 1YL6A 2V4ZA 1DU4A 4N5LA 4BFUA 1OFHA 3O8LA 4YAFA 1SG9A 5FPKA 4H18A 3SICE 3HJAA 3F49S 4X64B 2JGLA 2ONYA 2W2LD 1W59A 4EB8A 4Z4FA 1M67A 1ZH0A 5CVTA 1TZBA 4IHJB 4L2IA 1H1LA 1W0JA 4OUDB 1P5FA 4Z7QB 1N2GA 1K8RA 2O8NA 2PZ8A 1YZKA 3HWX1 1HDXA 4PLZA 3O2SB 1WD5A 1M6NA 3I9JA 3GEBA 4HUQA 4JMLA 4B35A 1MW8X 3QBDA 5JMWA 1EIZA 2XIJA 2V9CA 3EGDB 4ISCA 4WFJA 1T4GA 2V6IA 1E2JA 1UQUA 5K45A 1VOTA 1I2BA 2BI7A 3BHIA 1EFUA 5CA1A 4Q66C 3CSUA 1R3UA 2YOFA 3I1JA 3OEHD 1F0PA 2BCJQ 1YZVA 5DYYA 4AP6A 5IJ0A 3S6JA 1O57A 5EIHA 1G6HA 2SCUA 4LRUA 2XBLA 2H4FA 3DMHA 1M75A 1XKXA 2JZCA 4BBAA 3K2QA 3VSCA 3X3HA 4Y6OA 4DA6A 2G70A 1K4KA 1BW9A 2XUAA 4O4HF 3OPYI 3ZCXA 5EKDA 1TJ4A 4HN4B 5B58C 4GVLA 1FXWF 3OT5A 1E9EA 2GYYA 2WD8A 4NZPA 2I8CA 4LF6B 3W6NA 2QTGA 2HUNA 2FG7C 2BI4A 2GO1A 1T3ZA 1PDVA 3L05A 3GLHB 2OOSA 1X8LA 5C1PA 2BFDA 5DX8A 1T6ZA 5IS2A 1N34B 3DAYA 3G7NA 3RASA 4QXQA 3IEPA 5B64A 2ZJ4A 3PQEA 2CXPA 1EE9A 3CPSA 4NCJA 1KOFA 3PGJA 1OOEA 2RCNA 4RTQA 4NBWA 4XWGA 2FW0A 4JSRA 3WL7A 4AMZA 2F1KA 1O03A 2PLNA 2KBFA 2X86A 2AJ8A 1SA0A 1DG9A 1OILA 2GVDC 4JQYA 4GLFA 4LMAA 4O5AA 4TVKA 3T5GA 3T3NA 2JJ2A 2I4OA 2X40A 4I1SA 1Z88A 3FNRA 3PVSA 4LUCA 5HIIA 2AKAB 5BWNA 5J4KA 2ZRLA 1QG0A 5DCWA 3WGGA 5D3ZA 3I1FA 1M2HA 2DHRA 5DH9A 4ZXPA 2RK6A 4YHBA 3RK1A 4D7AA 1T5HX 1FDRA 3N6RA 3OP1A 5B3AA 5DGIA 4B6PA 4DDTA 3SBDA 4DIOA 3GB9A 4R2XA 1GLNA 4EKYA 2JGAA 1BWPA 5HKKA 2VRBA 2PZLA 4NBRA 4QXMA 2AQIA 3EC1A 1GEEA 1AS3A 2W6ZA 2LE0A 4HNTA 1VSQA 4QRDA 3TOCA 2PJRA 4KE6A 1OC4A 5ALSA 1OLXA 1PWHA 3ESZA 2FZ4A 3I9NA 3OZBA 4ZKDA 5JYEA 2QRQA 1F0KA 2MYPA 1UC8A 3P96A 4NHOA 1N0HA 3EFOA 4WFQA 3LP5A 3ZHSA 2QP3A 4QULA 5JTTA 4NJEB 4J0GA 2BGLA 5DV9A 3NALA 1WXHA 4HEJA 1JL3A 1NV8A 4NV0A 5IKOA 3D0QA 4Q3LA 2IZ7A 4EMBA 1NE2A 1UBTS 4ZU1X 2WVJA 3AF4A 1EX1A 3EAFA 3LGSA 3IHTA 4LC0A 5AKXA 4J1QA 4AJ4A 4KOAA 1A3CA 1KYXA 5E8RA 3T1QA 1BWSA 2XQFA 5TEVA 3CNOA 3TLXA 3B9RA 3WYBA 3L0YA 4GC5A 1NATA 4MB2A 1A2KC 1CQIB 5J4HA 5JS6A 2NVUA 4F21A 2C59A 1PT7A 2O2EA 4XX0A 1SC9A 1AKMA 5EUBA 2NT4A 2Q3JA 1XAJA 1FW6A 1U7XA 2QLLA 1J4AA 2CFCA 1XF1A 4FD3A 2IZ0A 4H7HA 2FXIA 2IV3A 1WMBA 2R8OA 5TEWA 5JATA 4FGSA 5G1NA 1FZQA 4LV6A 2GB4A 2OE2A 4BPBA 1OXKB 1SUPA 4M1WA 3UHOA 2O19A 3DEAA 2CNOA 2V74B 3WNZA 4LJ5A 3PITA 4Y1RB 3FB1A 4EVQA 3OIFA 1KDRA 1TW2A 1J22A 1KKMA 4MR7B 2AXEA 2XB9A 3JX9A 4I9NA 4N18A 2Q1UA 2VRCA 2VBIA 3C3XA 1KWKA 2ZM5A 1NVFA 4QATA 1SJ9A 1E1YA 2JAXA 3SX2A 4J0DA 4E4RA 2R4QA 4LZZA 5LLSA 1F14A 1KEPA 1FDSA 4V1CI 4CQLB 2P0AA 4JI0B 1B4DA 1MB3A 3C70A 1Y9EA 2Z09A 3JQAD 3L0BA 1BMFD 1OT3A 4BNYA 1JHUA 3ESXA 3NC0C 5FOSA 4CQNA 3ZWCA 2YQZA 3ICEA 4B76A 2QX6A 3C5EA 1COZA 1XRNA 4YP5A 4R7TA 1PW5A 1PQ4A 4UU8A 1PV1A 3MLAA 1GUBA 4XW2A 4Y30A 2NV0A 1W36C 5DHRA 1JH9A 2I55A 3ORSA 2OUIA 2BMEA 4MLCA 1ZVVA 3UJ8A 5ICGA 2C82A 4M7PA 4ZPJA 4RNCA 1OVMA 4Q1AA 4WOKA 1LX6A 5EAIA 5FUVA 2PUTA 4D9BA 4EZIA 1EGQA 2WUDA 1E6CA 2H48A 1PNTA 5TS3A 3TBFA 1RE1A 2J3JA 3UJAA 2XUGA 4B73A 3VO9A 3U56A 5ERYA 4YUXA 4QJ3A 3P19A 2Z2ZA 4HYEA 4M88A 2IWHA 4B9EA 1U8AA 2CCGA 3PXBA 5B2FA 5AW2A 3TG8A 4KXUA 1E18A 4UCFA 5EHZA 3KEGA 2OILA 3GMDA 3EQ7A 1T5BA 3H4VA 5BO5A 3U9SA 2EFJA 3PHGA 4TMYA 1B43A 4ACAA 1PDWA 1BFDA 1UZMA 2ORIA 2ZLBA 2HMTA 2QENA 3C3WA 3H5AA 4MUBA 5LR6A 2PX0A 2W6IA 3EPKA 4FC6A 2HY7A 1DKLA 1SVKA 4QNRA 4JEHA 4GI7A 2HO5A 4PZEA 2GN9A 2P3OA 4B45A 3MF4A 6ADHA 3O7MA 3PHJA 3KD2A 3ZHXA 2VWHA 1N2HA 2C4MA 1L4YA 3PZRA 1L5GB 3VJMA 3ANXA 4Q3BA 5ITWA 3B3AA 3M6UA 4LOIA 1H0HA 2R86A 2ZR9A 5D51S 3QBJA 1I33A 1SKYB 2D8AA 3CLSC 1T4DA 1FSZA 3L5KA 2YW9A 1OLUA 4ZEMA 1UBKS 2OFOA 5BV1A 3ADBA 3ZVMA 4OUKX 1O6BA 2XXAA 1JVNA 1TYBE 1A8SA 2RCYA 5G1OA 5EQDA 1XTRA 3V5NA 1ZC4A 4BNTA 4MVJG 3GLGA 3UJHA 1E8NA 1L7EA 1LW6E 2NO9A 2I5PO 2ZTSA 3F4LA 2D74A 4JXZA 2H7YA 3QMVA 5AQ1A 2ON6A 5FYDA 1X1EA 4IOLA 4RD0A 1DQNA 1HKHA 1LQ2A 1HT2E 2R11A 4DLPA 2WTUA 1LK7A 2W6MA 2A1TS 4N7JA 5A1JA 3DFKA 1GO2A 4O3FA 1NA5A 1L6RA 5LQMA 4GVXA 3LT4A 4LVCA 2DBRA 3OQVA 1ODKA 2DU8A 3M83A 2HRZA 3OUTA 4DW8A 3GZJA 3O9VA 4MWZA 1VKZA 1V7CA 4WBSA 1N6HA 1QVVA 1U2EA 1U5AA 2FJUA 2NQ2C 2UVPB 2QIOA 1WKCA 2GARA 1A50B 3VNSA 4EUFA 4YWJA 5BOSB 5BW6B 3RVPA 2GF9A 1EFVA 4HDMB 3SK0A 4AIIA 2VKTA 5KQPA 4E70A 3P4UA 1NUSA 3DOOA 4H3KB 2GKGA 2NVOA 3DB1A 1GTL1 2SKEA 4IUBS 5DNAA 4JJIA 5FTJA 4S04A 1RZRD 4UNSA 2GH1A 4YHHB 1BX3A 3GC6A 4RTMA 4RF4A 3PX3A 4Q6WA 5AJTA 4MHSA 1QAMA 1W5AA 2ETXA 3DL0A 2QZJA 2YVAA 4NKRA 4OREX 1JZSA 3CVOA 2JDID 3FZEA 1RMQA 3TOZA 1A4IA 1E6MA 4X6UA 1FTGA 1XMSA 2DFNA 1INLA 2YJ6A 5JBNA 4PHCA 3SXUA 4E5VA 3LUCA 2RGAA 5F12A 5CITA 1QE0A 2F4VB 2VPQA 2E0IA 4NBVA 1QYXA 4R9UC 4F4JA 1VG1A 2YXLA 3TLEA 1T4CA 2OHOA 1A5SB 4QHSA 4R9RA 1XTPA 3EVDA 3S2ZA 4A0HA 3HCBA 2H1HA 3ML1A 1O97D 1YB4A 4PWZA 3AI7A 4DC9A 1ICIA 1V8FA 4IIDA 4WLUA 1CW2B 3X1YA 3A7DA 4DRXB 4JB3A 3Q7RA 4PCUA 4YO8A 5MHTA 4JUAA 2A9JA 4Z86A 2QRKA 1KAOA 1XN1A 3TRKA 4DM7A