1HUQA

1.8a crystal structure of the monomeric gtpase rab5c (mouse)
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
164
structure length
164
Chain Sequence
b'ICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNTDTFARAKNWVKELQRQASPNIVIALAGNKADLASKRAVEFQEAQAYADDNSLLFMETSAKTAMNVNEIFMAIAKKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RAB5C
publication title Structural plasticity of an invariant hydrophobic triad in the switch regions of Rab GTPases is a determinant of effector recognition.
pubmed rcsb
source organism Mus musculus
molecule tags Protein transport
total genus 55
structure length 164
sequence length 164
ec nomenclature
pdb deposition date 2001-01-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1huqA00
2TMKA 1RRPA 3B82A 1S1MA 1E96A 2QMUA 4EIWA 3TQCA 2G0NA 3LX5A 3B7GA 2IUSA 4KITB 5AK0A 1RFLA 5AJZA 4YMTA 1K6MA 1FX0B 3VNUA 2C04A 4LC1A 4TTPA 4P3YA 3ADCA 1QVAA 1QZXA 2WMNB 2IUUA 3E1SA 1R8QA 4ZDJA 3DHWC 3SDZA 1BOFA 5FBVB 2ONJA 1IN4A 4F4IA 4LJAA 4W7SA 3RS7A 4RCZA 3O8RA 2CDNA 4ITRC 2F1RA 5JEEA 4KV9A 1R7RA 3L82B 3THYA 4B6FA 2QBYB 1XB2A 2BHRA 2DPXA 4PC1A 2IBMA 3IHWA 1DOAA 1S9HA 2RGEA 2ZRIA 3CIOA 1KZ7B 4NCHA 4CRWB 1UM8A 2Q21A 4TN1A 3SS8A 4WA7A 4A6PA 3UIEA 3BORA 4B71A 2RKOA 1KOFA 1ZD9A 4Y0VA 1FNNA 1KHTA 3DPUA 1KI6B 1TX4B 4CEIB 4LWZA 5LB4A 3FDIA 5G3YA 3RSLA 2GXUA 1A5TA 3GEEA 2HDNB 3QPWA 4IOMA 4B3CA 1CR2A 1S1CA 2GXQA 1Z0AA 4IFBA 3IILA 3NBYC 3TVTA 4LYJA 4MRNA 4PQRA 5FOVA 1LNZA 3L0PA 1CJTC 4CGZA 3KKMA 2BOVA 1O3YA 1GOTA 1MRSA 4V0LA 1KDOA 5A0FA 4MYCA 4D26A 1N5JA 2ZSDA 5KSYA 3KTAA 5D3MA 4MKFA 1R0WA 4QHSA 3ZVRA 4EJSA 1QBKC 2GF0A 2N42A 4DLUA 1EWQA 1U8ZA 4D80A 1VCMA 4DLVA 1UKEA 4S2EA 2ZVQX 4M2LA 5H70A 2J3EA 2HEIA 4HAVA 3KJHA 3I73A 1PLJA 1XWIA 4KVGA 1P3JA 4PAQA 5C4MA 4HSEA 3PUYA 4QL3A 3ZIAA 4QC2A 1N6PA 3OE7A 2WIAA 3WRXC 3MSXA 2PMDA 3IUYA 5AUOB 3GEIA 3B13B 4M1SA 3HR8A 2BIFA 5K8TA 2W6ID 5JJLA 3N70A 2OFOA 2BCJQ 4DLTA 5F9FA 5EP2A 4HZUA 3UANA 3F0TA 2BBTA 1SZPA 1FP6A 2F7SA 3FMIA 4RY2A 4JYCA 1KI9A 3IHLA 3QNUA 4I81A 3T06B 2IL1A 1IN7A 3N2IA 4JLJA 4QNMA 1S0UA 5FR1A 4JLBA 3WHLA 4BFTA 4D4JA 4DCTA 5C1BA 4L5BA 4DIDA 3CH5A 5KOYA 3SBEA 2HF9A 1E9RA 1IN5A 1Z83A 2CL0X 2G0TA 2WPDD 3NG1A 4PC7A 4O2LA 5JS7A 4CDGA 3K0CC 1N6NA 4ZIRA 2BC9A 2FSHA 4URZR 3QF7A 3EIQA 2ZYWX 3F8TA 4EPXA 2VLIA 2MSCB 2HXYA 3E2IA 5FI0B 3PEYA 3B8HA 4QBFA 1MOZA 3B6EA 1WB9A 3C5HA 3VX3A 3AF2A 4FIDA 4ZO4A 3P20A 2VP9A 3N5CA 4OI2A 2A9KA 4PX9A 1N6IA 4BLSA 2HYDA 3CPEA 3U60B 4NE2A 1S9DA 3TSZA 4DLYA 1HY3A 1FPMA 3UXMA 1HT2E 1DO2A 2RB4A 2I1VB 821PA 1H8HD 5KNDA 4QBIA 3KQUA 2GTPA 5P21A 3AP1A 5AJVB 2L0XA 2WKPA 2J59A 2VQSA 2UZIR 2ZTSA 4Q9HA 4B3GA 2ZI7A 3FMFA 4Q4JA 3DEFA 5FBLB 5KDLA 4UNPA 4OHZA 2HJVA 4XSHA 5JBQA 1KJYA 2OBLA 4I99A 4OQXA 3ZZTA 1XTRA 5LDDC 5KUTA 2VHJA 2WWGA 3R7WA 4JKYA 2OV2A 2X8AA 2QGNA 3QKRB 1X86B 5J5CA 4HAWA 1CJVC 1MV5A 4TLBA 1DEKA 1G5TA 2ZSAA 3VMFA 3QKUA 5FI1B 4JT4A 3VR5A 3GPLA 2RGCA 4F4CA 1FTNA 2Q6TA 2ODBA 4URUR 2IYWA 1F5NA 3C8UA 2R6CA 2FA9A 1EFHA 5EE5B 2QTVB 3T61A 4HB4A 3AM1A 1LY1A 4ASUD 1QVRA 2ZPTX 4PAOA 3CNLA 1G16A 4PTLA 4LHZA 4IKEA 2FH5B 4HDQB 4DLSA 1II0A 1GFIA 4A0GA 1ELOA 2QA5A 1JJ7A 3ADBA 4DB2A 2YWFA 3NIBA 3BH6A 4MQBA 1RZ3A 1VPLA 1KDPA 2C9YA 4YXWD 3I8SA 1WP9A 4JMPA 4D25A 3U5ZB 1U9IA 4WXRA 3RWOA 4UJ5A 4OQFA 3QEOA 1W36B 1E2FA 3K1JA 1XJQA 3UMRA 1XTIA 4PSKA 4LPKA 3G5UA 4O0MA 3AP3A 4R98A 5EZ5A 1XTKA 4GDFA 1P60A 5ELXA 2GHIA 5EUMA 4QM6A 4O3MA 2JLZA 1N0WA 1NI3A 4TQ9A 4KLZA 3KXIA 4DLXA 2PLFA 2VIIA 3AVVA 1NF3A 3CO5A 2ZRDA 4P4UA 1IN8A 4E5UA 1KDRA 2C9CA 4NL4H 5KTYA 3CONA 4HAUA 3X1DA 2JLUA 1OLOA 4TL6A 3SE0A 4N1AA 2X77A 1FP7A 3TSWA 2CLCX 4AK9A 2XZPA 1E9FA 2ODWA 2VA8A 2YVUA 5KDDA 3ZLJA 4JL6A 4TLCA 1LF5A 2GBLC 5G53C 1X8LA 2YWGA 2ZRJA 5DSZA 1IXSB 2YC2C 3CR7A 5KPJA 3P1JA 3LW8A 4JLVA 3GMTA 4KBFA 2FPKA 2QQEA 1PVOA 2G83A 3K0AB 1T0HB 4US1R 3BOSA 1DELA 4HDOB 3GJ3A 2JLXA 1XMVA 4NONA 1RIFA 2FWRA 1MABA 2J9RA 4JKIA 1W36C 2XTZA 4V0KA 3H2YA 3GD7A 2QMHA 4PSAA 3VTKA 5J4LA 1WCV1 1N6RA 4YMWA 3RS0A 1ZD1A 2GJKA 2O52A 4Q7LA 1QDEA 5JRZA 2CCJA 5UKDA 2JLSA 2NO9A 4JVMA 2W2XA 3KUDA 1X1RA 3AGPA 2PZGA 1ZM9A 2A7QA 5CDFE 3AF0A 3UATA 1N5KA 2WSMA 4QG7A 4AYXA 3LWNA 2RCNA 4GMXA 4JSYA 2IWRA 2BM1A 2FPMA 3TE6A 1N6LA 2CCGA 1SVWA 3IDQA 5BYJA 1GP2A 4BRWA 5KSOA 4KFSA 1BMFD 3AH8A 5H1YA 3RHFA 2O8DB 3I32A 5SZKB 3EWSA 3OIYA 1KMHB 1P2UA 4KHZA 4WW0A 4TT3A 1JALA 5IHPA 1TUEA 4MRSA 3UPUA 1GNRA 3T34A 4PQFA 1DE0A 4R9UC 1JI0A 4LHXA 2VHTA 1OW3B 4WIAA 4P0TA 4EPVA 5CK5A 1SHKA 5HE9A 2D74A 3PUVA 1CXZA 1RJ9A 5GJCA 2ZS9A 1BYIA 3TUZC 2YWEA 3KFXA 1TNDA 4DWJA 1NN3A 2QM8A 3CLVA 2PT5A 1EFRA 4DZZA 1UPTA 5GADl 4AD8A 2QPAA 5EJEA 1NBME 2IS1A 2WAYA 2CK3A 4NMMA 4M9SA 1RJ9B 4C3ZA 1XCGB 2IX3A 4AYTA 3REFA 3BC1A 3P27A 3PEUA 2DHRA 2WWFA 2ZU6A 5IK2A 1P75A 3WHKA 2KWIA 3ZVNA 2QTFA 3C4JA 3IPYA 4TLDA 3BERA 4NZYA 2PEYA 3OIWA 2FJUA 2RHMA 4AC9A 2IC5A 4NKRA 1Q22A 2MSDB 2ZUDA 2EFGA 4TLAA 2XZLA 2NIPA 2JLWA 5DLQC 1I2MA 3IPXA 3ETLA 2QP4A 3EARA 3KXKA 4KFTA 1E0SA 1Z6YA 1NLYA 4EKDA 4G01B 1Z6GA 2V1XA 3OZXA 2XXAB 3AF4A 2XX3A 3KKNA 2WJJA 1AZSC 4Q00A 1IBRA 1LFDB 3RAPR 2XZOA 3PJRA 4XWOA 4ZDIA 4NDZA 5CLQA 1OSNA 5FUWA 2WJGA 3KDSE 4HDCA 3GP8A 3ICEA 3AV0B 1KY3A 1ZU5A 3NDPA 2OBMA 4J0QA 3K70C 1M34E 2H18A 1M74A 4DXAA 5DH9A 5DE3A 4DHEA 4FW9A 3CZPA 5EP1A 3PUZA 3EX7C 2H17A 4NHOA 2XSZD 2IF0A 2ZI3A 3UG6A 3QUSA 3X1YA 3HPQA 2HCBA 3K09C 3PEVA 1G3IA 2VHCA 3VKHA 2EWVA 3PEWA 4Q1CA 3ADKA 3WMFA 1Z29A 3FMOB 4A15A 2GESA 4DT1B 1MO5A 3BIFA 4XD7D 2BDTA 4NYMQ 2FNAA 2VSXA 2EFCB 3AVOA 4GZMA 3U44A 4D4KA 1G64A 1EX7A 3CBQA 3M0EA 1GRQA 3RSOA 2O8EB 3EXAA 3WRYC 3AKEA 3KQHA 4TYWA 2P6NA 1KSHA 5BN5A 1HYQA 2IYQA 4QGGA 4RD3A 1XMIA 1OXVA 1OF1A 2NO7A 1S3SA 1SULA 3ZD7A 1AGRA 4CEJB 1CJMA 2C96A 5KHOC 2CL7X 5L3SB 3U2QA 4BGDA 5JI3E 1JBKA 3CWQA 4LX0A 4CT5A 3THWB 4MYUA 1GNPA 3VR1A 4XVQA 1GKIA 4KAXA 3NBZC 4IXMA 4JT2A 4TYQA 2WSSA 4C30A 1JPNA 2HXSA 3C16C 2ZJAA 2YV5A 1M1YE 3BH0A 2SHKA 1E2GA 1HQYE 1ZBDA 4IXNA 1L4YA 1KI2A 4QBGB 2QPOA 4C0KA 2DR3A 2QPTA 4GRAA 2GJ8A 2CL6X 1GRRA 1CF4A 5DGXA 1KK3A 1R4AA 4UNSA 2CLSA 5TV2A 4JLKA 2A2ZA 4TL9A 1CKEA 2X1VA 3FB4A 1SXJE 1KZGB 1ZM2A 1HE8B 4Q4LA 4A92A 5HPYB 4QFMA 1MO4A 5IDVA 3AVPA 1GAJA 3A4LA 1LF0A 2ZI9A 3FTQA 1W36D 4Q9KA 1UKZA 4BQSA 2R8RA 4DDVA 4R7ZA 1TPZA 2O8FB 4NCKA 4CYMA 4IDOA 3SN6A 5EUQB 4C9BA 4OBEA 1OH8A 2QAGA 4L15A 4M1OA 2OCPA 3MJRA 5EP4A 1H65A 4G5RA 3CRW1 3MCAA 2OAQ1 2WVJA 2VEDA 1W48A 1IONA 4ZCMA 5JI2E 2RGXA 5KSZA 2W6IA 1NSFA 4DSUA 1GITA 1I4LD 2D62A 5FL7A 3VKWA 2QAGB 4BZXA 4MRRA 1IM2A 2ZU0C 4ARZA 1NMXA 2ZSFA 1EGAA 2GJAA 1S3GA 3GJ4A 4URYR 2PL3A 1E98A 4FINA 1E9DA 3D6TB 4B44A 5TVKA 2A78A 4PQYA 3VFDA 2WPDA 3CNNA 4PZZA 2WBLC 2ZRAA 3A1TA 5AWFC 2PH1A 2OCYC 2ODNA 4QBHA 2FFBA 1FMJA 2D7CA 3I5YA 1HA3A 4RSGA 3NWJA 2A5YB 4DDTA 1W4AA 4LRWA 5AJWA 5CM9C 1M8PA 1W1WA 3ASYA 5J40A 1D8TA 1HUQA 5BYKA 4C0QC 4CEHB 1CJUC 2FEOA 3IQWA 1B0UA 2HT1A 2DCUA 2GEUA 2DWOA 3K0FB 4N3NA 5GVSA 2BJWA 5FUXA 2WJHA 5JHGB 1FUKA 1ZCBA 1OT3A 1ZAKA 1QHXA 2HT6A 1H8HA 1N5IA 2EYQA 3OIVA 3CF2A 4AI6A 1X8JA 4E09A 4U7DA 3VHLB 1ZVQA 4LJ7A 4DCVA 5CK4A 3SYKA 2P67A 3BRWD 2YWHA 3T1QA 4LJ8A 4NCNA 3C7KA 4Q01A 1U2RA 3L0OA 3W9YA 2XITA 5C4GB 3DZ8A 5K8UA 4A2PA 4UXJA 1GIAA 4C0HA 1CBUA 1G9XA 2C9OA 5FTNA 4MRVA 1SXJB 1F2TA 1KY2A 2OESA 4HB0A 3EZ2A 4C0AC 4D4MA 1F6BA 5B2ZA 3ICQB 1FFHA 3B9PA 3FHOA 1OJLA 1KK0A 3CWZA 3H0KA 2W6JA 3DOEA 1P9RA 1KK1A 1KSFX 1U98A 2D06A 2LWIA 3MUFA 3GJ6A 1ZJ6A 3WYGA 2CXXA 1D2NA 3QJYA 3K70D 2ZJOA 3EZFA 5DHFA 1W47A 4FCVA 3VR2A 1R0XA 3MWYW 4C2TA 1FQKA 2WKRA 3FOZA 3B1XA 4TSFD 2AD1A 4M1WA 2ATXA 2A30A 2CBZA 4B2LA 2WJIA 4YXWA 4BFZA 2AFHE 1F2UA 4L16A 4URVR 5FTJA 4PHHA 2DYKA 3RDPA 2IS2A 4C7OB 1FW6A 1KNQA 2CVHA 2O0KA 1QHIA 5L3QA 4DEYA 1SXJC 1W44A 2REXB 3CF0A 4M1YA 1KI8A 1QHHA 4FMCB 3Q72A 2E1RA 2J45A 3NXSA 2CEAA 1F2UB 3IEVA 2FMXA 4DUGD 4B74A 3QOFA 5DIFA 1XRJA 4FD2A 2ZQ5A 3B1VA 4R71A 4CF7A 3TMKA 1V43A 4NYJQ 3SR0A 1HH4A 1N6KA 2YZ2A 5L3QB 3QY0A 1Q44A 4IDNA 3FFAA 3JZMA 2AXNA 1QHHB 3EZ6A 1VG0B 1CR1A 2R6DA 5TARA 2ZJYA 4IOLA 3TIFA 1D2MA 4AKGA 1E2KA 2JJ2D 5E95A 3IBYA 3GQBA 1R2QA 1YR7A 1FX0A 2I3BA 4QRHA 3RRMA 4AURA 1NRJB 1Z06A 1W49A 2P6UA 1AQUA 3NC0C 1C9KA 3EA5A 3W3AA 4AY2A 3ZS8A 2ANCA 1E9EA 2B8TA 1LW7A 3FYHA 2PX3A 2D4HA 2QE7D 2QBYA 5TY0A 4LGMA 1MT0A 2F3TA 3CNOA 3I92A 1R10A 5FPTA 1MKYA 4DLWA 5H8WA 1NVVR 4TMKA 4A0FA 2F9LA 1LTQA 3KKPA 3JZAA 1CRPA 2AK2A 2ZR9A 3NDBB 1BMFA 2ZYVX 4GMDA 1COWD 4TMZA 4XTCS 1OH6A 3KZ1E 4F92B 3U7GA 1NBMD 4U02A 4HAXA 1KKMA 2BJVA 3LNCA 1KI6A 4G3XA 5FOSA 1PLLA 4CEIA 4E07A 2VL7A 3I3SR 2LKCA 4GFDA 4K46A 4XWKA 3PVSA 4LJ9A 2H5EA 5EXXA 4B3FX 2OBNA 2P3SA 2R65A 2YOGA 1W0KD 2J7PD 1VIYA 4M0LA 3I8XA 3K8YA 4ZDKA 1GNQA 3UG7A 4BASA 4ZPXA 3MJHA 3CB4A 3T5GA 5E4FA 2VSFA 1G3UA 1XPUA 4G1UC 3U3RA 2LCFA 3GEHA 2WSSD 3KUCA 5KU1A 3U3KA 3U61B 2V4ZA 2C99A 1V5WA 1RW4A 1E2PA 1S8FA 3B1WA 3Q5EA 2O0JA 2BCGY 3SYLA 2GCPA 3MMPA 4V0MA 2IK8A 4Q9JA 4YONB 3QENA 2QL6A 2ERYA 2G1KA 1E2HA 2BWJA 1WBDA 5CYPA 1QHSA 1RE0A 2ZI6A 3K0CA 1IXZA 1R6BX 3QXXA 1VYTA 3HWSA 5BW8A 1U94A 1E94E 5TB5A 4HAZA 1B23P 2R6AA 3NTUA 1Q1EA 3A4MA 3ZD6A 5B30A 4NTZA 5EXPA 2W0SA 5BQ5A 1HE1C 2F9MA 4KYUA 1AQYA 5HTKA 2B7CA 2PZFA 5KO2A 2QSZA 2EFEB 4M9QA 4JVSB 1G21E 1TU4A 2OCAA 3NBFA 3TGPA 2IYXA 4B75A 4KXFB 4F93B 3KJEA 2BM0A 3M6AA 3KB2A 3UMSA 1NIPA 3K9NA 1RRCA 2JLYA 1KO8A 3FPAA 4JJKA 4LYFA 2BMDA 5FOUA 3QKTA 5FL7D 5AUPB 2ZEJA 1DTSA 2VP5A 1XTQA 1YZNA 4EPYA 1OXTA 3L0SA 1AK2A 4ABYA 4DEXA 4TMTA 4AWXA 1GRNA 3GCGA 4D81A 3BE4A 2XSZA 1G17A 2NPFA 3CRMA 1YZGA 1QHGA 2GKSA 4RZ2A 1KJZA 2FGJA 4LHYA 4BFWA 4PHFA 3A37A 1FNMA 2BBWA 3AUYA 5EZ6B 5C18A 1EX6A 1BKDR 2ZETA 5FBRB 3DL0A 4XD7A 5FTMA 4CT4B 3QF4B 3KJIA 3RC8A 1QF9A 1TTTA 3H4MA 4OHXA 4YMVA 4IOKA 4URXR 1OH7A 1NJFA 2GK7A 3CX7A 4GT1A 1YHNA 1BO6A 4KBGA 2ZS7A 1ZNZA 1OYWA 1Z2AA 3V9PA 2AWOA 3DDCA 4MYHA 2C03A 2PCLA 1VHTA 3QKRA 2WWWA 3AVUA 4LY6A 4QHTA 4MKGA 3TK1A 3ZH9B 4MRPA 1YR6A 2IYUA 4Q4HB 4HB2A 1SXJD 1Q12A 1XDBA 3DMDA 4HATA 1T3HA 3F5FA 1IY1A 3PCRB 5KYKA 1P62B 3LBIA 2KI5A 4EPTA 3B1ZA 4A0RA 5LPNA 1Z5ZA 2ZRNA 3K53A 4LK2A 5GJVC 2OCBA 2FGKA 3WY9A 1NN5A 3TKLA 1ESMA 3OEHA 4RZUA 3B9QA 4Q47A 1TF7A 2C77A 4W5JA 2BMFA 2IYVA 2V3CC 1ZW6A 2GBLA 3U7HB 1AN0A 2J0UB 2W6JD 4EFLA 5JCPA 2CHGA 3PIRA 1OIWA 4IDPA 4XSGA 2E9SA 2V6JA 3OF5A 4LJ4A 2GAOA 4H9GA 1KO5A 2JJ1D 2ERXA 2ZAMA 3GJ5A 3W6PA 5JMTA 1VTKA 3DVLA 3IEUA 3O8CA 4AYWA 1II9A 3NH9A 1WE2A 1IN6A 2Q9AA 4QJ4A 2IA5A 1ZRHA 1IY2A 4X8MA 3SEAA 3AF3A 4DSNA 4C0BA 2ZE6A 1JQJC 1YRAA 3EW9A 4PPQA 4C0LA 1Z0FA 2QM7A 3LXXA 1GL9B 1CU1A 2Q3HA 3MAAC 4ERNA 5JLJA 3GLIE 3ECCA 4Q21A 2CE7A 3R20A 4MDFA 4A9AA 1OYYA 1CEEA 4P32A 4JVLA 3ZQJA 2CJWB 1JQLB 2GEVA 421PA 2WOOA 4PC3A 4OQLA 4G5GA 1XEFA 2VYFA 4L9WA 4H1VA 2JJ8A 1DS6A 4K81B 3K0AA 2F3RA 3FWYA 2Y8EA 5KNCA 3LX8A 1ZIOA 3B85A 2H7VA 6Q21A 4D0NA 2XNDD 4OQNA 4M9XA 4TLEA 5KSPA 1KO7A 2KSQA 4FMCF 3SBDA 2VSOA 4KLNA 3CW2A 5F9HA 3TAUA 3FVQA 1E4YA 4IEIA 4WAUA 4PZLA 2XNSA 4OK6A 5F98A 1AKYA 4GP6A 1ZUNB 2CLDX 1JECA 1VCNA 3ZVLA 1IXRC 1W0JD 4DCSA 1F60A 3QKSB 4BEBA 3P26A 4MUAA 2A5GA 1QG4A 2QSYA 5FOTA 5FBWB 2AFIE 3QBVA 3QPVA 5JSZB 1AJEA 2QMOA 2FSIA 2Z0MA 2RGDA 2O8DA 2BEKA 3R8CA 2Z83A 3FKQA 1KMHA 1NVUQ 1F48A 1E2IA 1QRAA 2QORA 4UNRA 5IRCD 3P4XA 1G3MA 3AEZA 3WP0A 2KBEA 1KSGA 4KYIB 5FUYA 3B1YA 3EPLA 2YHSA 4JLNA 4F91B 1JR6A 5BWMA 2ZJ8A 4Y0AA 2YNMA 2KE5A 1BH2A 2GJ9A 2C95A 2NO6A 1K8RA 1TEVA 3OFND 4PR0A 4I1OA 4EQ6B 2QU8A 1IJEA 1NVXQ 4GOXA 4LBVA 4EFNA 3GJ7A 4N0EA 1DG1G 1G6HA 4RKFA 2ASEA 3TR0A 5EE0A 3LQRA 1DG3A 2F55A 4OYHA 3NKVA 2IEZA 4PAMA 2GXAA 3W90A 4Q19A 2ZI4A 1RRGA 3ASZA 1YZTA 3HU2A 3KQNA 2HV8A 2OM2A 4BFUA 1RYHA 1XMJA 3GFTA 5DN6D 5JWOA 3AKCA 3CUEF 3I72A 4PC6A 1XD8A 4LPSA 3GLIB 4BFYA 4TSFA 5CITA 1Z0KA 3HYTA 4KVAA 2QGZA 1Z08A 5EXTA 5HE8A 3V4RA 4ILEA 3IQXA 3LXRA 2UZ3A 1KYIA 2XJ9A 3K70B 4L8GA 1T5IA 3K09A 2GAAA 1U81A 3SI7A 4I4LA 3LFUA 5JZVA 2CHQA 1R5NA 2GZHA 2GZAA 4Z8YA 1ETUA 1JAIA 3E5HA 4QNRA 5FOXA 4WZ6A 3RRNA 3U6KA 4TMXA 2NQ2C 1P6XA 4US0R 2C2HA 2EW1A 2NMVA 1P2TA 3AVYA 5HCNA 4YMUA 3LA6A 2VHQA 3LD9A 4DUGA 1WBBA 221PA 1OFTA 3A1WA 2XXAA 1DARA 1P5ZB 1OE0A 4M22A 1N5LA 2FZLA 4AG6A 1KO4A 1XCMA 5DYIA 4BLOA 1UAAA 3TQFA 2Q0HA 4KO8A 4ESHA 4P4TA 4PO9A 1ZMXA 4OI4A 2J0VA 4D0GA 5HKKD 1DO0A 2F1IA 3QXJA 5AUQA 5CDFA 1E1RD 2WWXA 3LY5A 2JJ2A 3ND9A 3U7EB 2FX3A 1KAGA 3DKPA 3REGA 1L8QA 4BLQA 3QBTA 4F4JA 2VBCA 3CF6R 3OIUA 3THXA 1WDTA 1H8ED 2B7BA 4RD1A 1OH5A 1GSIA 2N46A 2R6GA 1UJ2A 3CRQA 4M21A 4P33A 1OKKD 2DFTA 2QNRA 4DT1A 4DB4A 1GM5A 1SVLA 2Z4RA 3BAFA 3A6PC 2FFQA 5BXQC 4LYAA 4Z1MD 1ZM3A 3TJZA 1Z22A 3AF1A 5FBQB 4FWIB 2QE7A 3K0EA 4OHWA 4L9SA 3LH5A 4EAQA 3H1TA 2RGNC 3THXB 1DAGA 5IF9A 3RABA 4CVNA 1XXHE 4KSBA 2ZANA 2O8EA 2NOAA 1I4TD 1UADA 1T91A 1VCOA 3WNCA 1ZM4A 3WXMA 1IJFA 4HEJA 3LVRE 1GWNA 3NEYA 4DCUA 3LAWA 3T35A 1EXMA 3I61A 3TH5A 1COWA 4MKIA 4V0OA 5SZIA 2ZE7A 3U4QB 3ZYCA 5G41A 1NBMA 4CEJA 3SFVA 5L3SA 1NJGA 4IDQA 2OZEA 1KJWA 2AXPA 4LHVA 4OL0A 3THWA 3E70C 4HLUC 5FPYA 3RS5A 2ZE8A 4W5WA 1P7CA 1W0KA 2J7PA 1KTVA 1C4OA 1E9CA 1W4CA 1Z07A 1U99A 4FCWA 3SOPA 3WNDA 3MG9A 4WZBE 4TYPA 1YR8A 1W5SA 2CNWD 4BPBA 1PUIA 1D2EA 2OLKA 4P31A 1JR3E 1NVWQ 3RRYA 1CLUA 3U6BA 3ADDA 1OIVA 4P4SB 3D31A 1YKSA 3BJIC 3A8TA 5JFGA 4EPRA 4TYNA 2BBOA 1UF9A 1AA9A 2HUPA 2IYRA 3RYTC 2P6RA 4ESVA 1CIPA 3OEHD 4JL8A 4I1UA 5FPKA 3EPKA 2ZUBA 3FHTA 1BYUA 4DJTA 2Q3FA 1US8A 1RYFA 4FCTA 2O8FA 3GLGE 3UWKA 4O2RA 2RGGA 2GILA 1X8KA 2EYUA 3B5JA 4NH0A 1LVGA 1JPJA 3QXCA 5LB2A 4PO8A 2ZYTX 2GVZC 3SC3A 4LJ5A 1JB1A 3LLUA 3T1TA 5LD2B 2NZJA 5JCZA 1BS1A 3ZQ6A 4A0HA 3GLHE 1US8B 4NP6A 1Y3AA 4AG5A 1OXUA 4QHYA 1G4AE 3S1AB 1G7RA 5J4VA 2Q9CA 4LHWA 4LOAA 1CTQA 4G5OA 3RC3A 1Q1QA 4W5HA 5AUNB 2O8CB 1ZUHA 1R0ZA 4A8JC 1KI1A 2VH5R 4QM7A 1XEWX 1S96A 3X1WA 3T15A 1XJ0A 2WTUA 4QOSA 1NY5A 2WIBA 2IUTA 2AX4A 1AS0A 2QP9X 1FUUA 1XU4A 1UBFA 3HYRA 4Q02A 4E22A 2WWIA 1JAHA 3IIMA 3IGFA 3VX4A 5G40A 1Q3TA 4G5QA 1G5PA 1XXHB 1YZKA 1WF3A 2HF8A 1UBGA 2AWNA 2YYZA 2ZR7A 3LVQE 3R8FA 5TXGA 4PZYA 4BWYA 5CJPA 2D3WA 2QAJA 1EESA 3W5IA 2NZ8A 3LLMA 3W3ZB 2QP3A 5LD2C 2F43B 5F3WB 2IYSA 4BLPA 4CEHA 4NYIR 3K0FA 3AVXA 5HR5A 1NLFA 3AVTA 1XCPA 4Q9LA 4QKQA 3SJAA 2Q3MA 1P61B 3A36A 1N6HA 4OK3A 4RD2A 4UXIA 4TQAA 3H84A 3AUXA 2IW3A 2YC4C 3OAAD 1YZQA 4AKHA 2QT1A 4NBSA 5AJXA 1JJVA 4LSGA 4R2HA 1TQDA 2AHOA 2PX0A 2ZJ5A 1U8YA 2CE2X 2XTMA 1Z6XA 3FKSA 4HZIA 4D4LA 3PG5A 3EWAA 1YQTA 2BV3A 2ZS8A 3TLXA 2JIZD 1XFAA 3KX2A 2FG5A 4JLMA 4RKEA 4U5XA 4B73A 1Z2CA 1XBTA 3GLGA 1SXJA 2OO7A 3AQ4A 1XPRA 3LV8A 1XP8A 4FI3C 5DNYB 3LRPA 1KIMA 2ZRBA 4GNKA 4JBWA 1GG2A 1X1SA 2N1BA 4TL7A 1TAGA 3KFVA 4HLCA 2WMOB 4M1MA 4Q4AB 1UBCA 3DOFA 2DFKB 3GLGB 3CX8A 1KNXA 3CKLA 2MMCA 3MWLA 3FMPB 2ZRPA 4B47A 3JVVA 1GZSA 1E79D 1E1QD 4CZ2A 5FTLA 3GFPA 1XTSA 1G291 5L3VA 3GLHB 1OHHD 1TF5A 2JCSA 4QGHA 2EU8A 1GUAA 2IXEA 1XD9A 1TQ2A 5CJ2A 2JJ1A 1E2JA 2ORWA 4IVPA 4HLDA 2O8BB 4C7OA 1E2MA 1ZCAA 5JEDA 3UWOA 4Q1FA 1EWRA 1GVNB 3SJZA 3IBGA 2B21A 1D9XA 2VO1A 3M1IA 2NG1A 3CR8A 4DVGA 2J87A 3K0SA 3EASA 4LYHA 2D2EA 4DKXA 1FMLA 2UVQA 1VDZA 2XOKD 2XTNA 3BK7A 2ZIAA 2B6HA 4TQUS 5CIQA 2J7KA 4LDJA 5IT5A 1D9ZA 4DIEA 5KDOA 2WJYA 3EIHA 1KGDA 3T5DA 1TQ6A 4JJZA 4A36A 3T1OA 3EC2A 4NYIQ 4CIDA 1ZYUA 1Y63A 1G3QA 2JDID 3HU1A 4XVRA 2W83A 1NNEA 3QXSA 3EG5A 1E9AA 3NC1C 2GNOA 2V8OA 1RKBA 1FL9A 4OQMA 2DBYA 3DKVA 2XNDA 5B64A 2ZRGA 1ZC3A 4FWTA 2WHXA 3NHBA 1VG8A 3AKYA 3O47A 1XEXB 4Q1EA 4XIGS 1MH1A 2OHFA 2WWHA 1G7TA 1W5TA 4BFSA 2ZRHA 3MLEA 2F6RA 3K9LA 2QEQA 4ZKDA 4GL2A 2GCOB 1W0JA 1WMSA 2VF8A 3LBNA 5E7IA 3SYNA 2JASA 3MWKA 2G9NA 1LS1A 3QVUA 1NG1A 3A1UA 2VF7A 4QJ5A 3QG5A 4KODA 4PHTA 1DAEA 1ZNYA 5FFMA 3RRZA 3SFZA 3VR4A 5C2JB 4X8LA 2OG2A 1QHYA 2ZI5A 5F2EA 1ODFA 1P2VA 1E2DA 1R8SA 1QHNA 1G8YA 5CIWA 1E9BA 5EE1A 1JXOA 5EE3A 1F3OA 3THOA 2AD5A 2XGJA 2FFAA 3L8YA 2D7DA 2LKDA 4A6XA 4TL8A 2JLVA 1U0LA 1ZNWA 3U3OA 3B78A 4DBLC 2HLDD 3BXZA 1QG2A 1Z8FA 1TU3A 5B57C 1T8TA 1UEJA 1NP6A 4F38A 2QI9C 1KDTA 2P65A 3OFNA 2ZJ2A 4V02A 2R2AA 2P0EA 2VTKA 4K8OA 3A1VA 4IW3B 2KB0A 1VYUA 2PT7A 3I1FA 2P5SA 2OILA 3CH4B 1JNYA 4GI7A 3R9WA 3NH6A 4B2PA 2V54A 2JGNA 3IKJA 1VYVA 4BLTA 2YJTD 3ZVMA 1A2KC 1EFUA 2RH5A 1M7GA 4IVRA 4NPHA 4WXPA 1E2LA 2PZEA 1G7CA 4UQOA 5FH9A 2IHYA 5DN6A 5HCIA 2A3RA 1C1YA 3BGWA 3TR5A 4DRZA 4QGAA 4HLQB 3W5JA 1Q1ZA 4A2QA 1FZQA 4B3XA 1E2QA 3DO6A 4TMWA 2W58A 1IAQA 3QG1A 1CRQA 3THYB 4JS0A 1HTWA 2P2LA 3CZQA 3WP1B 1XD2A 1WXQA 4I1SA 4OKSA 1EFCA 1YVDA 3EPHA 2J0QA 1NMYA 2ECKA 4G0NA 3KKQA 5DO9A 3Q3JB 5CLLA 3W8NA 1HURA 1TEXA 2I4IA 2BMJA 2BVNA 1PV4A 2ORIA 1XD2B 5DISB 3I4LA 1OFUX 2XB4A 1TL7C 3SU8A 2IYZA 1WA5A 4PO1A 3F3YA 4BLRA 4EPWA 3PUXA 1O87A 3ZDQA 1E4VA 1DAKA 1RPZA 4C0JA 3TUIC 2V7QD 3U3MA 1G8PA 4WOPA 3RS3A 1Q21A 2KBFA 4Z51A 4RVCA 1JXMA 3RVBA 2VHUA 3T1VA 4NCJA 3PR1A 4TTQA 5HKKA 2AL7A 1P2SA 3QEJA 3TNFA 2OEPA 1E1RA 3CPJB 3CM0A 2E87A 2Z4SA 4UNNA 3L8ZA 2FFHA 3SQWA 4C2UA 4RZXA 4MGIR 2FF7A 4LI0A 3W8RA 3I5XA 1IHUA 4D6PA 5BN3A 1W2GA 2O0HA 1H8EA 3KTAB 5D3MB 1NVVQ 1U0HC 2OLJA 4KFRA 4EJSB 1GDDA 2BBSA 3V00A 2GWHA 4FMDB 1OKKA 4US2R 2HCJB 1EFTA 2IYYA 3PFIA 3ZZ0A 3PENA 4Z1MA 3QF4A 2ODEA 3Q7PA 4C0SA 3AGQA 1A1VA 1CJKC 2QROA 3D8BA 2OE2A 4HAYA 4PANA 2ZXUA 4URWR 2G3YA 1II8A 1MRNA 2WM9B 2ZAOA 1W46A 2BKEA 2MSEB 1JR3D 3I62A 4TWZA 4KU4A 2OAP1 2BEJA 3WMGA 1P9WA 1OXSC 1XZPA 3LW7A 4S35A 2OFXA 2OXCA 3BB3A 3MFYA 4LV5B 3TVDA 5L8VA 3N2EA 2KJQA 3OESA 1AGPA 3EPJA 4Q4HA 3PXGA 4POAA 3GFOA 4HZUB 4UJ3A 1KI3A 2AKYA 1YRBA 1II8B 3FKSD 3P32A 5CB8A 2GEDA 4PFSA 4YDSA 4EJSC 3X1XA 1XF9A 2RMKA 4A82A 5J4YA 2IYLD 2XJ4A 2EFHB 3C41J 2JLQA 4XVUA 2EVWX 4MITA 1KAOA 2CNWA 2RAPA 4MKHA 3RLFA 3ZZUA 1OIXA 4Q1BA 5FUVA 5JJKA 3TRFA 5J4KA 3TW4A 3CRVA 4ZIRB 1ZINA 4JLOA 2O5VA 2V6IA 2ZE5A 2J0UA 2W2TA 1DPFA 1UDXA 1E6CA 3ZJYA 4YDHB 5EE9A 2IF2A 1NSTA 1OFHA 4B33A 1ZNXA 3RNLA 1NLZA 2FEMA 4L4UA 3X1ZA 5EXSA 2R62A 5EQTA 4D0LB 3A58B 3LQQA 3VR6A 3KKOA 2FU5C 4W9MC 2WICA 2IS6A 5K8LA 721PA 4DC9A 3D7MA 1G8FA 2GXSA 1AIPA 2AK3A 5FPHA 2IWHA 3Q85A 3FGNA 2QUZA 4WVFA 1A2BA 5JHHB 1Z63A 2QRNA 4Q4JB 2NO0A 1NKSA 2VP2A 1T4GA 2CJWA 1RC8A 1M7HA 2C8VA 3FHCB 4EFMA 1X6VA 2R44A 3R7WB 2GETA 4DDUA 3O8BA 3ZS9A 4DCNA 3R9XA 3TUJC 1J8MF 2P5TB 4H1UA 1NL3A 3OHMA 4M53A 3U3JA 4WZAE 4B32A 3WMEA 1G3RA 1KMQA 1G19A 3J81k 1RVDA 2PLRA 4LBYA 2A5FA 1KSJA 4QJ3A 2W0MA 1DBSA 1KK2A 2RHDA 3GJ8A 3L43A 1TQ4A 2DFNA 1MO6A 1AS3A 1SKQA 2FSGA 4RJLA 1SVOA 1NMZA 4HB3A 4A2WA 4DDWA 2AKAB 3MWJA 1E2NA 5B58C 1W4RA 4LJ6A 1ONBA 1HEIA 1S4QA 1GKUB 3DZDA 2AR7A 3SJCA 1GKYA 5M04A 3Q8XB 3OEED 3QKSA 4JVNA 3KXLA 1G1MA 1Z28A 4LJYA 4ZKEA 3VR3A 1N6OA 3SJBA 5JSZA 3R9IA 1E9SA 2R6FA 3HU3A 2VPPA 2JATA 2GK6A 1ZP6A 2ZR0A 2FDCA 2DY1A 3OAAA 2B8WA 5G3ZA 2W00A 2OUKA 4Q66C 2G77B 1HQCA 2ZRMA 4KSCA 4ZI3A 3TBKA 3HDTA 2JIZA 2JA1A 3QIAA 3QE0A 5GVRA 4EQ6A 1UKYA 2QN6A 1SVKA 2J41A 2GF9A 2EQBA 1Z6AA 1E2EA 1P73A 4Z8XA 2REOA 3BH7A 4Q1DA 1OFIA 1NN1A 1YU9A 1U0JA 2NPIA 4ACBA 1UDWA 3EIEA 4IFEA 4B48A 1E99A 3RANA 3BBPA 3IIJA 4RD4A 4XJXA 1U9IC 3RS2A 1MABB 1SVMA 2FZ4A 5FR2A 3VAAA 4BFXA 4GOJA 4OJKA 1NY6A 3LBHA 4XH9B 1E79A 3GLIA 1E1QA 1Q0UA 4MDEA 3B60A 5FTKA 4LCBA 1OHHA 2ZJBA 1OB5A 2C98A 3BB1A 2WAXA 3W6NA 5HZHA 1J2JA 1PZNA 1CR4A 2QZ4A 4TMVA 4TZ6A 1G8HA 1SVIA 3QPUA 1Z0IA 2XEXA 521PA 2VP6A 3SHFA 1U8AA 1JEDA 1ESNA 5JWHA 1G18A 4MUBA 1NG9A 4NCIA 2ZRFA 3KL4A 1VECA 2R9VA 4PC2A 4A1FA 3IO5A 4NYMR 4MGZR 2WV9A 2ORVA 5E7JA 5C46F 3AVWA 1WRBA 1IY0A 1YR9A 2GZDA 2RGNA 2XOKA 3BFVA 3EZ7A 3CRRA 2YKGA 2H1LA 2FV8A 1UFQA 3MD0A 2H57A 1XPOA 4JLAA 4Q18A 4Q03A 1SHZA 3P4YA 1U90A 4LC0A 3W34A 1J70A 2H8KA 4JBXA 2DWPA 1VG9B 1T5LA 2H16A 2JDIA 3M4YA 3A1SA 3V4FA 2BKUA 3GJXC 1E69A 4MA4A 4HLUA 4LV6A 1T6NA 2PJZA 4DLRA 5JJIA 2ZJZA 4DLZA 5JWRA 5KNBA 1T8UA 2J5XA 4N0DA 1G8GA 2ZUCA 2ZYUX 1ZUIA 1E0AA 1Q1BA 2VRWA 1G4UR 1M7BA 3K9HA 4WBSA 1T9HA 2UKDA 3LO5A 3WYFA 1BIFA 1WQ1R 2X19A 5BN4A 4IEEA 1D6JA 1CULC 2ZRCA 3DM9B 3GLFE 3NVAA 3MRSA 1G20E 1DAMA 2A5JA 4D2IA 3ZIAD 1P4SA 4YMSA 2BMEA 4B3BA 1CR0A 3OE7D 2FN4A 5A4JA 4M9ZA 3VNVA 2NGRA 1TUIA 1K5GA 3EAQA 3HP1A 1G41A 3FE2A 4JL5A 2OFWA 4XTRA 3U4QA 1LB1B 4ACAA 1M2OB 3PITA 3BFKA 4O25A 1A4RA 2JLRA 3AVQA 2WZQA 4LBZA 2WWYA 1EK0A 4GSYA 4FMDF 2K5UA 1ZIPA 1L2TA 2ZROA 3D3QA 3QSYA 1AS2A 2G88A 4Q7KA 2H92A 2HLDA 1E3MA 4JLPA 1GILA 4Z54A 4HYYA 3GJ0A 5AR1A 4QXAA 3ONWA 4RFSA 1W4BA 1XEWY 4OHVA 1YZLA 3NHAA 4GP7A 4MGKR 4XOIA 4ZI2A 5HZKA 1J7KA 4P4SA 2PEZA 2YINC 4BE7B 4II7A 1Z47A 4C4PA 4A8JA 1DAHA 4E03A 3VKGA 4PPGA 4Q5IA 4RFSB 1KO1A 1MR3F 2C5LA 2F1HA 2I1QA 5ANRB 3Q5DA 4BZPA 3U7FB 4UKDA 2XB2A 1G7SA 2VP4A 2X2EA 2WOJA 2Z5FA 1ZD8A 3HR7A 2Z6VA 4A8JB 4RD6A 1N2CE 3EZ9A 1KI4A 1Q20A 3UKDA 1IQPA 3AB3A 4A4DA 2IXFA 1Z6TA 4Q9IA 5TDHA 3U44B 1MO3A 2HJGA 1FOEB 4V0NA 1Z0JA 2ANBA 4PHGA 1YE8A 4B34A 5J47A 4PPNA 3K9GA 4IDHA 4RCYA 5GJBA 2AN9A 3W6OA 1XNJA 2CMKA 4JSTA 2IS4A 3X2SA 1T0JB 5KPDA 1XTJA 1ZU4A 3QVVA 1YZUA 3S1AA 5JRJA 4TYYA 4PSVA 3VU9A 3Q7QA 1OV4A 4NU0A 4QGFA 4LV8B 1XJCA 2O8CA 4JLDA 2ONKA 3GLFA 3SHWA 4B35A 2YOFA 2QMEA 5CB6A 2V7QA 4M1TA 1E32A 5GJWC 4MGYR 1DADA 1Z3IX 4Q7MB 3TSOA 1DVRA 1RRFA 2FPLA 3SZRA 3VU9B 2Q9BA 1A82A 1SGWA 3ND8A 3O8DA 1R5BA 3H86A 1Z0DA 2ZM5A 1JEEA 4I1VA 3GLFB 1XXHA 1N0UA 1HT1E 2ZRKA 5SZJA 4BFVA 3FFBA 1OB2A 5EP3A 2J1LA 2FSFA 1HV8A 2J46A 2ZRLA 5FOWA 2OXRA 2XAUA 1VG1A 1VIAA 1VMAA 2F43A 3B2EA 2PBRA 3DMNA 4BRUA 1J90A 3QXHA 4ZCIA 4OHYA 2Z43A 4Q1AA 4KI0A 4AKIA 2GCNA 4ZV4A 1L4UA 3C5CA 5L3RA 3IIKA 5AJYA 1OXXK 3WBJA 4TZ0A 1FTSA 1XZQA 5A5GA 5J4HA 1G6OA 4UNQA 1AKEA 2PJRA 2IYTA 2WJVA 3CX6A 3NEJA 1SQ5A 2CCKA 3L2OB 4M8NE 4BEJA 3Q9LA 4ON9A 1CP2A 2OSBA 1I4DD 4HUQA 1TADA 1N0VC 1JR3A 2GJSA 2YOHA 1LS6A 3WYAA 5LBIA 3LDAA 2QY9A 4KCGA 3IO3A 1EG7A 3EC1A 4X8HA 3WBKA 3G0HA 1I2DA 4UXHA 3KQLA 2GRJA 1T3LA 1UKVY 5TMPA 4LUCA 4HI0E 4HUQB 1DAFA 4ARZB 4EDHA 2EFDB 2ZREA 2F1JA 2VP0A 4IRUB 4JIMA 4F7WA 5JECA 2J0SA 2QG6A 4GZLA 4FXPA 3SNHA 1ANKA 3UMFA 1VKJA 4XWAA 4JZKA 3BS4A 2ZVPX 4Q4AA 1GL6A 3UK6A 3VHXA 4NYJR 5E3HA 3PQCA 4EUNA 2WKQA 5FPSA 1X3SA 2ATVA 2IT1A 3MGCA 3ZGXA 3HPRA 5JS8A 3AP2A 1VCIA 4FN5A 4IOJA 1SKYE 4ZCLA 3DM5A 2EWWA 4KJZA 3GLHA 2QAGC 3HJNA 2IXGA 1N25A 4RZ3A 3T12A 2X2FA 4G5SA 5DYGA 1IOZA 2GVDC 2PCJA 3WNBA 1R0YA 1TMKA 2O8BA 5FL3A 5D3QA 4AIIA 3BB4A 3BWDD 3A4NA 1PLKA 4YQFA 3C15C 1KKLA 4B6EA 1S2MA 1XX6A 3G82C 1AZTA 3L0IB 1XMSA 4R2IA 4FMBB 4X8OA 4OI1A 2PMKA 1R5OA 5DI3A 1NN0A 4B76A 2NTYC 4TT3D 1D5CA 4OI0A 2D2FA 4BUJA 4Q7JB 4YC7A 4PPFA 4OK5A 3JVUA 2DWQA 2A5DA 4GBMA 1W2HA 2V9PA 3PV0A 2G6BA 4MH0R 4JBYA 621PA 4JYBA 2ZITA 4RD0A 3NBXX 1LV7A 121PA 4RFVA 1AM4D 1UEIA 2FOLA 4V03A 1PJRA 4M1KA 5H68A 4U00A 5DI3B 1OPXA 1TF2A 2JEOA 2QT0A 3BD9A 2CHVA 5DHAA 4ASUA 2QRZA 3RS4A 1N3BA 4LBWA 4BECA 1F2TB 1T3SA 2OT3B 5K8IA 1W7AA 2V55B 1P72A 3RWMB 1EFRD 2GA8A 2ZSBA 4GOKA 3BFXA 4YLGA 1G5RA 5DI9A 1CS4C 4B3DA 2RGAA 4IVQA 1P9NA 2CK3D 2GDJA 4IHQA 1PUJA 1VHLA 1YJ5A 2QQ0A 3TW8B 1J99A 1XEXA 4IJMA 4B43A 4PXAA 4ZDWA 3VQTA 4M4SA 3EA0A 3C14C 3KB1A 4CW7A 4B2IA 5IK2D 2HYIC 2DFLA 3QI2A 4TTRA 2IHBA 2G1JA 4MYTA 2GCOA 1GTVA 1E0JA 3OEEA 1GL7A 1M6NA 4LZZA 1A7JA 4Q48A 1E0KA 5CM8B 2QTHA 1K5DA 3KQKA 4BZQA 4KFUA 1Q3HA 3TAHA 1Q57A 4GPTA 3CPHA 4AKEA 4D82A 4DSTA 1NKTA 3QQ5A 1FQJA 2CVFA 2W2VA 2ZSEA 1L7VC 2B92A 1KI7A 2MMGA 4V0ME 2DB3A 4DSOA 2REBA 2FE4A 2QENA 3AKDA 1ZM7A 1ZC4A 5CYOA 2JAQA 1UBEA 2C78A 3PUWA 1SVSA 2RGBA 2IEYA 4HUTA 4OJQA 2V1UA 8OHMA 1J8YF 1SKYB 5E7MA 3SQXA 1DAIA 5SZHB 2NO1A 1NIJA 3KJGA
chains in the Genus database with same CATH superfamily
2SBTA 1JVBA 1RRPA 3FSRA 1S1MA 4FSXA 4FOPA 1E96A 4XOUA 4CI9A 2CNKA 4EIWA 2BDEA 2G0NA 4MIYA 2J9FB 2XDAA 2Q2OA 2WTMA 3F3SA 4MO9A 1LD3A 2ONYA 5B2EA 3GFQA 1GTZA 3ZQKA 2GUGA 4POOA 1KQFA 4JB3A 1GZVA 2C04A 3SMQA 3ADCA 1QVAA 4J49A 3RARA 4IFTA 1R8QA 4LK3A 5AOCA 5M29A 3DLTA 4X0EA 3WXBA 1MVLA 1OFGA 3W79A 2B94A 5KYYB 2YUTA 1AF7A 4RHTA 4RCZA 2GK4A 3TRKA 2CDNA 2PU5A 3W2FA 1Z9BA 5BUQA 5JXHA 2EF1A 2A88A 3FTNA 3L82B 4QOFA 1V9LA 3THYA 2VPZA 1GL3A 2V9CA 3SSMA 3HSSA 3R5FA 1YB1A 3RUDA 4K9PA 1GZ7A 1C8LA 1NI4B 2XVYA 2Z5GA 1EK6A 3DV2A 5A0VA 5ENZA 1KEEB 4B4WA 1X7ZA 4NBKA 3CUSA 4O0LA 4NAVA 1RAAA 1XC7A 4DZTA 2JFFA 1APBA 2D2XA 1KZ7B 4E33A 3WFZA 1UM8A 2O0LA 2Q5OA 3BWYA 4JVOA 3RTEA 3C85A 1GEEA 2VHXA 2GZ1A 1FP2A 5GP1A 3S8MA 1KE1A 2F3PA 2RK4A 4B71A 2RKOA 1L4GA 2VDQB 4DIBA 1HTBA 3B6MA 3KVYA 4EA7A 4ZJPA 4F9TA 3GLUA 3GLSA 2E18A 3DPUA 4MPPA 1OXKB 3HBNA 3H13A 4KJXA 2QU7A 5BSWA 4E11A 3Q8WA 3ODGA 1B41A 3AY6A 3BMCA 1L4NA 1Y1RA 5JE8A 3UWSA 1NFFA 3D7SA 5G3YA 3RSLA 3NI2A 3N8GA 1KEZA 2JPDA 1MX5A 1CYDA 3DKIA 3L6UA 3O83A 4HNSA 3GEEA 2HDNB 3QPWA 5ECGC 1CR2A 2RGWA 1S1CA 3H2KA 4ZZ2A 3IILA 1GPUA 3E48A 3NBYC 5FOVA 3QXGA 2JHAA 5HA5A 3A3KA 3L8FA 3KKMA 2QW1A 2HF7A 3F9RA 4FXOA 2IV7A 3RUCA 3SNKA 5A7FA 5BNZA 1K66A 1KZ1A 5A0FA 4MYCA 1OC4A 4D26A 3ZHRA 1EBUA 1MIHA 2ZSDA 3KTAA 1MOPA 3G7NA 4JIGA 4U2FA 5D3MA 3ZNPA 1R0WA 1SBZA 1TXGA 4INAA 4IV8A 2XA1A 4EJSA 5BQPA 3E9DA 2VC2B 3Q87B 2ECPA 4D80A 1X3LA 4CV1A 1SUPA 2V4MA 2VJMA 3FCYA 2GHRA 3VM6A 3KFLA 5K3FB 3TLZA 4M2LA 3FOWA 2HEIA 4HAVA 2MTBA 4DLLA 3I73A 4G36A 5AIAA 5DHSA 5K2MA 2GEKA 1P3JA 1KJ8A 3TZ6A 5AHXA 4AWBA 3IJ5A 3I9KA 3ZOKA 3WNZA 3UBTA 2AG5A 3WRXC 4BFCA 2VJMB 4EWLA 4PNEA 5A3JA 3KLOA 1VJ0A 5AUOB 3GEIA 3B13B 2AYZA 1ZD4A 1TA0A 1R0CA 2W6ID 4HWRA 3H19A 2NZYA 4P9NA 2OFOA 1LUAA 2D2VA 2WG2A 4P22A 1QGZA 4DJAA 4DLTA 4QG3A 5F9FA 1QGAA 4KQEA 3F0TA 3LUCA 4R81A 3FMIA 3IHLA 4Z4HA 4N49A 3FTFA 1H3FA 1I1NA 3GJSA 1QAMA 1RXSA 1IN7A 1J9GA 4MROA 4URHA 3MTDA 3BHNA 2F8MA 3GAZA 3OM9A 1VL6A 1I5EA 2LPMA 4I8DA 5G1OA 2C7BA 4PQGA 1EVYA 4HWGA 4M8KA 1P8JA 1FFXB 1IRXA 2YRXA 3HQ4O 1P39A 1T43A 2G0TA 1LBIA 3HB4X 4E4RA 4E1AA 1ZGBA 1RBZA 4MAMA 2Y1KA 3K0CC 4LKRA 2XECA 1H5UA 1JKJA 4LSZA 1KQGA 5K05A 3LC7O 3NLLA 3DS8A 4L1KA 1TJ5A 1DCKA 3ELDA 4HNGA 4URZR 5G0SA 2O2YA 3EIQA 3QF7A 3WLIA 3I01M 2PUGA 5CT8A 1GV1A 4EJ2A 1VGQA 1XTPA 3KZCA 5BSMA 1RTTA 4JU8A 4OXXA 3B6EA 1E66A 2W11A 3VX3A 3C0KA 1USGA 1OR8A 1XRRA 4YJ3A 3P7MA 2P78A 2X0KA 4BLSA 1GTL1 2UUOA 2HYDA 3SKXA 2XYVA 3U60B 2YVQA 4L74A 3EVDA 4EHAA 4DS3A 1ECGA 4DZRA 2AH5A 2GCIA 3C7DB 3UXMA 2RB4A 3Q3VA 4QTYA 1B14A 2CXTA 2LW7A 4N6OA 4QBIA 2I2XB 4OUKX 2EZTA 3REOA 4KE8A 3AP1A 1C3VA 4QUHA 3WGMA 4C07A 5BWBA 3ZIUA 4CQMD 1JG3A 3H9EO 3E84A 4MVJH 4L8YA 1YJCA 2HHJA 3KBBA 1NW8A 1PR2A 3AESB 3T3EA 3FMFA 4Q4JA 3OP4A 5FBLB 4C08A 3SX0A 3ZV6A 2OBLA 3UJDA 1XTRA 2H7CA 3M6VA 1EAYA 4TRJA 3T6KA 2WWGA 5FRDA 3Q3CA 3ONDA 2X8AA 3WDMA 3QKRB 4OHBA 4JKOA 4DV4B 1W76A 3HB5X 4KWTA 5ECYA 2AJ8A 3SQMA 4YV1A 1SOVA 4LFBB 2BLLA 5I4BA 3A1NA 5IF3A 1UBLS 1Q1AA 4EY8A 1SUIA 5DKFA 2RGCA 4JC0A 3BQ9A 1LI7A 1QQ5A 1QAQA 2ODBA 4WKGA 1H9CA 1FNDA 1F5NA 1QO0A 4JQZA 3OO1A 4LA4A 4N3BA 2G04A 5EE5B 4C6SA 4Y1EA 4RDXA 5JCJA 5I4KA 3AM1A 4TUYF 1LY1A 2XRFA 3QRWA 1RE1A 4OU5A 4L72A 2ZYDA 4PAOA 3CNLA 4UE2A 3KZXA 3NHUA 4LHZA 3V4ZA 2FH5B 1ZRNA 1T10A 1JJ7A 3ADBA 3L7NA 5JNWA 1J39A 1P4AA 5B4TA 4MQBA 4BN0A 1R4NB 1ST3A 2DG2A 1DBIA 3RAGA 1G2QA 5IABA 5K6TA 1VA5A 1WB6A 4LZNA 4LOHA 1U2QA 1GFWA 4MIOA 4OQFA 1E2FA 1RLTA 3A05A 3II6X 3ILVA 4M8LA 2XKJE 5ALLA 4ZVRA 1CUZA 3L4KA 5K0CA 4PSKA 1RJDA 2UYCA 3BWMA 3VDMA 3ZWKA 3I37X 1XTKA 3OUZA 3WLNA 4JK3A 1ZGCA 8MHTA 4OYYA 1Y33E 2JLZA 1G9TA 2GM4A 4E12A 3T54A 3U48A 4FDUA 1TCAA 2YWJA 2XB9A 2VIIA 4MMYB 3AVVA 1NF3A 3QKWA 4JP3A 1AQIA 3WKBA 2YIDA 4II3A 4AX8A 4ZVPA 3MILA 2UYQA 4TL6A 4N1AA 1C9EA 4QUBA 2OB1A 3E03A 5K3CA 2IITA 2ZWIA 1MEEA 4G41A 1RQNA 1F14A 1LQUA 1LF5A 2BF7A 2GBLC 1X8LA 4YCJA 1C8KA 5L6LB 1GQRA 1UWVA 5KPJA 3LW8A 4JLVA 4KBFA 2RE8A 2FPKA 2QQEA 4D3XA 7MHTA 2AN1A 3WGNA 3G7SA 5TGZA 4E5SA 1NTRA 3ZWQA 4HDOB 1L4MA 2JLXA 4KNWA 3QVGA 3BWBA 3C24A 3ZQ4A 3ITNA 2C8LA 2DLDA 2XTZA 3QBEA 2P8SA 1W36C 4NNOA 1K9VF 3MQFA 1AXRA 1C3JA 4DWWA 1ZD1A 1KRWA 4YVFA 2O52A 5JRZA 5EWMA 2CCJA 3O38A 1Q16A 4U7HA 4E7PA 4GVLA 4B84A 4EF6A 2G8NA 2GOYA 5BYBA 4IKPA 5IARA 4V1CI 1ZM9A 1Y8CA 3UGKA 5BN1A 3H2GA 1F38A 3AF0A 4B6SA 1ENZA 3NIFB 1WMEA 3DP7A 4QG7A 4IGKA 2OLEA 3ZDXB 3LWNA 3IOYA 2B4KA 4G5HA 5AOAA 3S2GA 3GFFA 4ND3A 2BM1A 2FPMA 3KD2A 4RK7A 3TE6A 5WRFA 2C4WA 3C39A 4C7KA 1O0CA 3IDQA 4BRWA 4BMZA 4F04A 4KFSA 5JYCA 3MD9A 4YJFA 1BMFD 3AH8A 5BSUA 5TPZA 1JV2B 1RRVA 4OG2A 3NW9A 1N8TA 3KZVA 3TX2A 4WW0A 1KWKA 3CLTC 4LF4B 1JALA 1DBVO 4MRSA 2FWPA 4HDNA 4YYZA 3VKUA 4C01A 4D3YA 1ZH2A 2IXBA 3EY9A 2BELA 2Q5LA 3D3JA 4I9UA 4KQFA 1XZ8A 1JI0A 2JD0A 1VXRA 4O4IA 4UCFA 1YQGA 2BUBA 2CYCA 1OW3B 3JWIA 2CNDA 2I8CA 5ADHA 4RTMA 2D1TA 2YJGA 1B0PA 2A35A 3C5WP 1SHKA 3CEAA 4FDMA 2D74A 2F64A 3PUVA 1RJ9A 2GR9A 3D8HA 4LJLA 5GJCA 4CL8A 4DA6A 2ZS9A 1BYIA 4EL0A 4B83A 2AEJA 2FPSA 1HDZA 2WMYA 2H0RA 1T8RA 2C7RA 3WJ7A 3IP6A 4JX9A 4UBMA 1LU9A 3C5VA 3RKUA 3S2SA 4AD8A 1B3BA 2QPAA 2IS1A 2P7IA 3HE3A 2HRDA 4ENTA 1RJ9B 3FI9A 3TZCA 1MX3A 2W22A 3LKDA 3BC1A 3CISA 3OPYI 1J2RA 2WWFA 2ZYIA 3OE1A 4G0QA 1ZGHA 2VT3A 4H2DA 4JEUA 5FLEX 4BO2A 3HDYA 3A7DA 2WPNA 2KWIA 3IP1A 4DADA 4XB6B 4ZT7A 3SYMA 2MYPA 3GJZA 3NRCA 4IQGA 1TZ2A 2C0CA 3VZDA 3IBSA 2ETVA 1U3VA 3BWCA 3RFVA 5L45A 2P3OA 2VTBB 3A3PA 2IC5A 4NKRA 1Q22A 3DWEX 2EFGA 1J2TA 1ZMTA 4GECA 4DCOA 2NIPA 3GPDG 5MFZA 5DLQC 4BNTA 2EKZA 3TEMA 3GXBA 3IPXA 3KXKA 3V46A 5DYYA 4BGUA 3IKTA 4U9HS 3TM4A 3O2QB 3MT8A 4EHLA 3TVYA 1KS9A 1SUDA 3RV4A 4ZT3A 5DVZA 3WO1A 1KWGA 1UXHA 2ZR8A 2PG3A 4G01B 4ZMBA 2ZVDA 1NU8A 3DQZA 2PD6A 4JOCA 1IY9A 3UJCA 2V1XA 2X41A 3GELA 4FGLA 3R7SA 3WL3A 1VRCA 3RAPR 1XZAA 1PJZA 1AZSC 1N4DA 2O0MA 2QTBA 2GRUA 3HB0A 4F45A 2IQIA 1DQYA 4D8UA 5LKAA 3TDMA 2A1TR 2N47A 1GLGA 3GP8A 1JFTA 1PT8A 3AV0B 3ICEA 1ZU5A 3K70C 3D3EA 3ONNA 3PRYA 1M34E 4J0QA 4B3SB 1SOWA 1ZI9A 2H18A 4LRUA 4JT8A 1J8QA 1DEAA 5K0GA 4QODA 1AV6A 5FBHA 3GLRA 2AVDA 1L5HB 2X7XA 4NHOA 1E1YA 3KWJA 2HCBA 3GJQA 3ZHCA 2XMBA 1NPTO 4A2CA 5CFLA 4MA5A 4Y2VA 2HH9A 4AM8A 2EWVA 3JATA 1RBYA 3RFXA 3WMFA 4ZHSA 5JV5A 1UMKA 1JJAA 3GRAA 4DT1B 1IM5A 3UTDA 4E5NA 4TQGA 1S2GA 2FN3A 4NYMQ 2PMBA 3AVOA 2O59A 4D4KA 5EAIA 5JYDA 2B1QA 3H8JA 4ENSA 1X1CA 3STUA 2O8EB 1JKMA 1PSDA 3EXAA 1B15A 3OETA 5EWLB 3ZG6A 3KQHA 1AUOA 2QYOA 3MT9A 2ZJ6A 2ZG6A 5H9VA 1KSHA 4QGGA 1VL1A 1A8IA 2GEJA 1JQDA 1Y4UA 2YASA 1OXVA 1OF1A 3QHPA 4RD3A 1ISIA 3OLVA 3B3AA 3UO8B 1S3SA 1MH9A 1SULA 3MWDA 5IBRA 3V2GA 4M3NA 1E1MA 5DOZA 4CEJB 4V2UA 4FX5A 1NONA 3L07A 3HBLA 5IEJA 3IP5A 1JBKA 3BJZA 4L75A 1AD2A 4LX0A 3LF2A 3F3KA 4UPEA 2QG9A 3BGDA 4IXWA 3F4BA 2YMMA 3VR1A 4XVQA 3H2SA 3NBZC 3QMPA 4JT2A 3D3KA 3WL7A 1KMNA 3V8PA 2H5JA 1JPNA 5J1TB 2YV5A 1YCGA 3HDGA 2VRCA 1N2BA 5K99A 5HQTA 4GKJB 3BH0A 1E2GA 1HQYE 2R1VB 4BMXA 2C9ZA 3E23A 4B8WA 1LVHA 1RHMA 1H3EA 5NULA 4TMFA 4A03A 2GJ8A 4Z9YA 1CF4A 3U3XA 2F8LA 4KK4A 1XSEA 1KK3A 1EUCB 5DGXA 4UNSA 3TNYA 3W8DA 4ETIA 4RIGA 3EODA 2YN4A 5TV2A 3W5SA 4EUSA 3DE7X 1M5UA 1OLXB 2GYUA 1GEGA 2I3ZA 4GPBA 2X1VA 1SXJE 1TAQA 2HWWA 3BMQA 1TQ8A 2NO5A 2PLNA 5G1PA 4IMRA 4A92A 2J07A 4W8GA 3AVPA 3HDJA 5CYFA 2VJDA 3QMWA 1LF0A 1W36D 2VHEA 4Q9KA 5D5PA 2ET6A 1UKZA 5BOVA 2LD4A 3ZR4B 1D7AA 3ND6A 3NFYA 5THQA 4A0SA 4W5TA 1DV2A 2WA1A 3SN6A 4BMVA 4F6CA 1T2VA 1DEXA 1PS8A 4M1OA 2OCPA 1G6Q1 1P33A 4G5RA 3DVQX 3MCAA 4DQ0A 1HDIA 1T26A 5EYPB 2OAQ1 2I3GA 1W48A 2VEDA 2XW6A 2Y9PB 1VLJA 5HF5A 4FSDA 1TT5A 1WCWA 3ZCRA 3ZCTA 1X80B 1C0KA 1XAJA 2RGXA 4K6OA 4UMVA 1GITA 3VZQA 4EHDA 1BWPA 3PE4A 2D62A 3E7FA 1X77A 5L7YA 1JIUA 2ZU0C 4R1QA 1P1JA 5KJCA 3A9UA 3IQHX 4G8DA 2DBRA 3DHEA 4LNHA 1NPDA 3CLTD 4NSNA 4EVRA 5KNCD 1YAJA 2HHLA 1E9DA 3LUGA 4YP5A 2HLHA 3A2MA 4PZZA 4UREA 2VS1A 2FFBA 5HKLA 1F0NA 1FMJA 2NU7A 4IHJA 4F56A 2Z4TA 5ITVA 5JXGA 5DBEX 5HKOA 1ZD5A 4DDTA 1H2YA 2XQJA 2ZBEA 5CM9C 1FDTA 1M8PA 5HF8A 1F4PA 5EJ7A 3RC7A 1RADA 3GRKA 2M2IA 2YYYA 1VSUA 1EX9A 1KY5A 3EIOA 4YROA 5D1HA 1D8TA 5DBFA 5IT0A 4K6MA 4GXRA 4DTIA 3H7IA 1RKXA 1GU1A 2HK6A 4C0QC 4CEHB 1CJUC 2FEOA 3IQWA 1RMYA 1XAGA 2UZ0A 4FQ8A 1N2XA 3UMJA 4BVGA 1XNQB 4FDTA 1PGJA 1YVPA 2C7VA 3WLTA 1U9JA 2WJHA 4NG4A 4ZWNA 4DQKA 5JHGB 1KAMA 3DSRA 4MAAA 1DNPA 1N5IA 2ZFUA 1P8AA 3CF2A 1X8JA 5J23A 4I4NA 4PLHA 1WM1A 1ADJA 2PL1A 2V7VA 3DOIA 1Z16A 4BKOA 3HEMA 5CK4A 2HPZA 2NSHA 4RZSA 5CT9A 3BRWD 2E48A 2GI4A 2BKXA 2YWHA 4OJMX 5CTJA 5F4BA 1XZIA 3TMYA 1SEPA 2R5WA 3A4VA 4MOWA 3DAOA 4NCNA 5EZYF 4Q01A 3RR2A 5B2FA 5CG1A 3KELA 2PJUA 4G65A 2XITA 1E5QA 3DZ8A 5K8UA 4UEJA 1D7OA 1GNSA 1Z25A 5K4HA 4C0HA 3CX3A 2XF2A 3M34A 4MRVA 2L17A 4IYJA 4HN2A 2OESA 4LY0A 4RH3A 3SZ3A 4HB0A 3T4EA 1RM0A 4C0AC 4D4MA 1VM6A 3MOIA 3KJQA 2WU3A 3CWZA 5HF6A 4LVCA 4NJMA 1WXWA 1P9RA 1PV2A 4MHSA 1P0MA 3HZOA 2AXEA 3TLEA 2XUZA 3I2KA 1WVMA 3UWMA 2ZPUA 3EGXA 1XTTA 3MUFA 4GR4A 3A4TA 3U62A 2CXXA 3K70D 2GO1A 2ZJOA 4MQFA 4C3VA 4ZCRA 3H1EA 1JN0A 2BFEA 1HR0B 1CQIA 2ZIWB 1XU9A 2XA9A 3VR2A 1GRCA 4H18A 5EZQA 4TSFD 4FNOA 4TWBA 5ESDA 3ZWWA 4M1WA 3HSYA 4Z9BA 4B6OA 3EGXB 1RQRA 1ZISA 3ORRA 2A9QA 4S0ZA 3SM9A 4YXFA 1F2UA 2OV8A 1VE1A 3N59A 4MQFB 4PHHA 1I9GA 5EHQA 1A8SA 2BFEB 1CQIB 2XXBA 2NU9A 1QNFA 2VNAA 3INNA 3GLVA 3ENVA 1AXEA 3PGJA 4MRMA 1L5LA 3T7TA 4DEYA 2MINA 2ZIUB 4B31A 2QJOA 3KUUA 1GQ2A 4YAKA 4PRLA 3TMAA 1HETA 1F2UB 2CEAA 3IEVA 2XWJI 3FTDA 4B74A 5DIFA 4FYKA 4BMNA 3RHSA 3N53A 9ABPA 1MXHA 5AVWA 2NU9B 4R71A 5I47A 3E9MA 2XMRA 5ALYA 1HH4A 2YZ2A 4GVXA 3FOEC 2PGJA 1Q44A 2Q2QA 3AIIA 4QA9A 3RBVA 3JZMA 5K6AC 2GD1O 2OM6A 3PQ5A 4H31A 4EGQA 4QUDA 2FETA 3MLAA 5BSKA 4OLBA 3T5CA 4P7FA 3ABOB 1X39A 1HT0A 3L8CA 3Q0EA 4F9EA 1YQXA 1C14A 1E2KA 4QUIA 4MI3A 4U7FA 1JQEA 3GQBA 3JD0A 4OUDB 5BNWA 1PZFA 1R2QA 1M8FA 3RADC 1T13A 2I3BA 4REMA 5DHTA 3ABQB 3TF5A 4R3WA 1Z06A 1W49A 4LC9A 3AR8A 2R86A 3KJXA 3M6LA 4JI8B 3EA5A 3W3AA 1XHEA 3TZLA 1KVQA 3CZ5A 1TZKA 9LDBA 1NF8A 3FYHA 5IDWA 2D4HA 2QBYA 4QVGA 1FUYB 3ASVA 3VO1A 5L40A 2EP5A 4CUKA 4QLOA 2E4AA 1X7GA 4YT2A 4BUZA 4O2BB 2NSDA 3I2JA 2Y2UA 1MQSA 5FPTA 3FOFC 4YP0A 7GPBA 1NVVR 1YL7A 4Q4DA 4TMKA 3V6MA 2F9LA 4ND8A 4ECEA 4RDCA 1NC1A 3KKPA 2PKXA 1JFRA 2AK2A 3AHIA 1WLYA 3PHJA 3PWSA 1UBNA 4RY8A 1Y37A 2Y4OA 4HV4A 4GMDA 1RYMA 1DXHA 2I4OA 3CNBA 3P9CA 4L5AA 4D9KA 3KZ1E 1K7FB 4Y9RA 2RHLA 5CFPA 1NBMD 1SXIA 3AUTA 4MXDA 3WV5A 4F92B 3KHKA 1J7JA 4E13A 4E07A 2VL7A 2ISSD 4TSKA 4GFDA 4H59A 1VC2A 1I1QB 1NXXA 2BRUA 1YS7A 2IXDA 3P2OA 4IF4A 1K86A 1YHYA 4K46A 1HDXA 1RFGE 3LLCA 4L95C 5EJ6A 1Y0BA 5IANA 2P3SA 1W0KD 2J7PD 1VIYA 3MW8A 3V8MA 2NU6A 2WM8A 4R9RA 3VDQA 3I6IA 4RF2A 3S29A 3DONA 3H1FA 1EFVB 4L8VA 1YTUA 2X23A 1KXJA 1J21A 1JHXA 1W1IA 2A0XA 2WWRA 3MJHA 2ZQZA 3P97A 1QB8A 3HKEA 5KOHA 1P7WA 2LCFA 3B5IA 3A6JA 2WSSD 3EF0A 4E88A 2PSHA 4MB0A 4R31A 3U3KA 3ZBPA 6CHYA 4CKWA 5J2UF 4EJ6A 2QLTA 1LPAB 1FRVA 4OQDA 1KIAA 1RW4A 4FOOA 5DFAA 4EG0A 5E9QA 2C8KA 3Q5EA 4CM9D 3EULA 4AJ1A 2HRQA 2P11A 1PSWA 5CDTA 4C14A 5B1YA 3SX4A 2W43A 3HKEB 1MD9A 3EMKA 5C8VA 4AZSA 4BBJA 4G25A 1IBKB 1RE0A 1YT5A 5BW8A 1R6BX 4UVHA 1VYTA 2Y66A 2Q99A 4MVXA 4RJKA 3ZGYA 4X41A 1E61A 1HTTA 1DPGA 4Y9SA 2PUHA 5KYXA 2J8ZA 4NTZA 4AG3A 4RLSA 2ID9A 3B6ZA 2HMVA 2Q0QA 3LQ4A 2DTDA 3QNMA 2IIPA 4WBNB 9LDTA 2UXCB 1V1MB 4LXGA 3VI3B 4EITA 1C50A 2VN8A 4KYUA 3ZWYA 2PZFA 4K86A 1BHQ1 1FLAA 5D5HA 5KO2A 1ITZA 5DXJA 2C2KA 1WUHS 2FMIA 4WCDA 4J29A 4B5LA 3MAGA 2OCAA 1YOVA 3NBFA 3TGPA 2IYXA 4KXFB 4PNPA 4D6YA 4EJ0A 3PC8A 2BM0A 2FWIA 1DKNA 5E9WA 4RTJA 4TMYA 2QRJA 3F3MA 3D64A 5FTWA 3UMSA 6PFKA 4MW9A 4Y7DA 2TECE 3KSDO 3M1AA 1A9XB 1IUOA 4EY3A 1RRCA 2HK8A 4ZVTA 1Z4QA 1N1MA 1KO8A 4JJKA 1L4KA 1XZBA 4ZYWA 3IVCA 3ISTA 4ZVLA 3OPXA 5AUPB 1TK9A 3SCZA 3VAZA 2CV1A 5LUAA 1PUXA 1YZNA 1OGIA 3UBMA 4ZCTA 3U13A 4WXYB 4ABYA 4TMTA 2JANA 2MR6A 3FPEA 3P9QA 2VJCA 4YBZA 5J3JA 4D81A 1KEKA 2CVZA 2O4CA 2GASA 5HW0A 1ULHA 1Q0LA 3VTFA 3ZNQA 3QVMA 2W8BB 5BN3B 2QV7A 1R50A 1T34A 2QLBA 4I1RA 4L27A 1FNMA 4BFWA 2BBWA 3C3BA 3HJHA 5FNVA 1CHNA 5EZ6B 4AAYA 3COSA 1P2BA 3C1TA 2QUAA 4CNBA 4RH0A 3KSRA 4GBJA 2ZUVA 3ZJTA 3QA3E 3FFTA 4PRKA 3ZGOA 1IQ0A 2QW0X 2ZYHA 4YLYA 2RJ3A 4PFQA 2G4VA 4YREA 4BNKA 2AEFA 2HJ9A 1ZUD1 2F1KA 3MS2A 5A2QA 3RC8A 4X20A 4C4XA 2R66A 1G9SA 2PVSA 3DZBA 5FNVB 3ESQA 2JH3A 4URXR 1OH7A 4OHOA 1Y1PA 4OMFG 4U3JB 1BO6A 4KBGA 4C4ZA 5CDGA 1QZUA 3W5UA 1Z2AA 3K8ZA 4B3TB 2AHRA 2C5FA 1PFYA 4UUAA 1D2RA 1HEYA 2EBUA 3JQAA 1VHTA 3H5TA 4QHTA 4IJKA 3C4VA 3H8WA 5A4IS 1QYRA 4M49A 1YR6A 2FX2A 1AGYA 1TTQB 1C9YA 1IOVA 1Q12A 1XDBA 1XQXA 2D0PB 3F97A 2IY7A 5LCXA 3ZU2A 4BAZA 4IHAA 3ICPA 3UAXA 4U7WA 1T3HA 3OLYA 3WL6A 2GBFA 4D8WA 3PCRB 4M86A 3BXXA 3PFKA 4F5EA 3A28A 2VNJA 4FBLA 2H2IA 1J1IA 1Z5ZA 2ZRNA 3DULA 5L51A 2IHZA 3GUVA 4KO4S 5ALOA 5GJVC 4Y2PA 3RQSA 1B43A 5AVJA 1DKUA 2CMHA 4MI1A 2J3MA 3ZDZB 2JEZA 4PW0A 4R7GA 4Q47A 1TK2A 4NMLA 1ZW6A 1VSBA 1AN0A 2W6JD 3IAFA 1U8FO 3AUKA 3MJ4A 4KQ1A 4I50F 3PIRA 4ZOAA 3DFIA 1OIWA 5ALUA 4IUBS 5ERXA 2E9SA 1UEXC 2Y0PA 2GAOA 3MHPA 3BJRA 2D4AA 2XH8A 3HJCA 2X58A 3GJ5A 4ND2A 2W37A 1EBBA 1EXDA 4EGAA 2RBEA 3EZXA 1J23A 3NH9A 1WE2A 1WR8A 4HPWA 3AUUA 4JQSA 3OY2A 3MK31 2AGVA 4QU5A 4C0BA 1HF3A 3P9XA 5EQJB 4BQQA 1UT8A 4C5BA 4ZV7A 3O8LA 3ZI7A 1AH2A 4QQKA 3LQYA 5INTA 3L4JA 1AUVA 2DF8A 3DW1X 4OP2A 3ZQJA 1T3TA 3HWX1 5ALKA 5ALVA 1USWA 4XFJA 4FZVA 4Y2XA 4BQIA 1TUBB 1PZXA 1IZ9A 5DCLA 4G5GA 4HH0A 1JW9B 5K0TA 1DS6A 4LE0A 3IVAA 3GGGA 1QAOA 2GFHA 3K0AA 3FWYA 5JXIA 2Y8EA 3KWMA 4IWNA 4R01A 5CA1F 1YF3A 3O7WA 2RC6A 1F4VA 5KYVA 3UH0A 4XFKA 4D0NA 3ZDAA 2BZSA 1U5CA 2EARA 2KSQA 3IKMB 1V8FA 3RUIA 1L8AA 1B26A 2O48X 1N9KA 3W7VA 5EJ5A 1C3EA 2G4LA 2MT9A 2JGJA 1RYDA 3NALA 1WY7A 3TAUA 3FVQA 4YJDA 5JYEA 4YDRA 2DE0X 2OBFA 2XNSA 4OK6A 1C1HA 4PZLA 3QH4A 3K71B 1AKYA 5TQ0A 2ADOA 4W6QA 4IJWA 3HO1A 4RYDA 3Q0TA 1ZITA 2ZIEA 2EZ8A 4EMSA 3QKSB 3MRTA 1UC8A 1JHRA 1H66A 3JQ8A 2A5GA 1KOJA 3AETA 2R1ZA 4MQ5A 1TVKB 2NTNA 4OY3A 5FOTA 2L19A 5JSZB 3H6GA 2ODPA 5F73A 3WLFA 2WZCA 5TQ0B 4F3KA 2O8DA 1ABFA 3R8CA 2Z83A 1ZVJA 3VI4B 1KMHA 1HWYA 1XDGA 2H08A 5JNTA 2IY8A 4UNRA 1QHEA 1I01A 4CNQA 4RTKA 2PAFA 1JTEA 3AETB 4KYIB 1Y9ZA 1YDGA 3RS9A 1EZ4A 2YHSA 4F71A 4F91B 4AS3A 2VQ3A 4R2KA 2YCBA 3S28A 4Y0AA 1H94A 2KE5A 2OGZA 4RVNA 3KEFA 2Z95A 1ND6A 2NXCA 2P9JA 4NBVA 1MHPA 3VSAA 2G80A 1GSAA 1K8RA 2Z3ZA 3OFND 4PR0A 1G8KA 2QU8A 1JNXX 4BRZA 5HS4A 1YNOA 2JIPA 3IKLA 4GOXA 3PPXA 3BMOB 4BO3A 1OWMA 1ZA2A 4BO4A 3OFVA 1M2VB 3ADOA 1UJBA 3GJ7A 5AW1A 3C1OA 3TR0A 1MOSA 2CXOA 2PUBA 1PW5A 1ZOSA 4OYHA 3TLYA 4BQRA 2OZLA 4I7EA 5BSRA 2W6NA 1DWQA 1DJNA 1EA5A 3N2GA 1RRGA 3ASZA 4KGDA 1KERA 2OORC 3I0MA 2RGRA 1WHSA 4S24A 2C5BA 2HHAA 5DN6D 5JWOA 5C5EA 1NRXA 3BMNA 4P38A 4ZU6X 1XD8A 3EVCA 1H6DA 2PIDA 3DV0B 4L22A 1IG0A 2V5AA 3N75A 5I3CA 3HYTA 3ER9A 1Z08A 5HE8A 1YUMA 4HCJA 4MVYA 5HVNA 4ILEA 1U4NA 1F8YA 3KAQA 3MGKA 1T5IA 3EQ8A 1P4RA 1BCSA 2GAAA 1IQUA 1NUQA 3BEDA 3ETJA 3IS3A 3GRCA 3M6WA 3NBQA 4Z8YA 3ZXXA 4B2YA 5EIAA 4BATA 1JAIA 2FFJA 3ZK7A 2E3JA 2P69A 3O94A 1B1CA 2Y1WA 4TMXA 1A9PA 5H82A 2O20A 3AVYA 2VUHB 5JO9A 5B4UA 3COPA 4INPA 5EIBC 2Y68A 3DNFA 4AULA 221PA 1EUDB 4DMLA 2ZYRA 1P5ZB 1A77A 1YJXA 3EUAA 3PZRA 4J07A 1T2EA 4R3NA 1KO4A 1XCMA 3GX1A 1K6XA 4BLOA 2VTDA 3RYHA 1UAAA 3A04A 4UTXA 1HYHA 3R3SA 3RC1A 3BX1A 4JR2A 1K8ZB 3B51X 4KO8A 1SUFA 2FEPA 2DHEA 1NOKA 1DXYA 2BMWA 2Y0EA 3KWLA 2G17A 3R3JA 1DO0A 1Y4AE 1UQRA 1E1RD 1GR1A 2WWXA 1M8JA 3LY5A 4MPJA 1XTBA 5AM2A 1GZUA 3NTLA 5JC1A 4CT0A 1U11A 4DM4A 1P4JA 5JYBA 2VBCA 3CF6R 3OIUA 1H8ED 5AKIA 3ANLA 3U56A 4EI7A 2OKCA 1UM9B 3VZSA 1FYVA 2FMHA 2VP3A 3O4HA 4RKQA 4TXHA 4XCXA 5DZSA 2A7XA 1OKKD 5EJMA 3UAGA 5GIPE 4DB4A 1RXIA 2C97A 1GM5A 1W1UA 2FFQA 2Q8NA 3IA2A 4BWVA 4Z1MD 3QPBA 5C81A 3TJZA 5FBQB 2LCIA 3HWRA 4BFLA 3K0EA 2H2HA 1HXHA 1OROA 2O2SA 4C22A 2DAPA 3TZBA 2A9OA 5CAEA 2PRYA 2EIXA 2X1HA 1AOXA 3TQOA 3UMGA 3NBKA 2ZANA 4GQAA 3F5SA 5I7VA 3TZEA 4Y2QA 1VCOA 3WICA 2DPGA 3EBPA 1J49A 3TL3A 3NEYA 3LAWA 4EY4A 5BV8A 3DF9A 5IZ4A 2CNBA 1WB5A 1ENOA 4GXTA 5EG5A 3ZYCA 4JY7A 4ESEA 2E5FA 4MEJA 3AOEA 2HI0A 4BTVA 1SCNE 1NJGA 2WR8A 2JFZA 4LHVA 5C80A 2A57A 1D2AA 3UPTA 3A10A 5FPYA 4F5WA 2FMKA 3EH1A 1YI1A 4H4CA 1KTVA 1C4OA 4Q05A 2ARKA 2X4GA 3CRZA 1U99A 3SOPA 3WLKX 3RAFC 2BMAA 2QYHA 4V3BA 2DHQA 4ZAGA 1IC6A 1V16A 1IQRA 3AWDA 1QK3A 3F6CA 1W5SA 5L3ZA 4MCAA 4DVJA 1F51E 1PUIA 1W59A 3QLJA 4BPBA 1D2EA 4Z2AA 5GINE 1R18A 3VYUB 4DLNA 5A5FA 3LIPA 3D59A 1P7PA 3C6QA 4P80A 4P4SB 2RAFA 4PG7A 2BSAA 1RYYA 2CKMA 1XROA 4U6SA 3ZTWA 1RDFA 1BS9A 1BC5A 3W90A 5JFGA 3WVNA 3K0BA 3RRFA 4TYNA 4G0MA 1P5JA 2HUPA 5GGXA 2HRCA 4HSGA 3BMXA 1CIPA 3NOXA 4G1CA 4K6HA 1GT91 4Y8VA 4JL8A 4QOHA 2CDRA 5FPKA 1T36B 4I4TA 3SZLA 4D41A 2HX1A 3ENNA 2DX7A 4KWEA 4MQEB 3WQSB 3SZOA 2BGLA 4F4FA 4BEVA 2H1OA 1FNSA 4E3WA 4YRBA 2B8NA 3CIFA 4QSHA 2G63A 3RFUA 4I66A 4MKXA 5IT4A 1X7DA 2AI2A 2RGGA 2R00C 4QLAA 1X8KA 2PGIA 2HRBA 2V58A 3GZNB 4PSUA 2R97A 3RREA 2B37A 3KV3O 4V0RA 3U1TA 3W3AH 3WGYA 2GM5A 2WRZA 3SC3A 3OM8A 1YCHA 3JSXA 3NHMA 3TIXB 1M1NA 1GYQA 1JPUA 4BU1A 2DLNA 2HA2A 3HYCA 2QIPA 3HJTA 3M83A 4LDQA 1M33A 4N0MA 3DVAA 4AG5A 1OXUA 1CRLA 3FSEA 4D1YA 2WVHA 4YV7A 1SRRA 2R2GA 4DIFA 4Q82A 5JOQA 4HJXA 3S1AB 1WW2A 3AJDA 1ULZA 1ESEA 1SK8A 4G5OA 1K4YA 3FPGA 4IJ5A 1P3Y1 2QWXA 4X92A 4D5EA 1CP3A 5AUNB 3PXAA 3MNFA 1IZYA 5MN6A 2IXAA 4QPDA 3U4DA 4EEKA 5KTMA 1XEWX 4YMGA 1ODCA 4EI2A 1XRNA 2AQHA 2F4NA 2SECE 3DVAB 3JQRA 3ORYA 4LQLA 4RGQA 4P5DA 5AVQA 1QH8B 2X14A 3TNLA 4ZYUA 5CLIA 1FUUA 1XU4A 1UBFA 3HYRA 2BEVB 3KQVA 2WWIA 4BMOB 3FXAA 3IGFA 4G5QA 3TLKA 1KTIA 1YZKA 4D3FA 2WI8A 1MW9X 1Y1SA 1NXQA 2AWNA 2XBUA 3NT2A 3LVQE 4NI5A 4ZXPA 1YI0A 4W1SA 5TXGA 1BQ4A 3BILA 3GG9A 2D8AA 3H9CA 3RRJA 3W5IA 1FDUA 1MB3A 2QXUA 2QP3A 4QOGA 5LD2C 3KB8A 3OM1A 3P94A 4BNGA 4C7JA 4BLPA 5LZ5A 3EYWA 3NO4A 2H2WA 4Y1FA 5K0EA 3AVXA 3KLPX 3GJRA 5HR5A 3L7JA 4FHZA 5CNJA 2AIRA 4QKQA 2I2DA 3F5MA 4AECA 4JJFA 4UDXX 3AF6A 1GYRA 1L6RA 2Q3MA 3A36A 3LCJA 5JCXA 3VZRA 3EZGA 4RD2A 2IH5A 4H1WA 3H84A 2FCAA 5A5EA 3AC0A 4E0BA 4UHCA 1YZQA 3M4XA 4JGIA 4NBSA 1DJQA 1AXGA 1JJVA 2B2NA