1HUQA

1.8a crystal structure of the monomeric gtpase rab5c (mouse)
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
164
structure length
164
Chain Sequence
ICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNTDTFARAKNWVKELQRQASPNIVIALAGNKADLASKRAVEFQEAQAYADDNSLLFMETSAKTAMNVNEIFMAIAKKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural plasticity of an invariant hydrophobic triad in the switch regions of Rab GTPases is a determinant of effector recognition.
pubmed rcsb
source organism Mus musculus
molecule tags Protein transport
molecule keywords RAB5C
total genus 55
structure length 164
sequence length 164
ec nomenclature
pdb deposition date 2001-01-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1huqA00
4LV8B 2JASA 1RFLA 4GZMA 4EJSB 4C0KA 2GCPA 4F4IA 2P6RA 1E1QD 4BFUA 4URVR 3DPUA 1NNEA 1OSNA 4EPYA 2PCJA 4M4SA 2JA1A 1QZXA 4BFWA 3EX7C 4I1SA 1XPRA 4HDQB 4XSGA 2WWXA 3RWMB 3SFZA 4Q4HB 1CIPA 3BJIC 4Q9JA 4KYUA 3LX5A 4HAUA 2XITA 3B1YA 4FMBB 1UPTA 4ILEA 4KCGA 3TBKA 3RS3A 5AWFC 1G18A 3A4NA 1NMZA 3C41J 1IN4A 4LYHA 4LBWA 2OCAA 3DZDA 2BJWA 2WAXA 3M6AA 4OK5A 2HUPA 3W90A 4O2LA 4ZKEA 4TLCA 5EE1A 4TSFD 4B76A 2AX4A 2CCGA 1OXVA 1MRNA 3D31A 4PPFA 2F3RA 4RFVA 1OFIA 2VP4A 3NC1C 1AZSC 1CXZA 4AURA 2OCYC 5DN6A 4CYMA 5GJCA 5EXTA 5CITA 3UMSA 3B60A 1NBME 1JALA 1X86B 1OXTA 5HCIA 3AKDA 3GJ0A 1EWQA 4C0JA 4BFXA 3ZD6A 2B21A 5JWOA 2WHXA 4OI0A 4G5GA 4LHYA 3EASA 2IYUA 4EJSA 4TYWA 4JT2A 1RRCA 2BMEA 2HLDA 1G5TA 5GVSA 5GVRA 4PZYA 4G1UC 3LX8A 3O47A 2NZJA 3ZVNA 3LA6A 1J2JA 1U99A 1US8B 3VR2A 3NDPA 1FL9A 2JJ2D 3RDPA 1PZNA 1J70A 3G82C 2CJWA 3N2IA 4C3ZA 1U8AA 2JDID 1U0JA 2DBYA 2JATA 4LYAA 5CM8B 4M8NE 1D5CA 1JAIA 2J9RA 1NJFA 1HUQA 2QEQA 3QKSA 1PV4A 3X1ZA 4ZPXA 3VKWA 4WIAA 2VTKA 2B8WA 2F1RA 3KKPA 2QMOA 1Q20A 4N0DA 4JLKA 3PEYA 2O8DA 5DHFA 4C4PA 1F6BA 1IN5A 2J41A 4JBWA 3THOA 2RGAA 2W2TA 4PSVA 3B1VA 2X19A 1G19A 1WE2A 1YRBA 4C7OB 1DTSA 2RGXA 4PQFA 4HLUA 3AM1A 3CRW1 3W9YA 4C0HA 5JHGB 5E7IA 5FR2A 1GKUB 1N6KA 1Z0AA 1Z08A 5LDDC 1TQDA 3OE7D 4Q7MB 2GILA 2F9MA 2ODWA 2NG1A 1IXSB 1Z6TA 3LY5A 3SHFA 1H8ED 1OE0A 4QRHA 1ZD8A 2ZR0A 2WV9A 2WJYA 1W7AA 1P61B 1HQCA 1KKLA 4PC3A 2V9PA 1Z0JA 2IS4A 4GL2A 1W5SA 1FX0A 1E2DA 4B32A 1UADA 3B9PA 1US8A 3BB3A 2YVUA 4LDJA 4WXPA 4IW3B 1VMAA 1KMHA 1GSIA 3CR8A 3Q72A 4RZ2A 1OJLA 3R9XA 2HF8A 4Q66C 5IK2A 1ZW6A 4N1AA 3BOSA 1GVNB 2IC5A 1UF9A 2D3WA 2I1QA 3CPJB 3QKSB 3MSXA 2JAQA 4IHQA 1A7JA 1JJVA 1OHHA 2AL7A 1OHHD 3NBXX 3CRMA 2QM7A 5DGXA 1DOAA 2BIFA 5J4HA 4B2LA 2XAUA 3KB2A 5LPNA 3KX2A 2FU5C 4KYIB 1TMKA 3TH5A 2RB4A 1DAEA 2JJ2A 3NEJA 4ABYA 3A4MA 1NKTA 4Q4LA 2OBLA 3C14C 1M7GA 3GEIA 3ZZ0A 1H8EA 5KDDA 5D3QA 5JRZA 4A2WA 1AIPA 3AVYA 1XD8A 1Z29A 5JJIA 4LJ7A 3E1SA 4BFYA 1AKEA 2FN4A 1TPZA 4F7WA 3KQKA 4S35A 3LQQA 4POAA 3K9GA 3B1ZA 2RH5A 3CPEA 3PQCA 2NPIA 3RANA 3VMFA 1FZQA 5EZ5A 521PA 3RRMA 2FSHA 1N5KA 3M0EA 4L15A 3FMPB 4LBVA 4PAMA 3R8FA 2OT3B 2DFLA 4WVFA 1W49A 2J7PD 3MAAC 4Y0AA 2J0VA 5LD2B 4NYJR 3UG6A 4D26A 3M1IA 3KFVA 4GT1A 3WMEA 4A8JA 4DKXA 2JIZA 1WB9A 1KI4A 1P2UA 4H1UA 3TW8B 1Q3TA 3ZVRA 3QSYA 2GRJA 1SXJC 2WMOB 3B78A 2CJWB 4CIDA 4G5OA 1E6CA 3L8YA 2OFXA 4OK6A 4Q7KA 3ZJYA 4ZKDA 5EP4A 3IPXA 2FFBA 1Z3IX 4V0MA 1QHSA 4OHYA 3HJNA 5CB6A 3R7WB 2O8FB 2RGDA 3W3AA 2VL7A 1JB1A 5FBRB 4D0LB 2IS6A 1ZMXA 4BLSA 4J0QA 4R98A 3V4RA 2ZJOA 4TT3A 2VHQA 2WMNB 4C0QC 4UNRA 2FFQA 5G3YA 2EWVA 1G7TA 3AF3A 3NBZC 1P4SA 4TLEA 4GOXA 4W7SA 2OLJA 3AH8A 1J8YF 3K70B 5FUVA 1XX6A 2XEXA 3FTQA 3NKVA 4IVPA 1Z07A 3HDTA 3BIFA 1IM2A 3LBNA 5EE5B 1GG2A 1KSFX 1TQ2A 4A8JB 2ZYUX 1EK0A 1GNPA 2VA8A 3IHLA 3P4XA 3QKRA 2J5XA 4HATA 4Q9KA 1AN0A 4JSYA 1FX0B 1T91A 5FL7D 1RZ3A 3SNHA 3RLFA 2BV3A 2ERYA 4JLDA 3CW2A 1RRFA 5FTMA 4HAWA 1Z0FA 3OFND 3T1QA 4PSAA 1Q44A 4D25A 3OIVA 5J4VA 4GNKA 1S0UA 4KV9A 2QT1A 3EZFA 1OB2A 1NLYA 2VP9A 5FOVA 1WP9A 4JLJA 4ZCMA 4A92A 4Q9IA 3QE0A 2G6BA 4B3CA 1N0VC 1T0HB 2ZJ8A 4XSHA 3T5GA 2QSYA 4TL7A 2AHOA 4JJZA 4Q4JA 5CJ2A 5FOSA 1NKSA 2H17A 2GEDA 2QPTA 2BBSA 3TQFA 2OLKA 4KBFA 3K0CA 3U3MA 2V6JA 3IGFA 4IDQA 4JZKA 5CYPA 4MKGA 3M4YA 5JS8A 1E9AA 1W2HA 4LOAA 3EW9A 1XJCA 1N3BA 1EWRA 4D0GA 4QJ3A 4TMWA 1MABB 2CVFA 3GCGA 1WCV1 2RMKA 2KI5A 2WSSD 4Y0VA 2YOFA 3IBYA 5K8TA 1MH1A 4MRPA 1XXHA 4HI0E 1G8PA 2QENA 4TLDA 2QQEA 2O0KA 4XD7A 4TN1A 1N0UA 3AKEA 4ACAA 4LC0A 1TL7C 4DLXA 1UBCA 1LV7A 2WJJA 1XEXB 3K9HA 4QGFA 2I4IA 3Q5EA 2VSOA 4XH9B 4BQSA 3CH5A 2ZRCA 4DWJA 4NYMR 4Z51A 4JYCA 3CUEF 3AVXA 4FXPA 2HJVA 2P0EA 3QENA 1VYTA 3ZGXA 2J0SA 1G8GA 4DIDA 1DS6A 4P4TA 5J47A 4P4UA 2R62A 3WMFA 1C4OA 1X6VA 4D80A 1EFCA 1YZTA 2AK3A 4FW9A 1P75A 4I4LA 2BVNA 5C4MA 3DMDA 3U61B 4QHTA 2JLUA 1XFAA 4I1UA 1G21E 2W6JA 2PEYA 3DEFA 1ZUIA 4C30A 2P67A 3B13B 2GKSA 3WNBA 1E2PA 1KO5A 5JEDA 1OIXA 1A2BA 1HEIA 4Q4AB 4BUJA 2C03A 2G0NA 1KO7A 4WZBE 3VFDA 3NXSA 3MJHA 4LJ5A 3R7WA 2C9CA 1AKYA 1JQLB 1DE0A 1XJQA 3QEOA 3S1AB 4D6PA 2JLXA 4O3MA 1P9NA 2ZJZA 1QF9A 4DSTA 2IUSA 1QVAA 3RC8A 1XXHB 3MLEA 1OB5A 2GEUA 2KB0A 2QBYA 1ZU4A 2A5JA 2ZAOA 5L8VA 4RD0A 2WPDD 2GDJA 4W5JA 3T5DA 2R6AA 1N6HA 2F7SA 2VHUA 3CX6A 4AG6A 1E79D 4JS0A 2EU8A 1G3RA 2IYSA 1M6NA 3FMOB 4I1VA 5IF9A 2CE2X 1UEIA 4OHXA 1N6NA 4QXAA 1NG1A 1X8LA 2H16A 3O8CA 1TF2A 4M1SA 4OHZA 3SYLA 5L3RA 4JT4A 1KJYA 1NP6A 4KFUA 4AD8A 1W44A 2NO6A 3SDZA 4KHZA 1E9RA 1KJZA 1CF4A 1LB1B 1G1MA 1AJEA 1CR0A 3FKSD 1H8HA 3VR3A 3PUWA 5TY0A 3NH6A 2W2XA 5UKDA 4ZDWA 2QP9X 5CK5A 2QAJA 2WAYA 2ZRAA 5DI3A 3OESA 1E4VA 2WKPA 3S1AA 1ZU5A 5JMTA 4NCJA 1MR3F 1KK2A 2XB4A 4I1OA 4LJAA 2QTHA 3LAWA 4LV5B 4JLOA 3HYTA 3WXMA 1DADA 1GM5A 2ZETA 2O52A 3GLFA 2AWOA 1QG4A 2IF0A 4DIEA 4UQOA 3PEVA 4DCVA 2ZI5A 3DZ8A 4N3NA 3EIQA 5A5GA 4LBYA 2ZROA 3AVUA 4DCNA 5CIQA 3U6BA 1R8QA 1G16A 1ZP6A 3LVRE 3RS7A 2GNOA 4CEHA 1EGAA 1CRQA 2ZRDA 2Q21A 4IVQA 621PA 2B7BA 3GJ3A 1S8FA 5FL7A 1QDEA 3EPJA 2OESA 3C5HA 1COWD 3UWKA 3I5XA 2EVWX 1XEXA 2QROA 2EFDB 2FSGA 3K0EA 3MRSA 3OFNA 4IOMA 2IXGA 3KXLA 5A0FA 3WP0A 1NIPA 2KE5A 3K70D 4P33A 4MKIA 1EFRA 3ND8A 1EFRD 3NH9A 2XZOA 3K70C 3K0CC 4NPHA 2ZRMA 1XD9A 3IQWA 4DCSA 4PO8A 3QF7A 4EFMA 3R9WA 5FBWB 3EPKA 4MDEA 1HQYE 1OFTA 2B8TA 1JXMA 1NF3A 1EXMA 1R0YA 2WSMA 2XSZD 3ZS8A 5KTYA 4WBSA 1P2VA 4TZ0A 3RABA 4YXWA 3W8RA 1CJTC 1TEVA 2IEZA 4RD6A 3BK7A 3DKPA 2JLZA 1E96A 1VECA 4BLRA 4GP7A 1SULA 1RRPA 2DWQA 4M1YA 1WQ1R 2V7QD 3WRXC 4WXRA 2GXUA 1M2OB 2YC4C 5HPYB 1L4YA 1IN7A 4JLNA 4LYJA 3T1VA 3ADDA 2VSFA 4TYPA 1KI2A 3G0HA 2ZI4A 4XVQA 4RZ3A 1SXJB 3B82A 2J87A 1YR9A 3KL4A 3QBTA 1GL6A 4Q02A 1U94A 1YZLA 4KO8A 3CNLA 2ZRGA 2D7CA 4JIMA 1JEDA 5C18A 4URXR 4B43A 3VR5A 1KO8A 4A4DA 3TSWA 4NCKA 1F60A 3TQCA 1FMLA 3FKSA 4ZI3A 1CS4C 3MWYW 1N5IA 4DB4A 1YZUA 3L82B 2OE2A 2KJQA 4A0RA 3U4QA 3K9NA 3T34A 2IUUA 2D06A 2ZYTX 1AQUA 3Q7QA 1E32A 3QI2A 1HYQA 4KI0A 3FFBA 3F3YA 1P62B 2DPXA 4DLSA 2WJIA 1E0SA 4QBGB 1GOTA 1XF9A 2C5LA 4L8GA 3IIJA 2FJUA 3L0OA 4X8LA 1KKMA 4YMTA 4F4CA 5ELXA 4W5HA 4LHVA 2PLRA 2R2AA 3P4YA 2B6HA 2MMCA 3E70C 5FI0B 1OLOA 3EC1A 5KYKA 3LBIA 1Z2AA 2D74A 1BIFA 1ZNXA 3KQNA 2DCUA 3HU3A 2ERXA 1SXJA 4M22A 4AY2A 4PHTA 3O8DA 5JEEA 3KJIA 4A9AA 2BOVA 2ZITA 4G01B 2OAP1 1ZM3A 1IJEA 5DYIA 4B2PA 3AVVA 4BFVA 3R9IA 2JLRA 3GMTA 1Z06A 1CLUA 3KJEA 3TW4A 2HYDA 2DYKA 1COWA 3CZPA 1G7CA 3BWDD 4LZZA 3LW8A 4MITA 4BRUA 4DVGA 3EIEA 2CDNA 2YJTD 4OI4A 3WY9A 5D3MB 4QM7A 1NVXQ 3X1XA 1E1RA 3QF4B 4ZI2A 3ICQB 3TE6A 1W2GA 3JZMA 4G3XA 1KAGA 4Q47A 1W4RA 5JJKA 1UKVY 5L3VA 2PZEA 3ASYA 3KQUA 3ZVMA 4XOIA 5AUOB 4DSNA 1Q1EA 1OT3A 4FN5A 2RCNA 4M21A 5E4FA 2WVJA 3GFTA 2KBFA 2GJ8A 2BBOA 4MGIR 4R2HA 3LXRA 4Q18A 4B33A 4OI1A 2Q3FA 4PAOA 1T5LA 2FEMA 3GEEA 3UMRA 1D2NA 4FCTA 1JR3E 4BWYA 1YQTA 2GZAA 1LF0A 5EXSA 2AXPA 4NONA 1G4AE 1KMQA 2WWIA 4BASA 4NBSA 1ZIOA 3WNDA 3C4JA 2HXSA 2IXEA 1I2MA 1YZGA 2OO7A 1ZM9A 1JBKA 4TYYA 4F92B 3RS5A 2A3RA 4Q1AA 2O0HA 1VHLA 3C7KA 4LJ6A 2GAOA 3UK6A 3IUYA 4EFNA 1Q1QA 1R4AA 2F9LA 5B2ZA 2TMKA 1VG1A 5E95A 3H2YA 4Z8XA 2IYWA 2D7DA 2BCJQ 3AVOA 4UNNA 3Q7PA 1E98A 1LTQA 5KO2A 5H1YA 2JEOA 5FTNA 3ZLJA 4IXNA 2J3EA 4TQ9A 2XZPA 5EQTA 2WBLC 3AF0A 3AEZA 4TL9A 4B6EA 1PLJA 3HU1A 3CX7A 5FL3A 5AJZA 2P6UA 1P3JA 5KSOA 5BXQC 1H65A 5J4YA 3BH7A 4Q01A 1D2MA 4DLUA 4JLMA 5HZKA 1TAGA 5DIFA 2NO0A 1HT2E 3HYRA 4HUTA 1ZD1A 2GESA 5CK4A 1SGWA 4KU4A 1FP7A 1BYIA 2CHQA 3CIOA 2EFEB 1MKYA 4Z8YA 4M2LA 3EZ2A 3UATA 4L9WA 2CCJA 1R8SA 3T1OA 1KHTA 2GXQA 2R6GA 4M9SA 1TTTA 4LHWA 2N46A 2H8KA 3EC2A 5AJYA 4LCBA 4DBLC 1R2QA 1KI1A 5LBIA 1Z0IA 1TX4B 5SZJA 3TUIC 1KDPA 5IT5A 4D4MA 3EA0A 2ZRNA 1IHUA 2ZI9A 1LFDB 5CDFE 4KLNA 4MYHA 1EG7A 5KNCA 2OEPA 1UEJA 3AF1A 1GRNA 3RS0A 2AD1A 3KZ1E 4F93B 3I5YA 3LV8A 3I3SR 1W0JA 1XPUA 1W0JD 3PJRA 3T1TA 1R5BA 1EFTA 3TGPA 2FZLA 3I1FA 1T3SA 4TL6A 3WRYC 3SS8A 4P0TA 1KDTA 3AQ4A 2Z43A 4CRWB 2IL1A 4EJSC 1WDTA 2PX0A 1C1YA 3AF2A 2RGEA 2AKAB 1E9EA 1JR3A 1LS1A 3QF4A 1DG3A 4FD2A 3ADKA 1OYWA 4DT1A 1YZNA 3VHXA 5F9FA 1MT0A 1GKIA 4G5RA 2H18A 1AA9A 2BKUA 4MH0R 3TVDA 2OCPA 4DJTA 4EPRA 4B71A 4DCTA 1ZNWA 3ONWA 4XVUA 3LXXA 1SVSA 3IKJA 4D82A 1E2FA 1EFUA 3VU9A 1L7VC 2YV5A 2ZYWX 5CM9C 3PEWA 2F43A 2BKEA 2CLDX 4NE2A 2OHFA 3BBPA 1SKYE 3PVSA 1IN6A 5F2EA 1II8B 4KBGA 2GXAA 4B3FX 2JLVA 3E2IA 2PEZA 1ZVQA 4PXAA 1B23P 1VDZA 1DO2A 3B1WA 2FSFA 1VCIA 1Z28A 1XNJA 4JLPA 2OV2A 5H68A 4F91B 1QBKC 4FINA 4ESVA 1T9HA 3GLIA 1DELA 2X2EA 1MABA 3BORA 1PUIA 4PC2A 2H57A 2YC2C 3SU8A 4RVCA 1JPNA 4IDHA 1NVUQ 1UBEA 3UMFA 1AZTA 2JGNA 3GP8A 2A5YB 2IHBA 4B3GA 4CGZA 2AWNA 3HP1A 3VKGA 1KMHB 1SVMA 3CF6R 2CNWD 5TMPA 4BRWA 1DAFA 4DC9A 2EYQA 3AVQA 4MYUA 4A0FA 1RPZA 4U02A 2EW1A 3IO5A 4C0AC 1Z47A 3I8SA 2H5EA 3P27A 4M1MA 3UG7A 1HE1C 2FE4A 2O8EB 4IEEA 4AYTA 3RC3A 4LX0A 3GLGA 3LQRA 1UJ2A 1ZUHA 1KGDA 5KOYA 2XZLA 1YR8A 3RNLA 5A4JA 3OEED 5AUQA 1KI7A 2F43B 2XJ4A 5JI2E 4TZ6A 1GTVA 2JIZD 1UM8A 2J7KA 2X77A 3R8CA 1DAMA 5TARA 5FBVB 4DDWA 2HXYA 3BH0A 4MUAA 2PZGA 3U7FB 3HPQA 5B58C 4DDVA 2HJGA 1QRAA 1QHXA 2A5DA 3BS4A 1E0AA 3TVTA 4H1VA 2CK3D 4X8HA 2WWHA 3WYFA 4JBYA 2HCJB 1YRAA 4NTZA 3X1YA 4QKQA 3TR5A 2I3BA 3TIFA 2JJ8A 3CPHA 2O8CA 4P4SA 3AGPA 4RD3A 2HT6A 3FFAA 4V0ME 1FUKA 3DM9B 2QAGB 4QJ5A 2GJAA 1OYYA 5GJBA 2C04A 4FI3C 4Q1CA 3QJYA 5JHHB 4UXIA 1YZQA 2YOGA 4JJKA 2ODNA 5C2JB 2R8RA 2IYZA 2WKQA 3CH4B 2FEOA 3I32A 2ZJ2A 2C9OA 3BC1A 5LB4A 2CVHA 4QM6A 1CP2A 1XMSA 4V0NA 1GNQA 1OV4A 1Z8FA 2QORA 1G5PA 1SVWA 3R20A 4DUGA 2CE7A 2G88A 1F48A 2OCBA 4OI2A 3VNVA 3P32A 4TT3D 4AKGA 2RKOA 4L4UA 4PR0A 5SZIA 3N5CA 2XNDD 4OYHA 4OBEA 2BM1A 1S4QA 1GWNA 2KSQA 2ZRJA 3KXKA 4KXFB 1II9A 1G7RA 2WICA 2AN9A 2VF7A 2O8FA 1Z0KA 1QVRA 2OFWA 2X2FA 6Q21A 4LK2A 5FOXA 4AG5A 2FDCA 4PQRA 3GLFB 1II8A 3BERA 4RD4A 3QXCA 2O8CB 4P4SB 2ZAMA 1VPLA 1B0UA 5F98A 1W4AA 2GVDC 4HEJA 2QAGA 3FHTA 1EFHA 3N70A 3PUYA 1BO6A 3HR7A 4B75A 3QVUA 3KUCA 2JLSA 4CEHB 5BYJA 1RRGA 2AFHE 2P5SA 4NCHA 4V03A 1KOFA 2J59A 2FPLA 4PQYA 2W83A 1FW6A 3UANA 4E07A 3KFXA 2QA5A 2J7PA 5B57C 5L3SA 3EPHA 3CBQA 1NY5A 4MGYR 3AKCA 5B30A 2IX3A 4AI6A 1NN5A 4PO1A 4RFSB 5FBLB 4BE7B 4ZIRA 1XWIA 2HDNB 1FOEB 3QIAA 2B92A 4XTRA 3SBDA 3ETLA 4UNPA 4HB3A 1G6HA 3LVQE 2D4HA 2IYXA 4KVAA 1R6BX 4QFMA 4RZXA 4S2EA 1KDOA 3Q85A 4LJ8A 2QI9C 4GFDA 1R10A 2ZSFA 1I4LD 2F6RA 4KFTA 2YKGA 3NTUA 5AUPB 1EESA 2IK8A 1K5DA 2VSXA 4M1KA 4QBHA 3SN6A 3BFKA 4WW0A 3FWYA 2WIBA 3RS4A 2WWGA 2NMVA 5BN3A 3I8XA 4IRUB 5KU1A 1SVOA 2GJSA 4Q4JB 5CB8A 3U2QA 3L43A 1Z83A 1KI9A 1U2RA 3NBFA 2OBNA 4RKFA 4U00A 1E9FA 5HE9A 1HTWA 3OHMA 1P73A 1XTQA 2Q3MA 1E2KA 3K1JA 4D0NA 4Z1MD 4DEXA 1T5IA 4Z1MA 3RWOA 3F8TA 4DSOA 3NDBB 4PPGA 4TTRA 4US0R 1WBDA 3U3KA 2QP3A 4HAZA 4IXMA 1KTVA 2XNSA 1Z22A 5P21A 1T3LA 2YWFA 5AK0A 3VR1A 4A2PA 1W48A 2QRNA 4IFEA 3QOFA 1XP8A 4TTPA 5CLQA 4KLZA 1II0A 3DO6A 3AP2A 4ZDIA 2WOJA 1U0HC 4RFSA 1M8PA 5FTKA 3A1SA 4C0SA 4Q7JB 3QG5A 1KZ7B 2ZI6A 2ZRHA 3SJZA 4PHHA 1Y63A 4HLUC 4CEIA 3TLXA 1BH2A 3HU2A 4AWXA 4LI0A 2IXFA 3SQXA 1L2TA 2W0MA 2CLSA 4A1FA 4KFSA 4II7A 2LCFA 2C98A 4IEIA 4XD7D 2HYIC 2BWJA 2GK7A 1R7RA 2OXCA 1E2NA 2OSBA 2JJ1D 4OHWA 1Q21A 2A5GA 3TJZA 1JAHA 2EQBA 3HPRA 1N6OA 1QHIA 3CONA 421PA 4LJ9A 4JL8A 4C0BA 4CDGA 1NSFA 5HZHA 1XCGB 1XZPA 2Z4SA 1GL9B 4A6XA 1MO4A 2X1VA 3GLHB 1ZJ6A 1GFIA 3AF4A 4ARZB 1E79A 1DPFA 1N6PA 2HLDD 2QTVB 3BFXA 4ZO4A 5JFGA 3GLFE 3LLUA 1U0LA 2QBYB 1K6MA 2GZDA 2W00A 3X2SA 1A5TA 1SXJE 1TQ6A 2ZIAA 5EUQB 1P9WA 5KSZA 2H7VA 3CF2A 3QPVA 2FSIA 3WP1B 1RE0A 2ZSBA 2IT1A 5IDVA 3QEJA 3A6PC 1G6OA 3VHLB 3ZIAD 4CEIB 1G8FA 2XX3A 4UJ3A 4CZ2A 2BC9A 4MRRA 4IOLA 3VNUA 4M0LA 4E03A 2VP5A 4LHXA 5EJEA 4DB2A 5EP1A 1ZC4A 3TRFA 4YMWA 5G3ZA 2VH5R 1XXHE 1HH4A 4Q48A 3LFUA 4EIWA 2AFIE 3IHWA 1CR1A 4V0LA 3EWSA 4ITRC 1JECA 2ATVA 2QAGC 2AK2A 3NBYC 4IDPA 2BMDA 4Q1BA 3UWOA 1F2TA 1NRJB 4URZR 1XMJA 2RGCA 1W46A 3Q9LA 5DI3B 2W6JD 1RIFA 2CHGA 2WTUA 3F0TA 3EXAA 3A4LA 2IWRA 1KK0A 2BCGY 4FMCB 4DLTA 1IBRA 2PL3A 3K0AA 5TXGA 1OIVA 4UXJA 3SYNA 4R9UC 2V55B 3CX8A 2ONKA 1Z5ZA 5DLQC 1D6JA 3B1XA 4IOJA 1N5JA 3BH6A 3TKLA 1DG1G 3KKNA 3B9QA 2VP6A 5FFMA 2LKCA 2MSCB 3REFA 2RHDA 1LY1A 1OFUX 4RD1A 4HAVA 2Q9CA 4AC9A 4NH0A 4PZZA 1ZUNB 1Q0UA 1NJGA 2FNAA 2KBEA 5EUMA 4URUR 5EXXA 4QJ4A 1UAAA 2PX3A 4DLRA 3GJ6A 3WBJA 1E1QA 2RGBA 3O8RA 3ADBA 4WZ6A 1VYUA 3PXGA 5LB2A 1UKYA 4PC6A 4UJ5A 4DDTA 1ZNZA 4O0MA 3SJCA 1G20E 3EWAA 3KDSE 4LWZA 4A0HA 4ERNA 1QHYA 3WNCA 5FR1A 1GDDA 4GPTA 2WJGA 4PTLA 4MRNA 1UBFA 1IXZA 4BZPA 2DWOA 3KXIA 4TMZA 4EDHA 4JVMA 3QXXA 5GJVC 2O0JA 2YNMA 2NPFA 1JJ7A 3AVWA 1ZD9A 4Q9LA 3TAUA 4KODA 1U9IA 1YU9A 2Z5FA 3U44A 4EPXA 1OH5A 1W0KD 1DARA 1FNMA 4TMKA 1M34E 1X1SA 1AGRA 2A5FA 4HLQB 4IOKA 5JI3E 2ZRKA 1CEEA 1NN0A 4ASUD 2NQ2C 5FOTA 4QHSA 1KAOA 1HA3A 3WHLA 2C2HA 1N0WA 2QG6A 3I61A 1Z63A 1E2JA 1PVOA 5CLLA 3KKMA 3ZQJA 2F1IA 3O8BA 4M1TA 3W3ZB 2GHIA 3K0FB 1G3UA 3GQBA 4ARZA 2YHSA 1GNRA 4YDHB 1F3OA 2WWYA 3BE4A 5GJWC 2OFOA 2PMDA 3TUZC 2QY9A 1TADA 1YKSA 2QPAA 4PHFA 3FKQA 5EP3A 5L3QB 1XDBA 4O25A 2R9VA 3EPLA 2YZ2A 4QNMA 1DEKA 4NCIA 3BB1A 1YVDA 4Q7LA 4BLPA 4ON9A 4B34A 3OF5A 4PC1A 1KYIA 2WM9B 3DHWC 1HURA 2JLQA 1ZRHA 4QC2A 5J5CA 2ZQ5A 2CK3A 2G77B 2ATXA 3CO5A 3FHCB 1P72A 3U4QB 1IOZA 4LJYA 3IILA 2ORIA 3DL0A 1X3SA 1FFHA 1G3IA 3QNUA 4M53A 2DFNA 3ZQ6A 3TSOA 1W4CA 4YXWD 2ZRPA 1KIMA 5KUTA 5CYOA 4TLAA 3P26A 2CL6X 1YHNA 1R5NA 2IA5A 3N2EA 1W1WA 1GKYA 3VU9B 2R65A 3VR4A 3I72A 1AGPA 2Q3HA 1E69A 1EX6A 5JLJA 1S2MA 4MQBA 4HLCA 3PENA 2CXXA 2GA8A 3K0FA 3OAAD 1XTJA 3K0AB 4EPTA 2ZE5A 721PA 2ZJBA 4QNRA 3KUDA 4K46A 1GP2A 1KNXA 4PPQA 2ZI7A 2ZVPX 4K81B 5SZKB 2G3YA 3CR7A 3DM5A 3KB1A 1XMIA 4CEJA 1Q22A 3WMGA 4PHGA 4PFSA 3ZH9B 2GCOA 3K0SA 2PCLA 3QQ5A 4BGDA 2DHRA 5D3MA 3WHKA 2CEAA 3A1WA 4NHOA 4XIGS 4JKIA 4DLWA 1S3GA 3X1WA 2XGJA 2IBMA 1AS3A 4FIDA 3U3RA 4DSUA 2W0SA 4GBMA 3LD9A 1BMFD 3AVPA 1KI8A 2UZIR 2WOOA 4R7ZA 2ZRIA 4YDSA 2ZRBA 5KDLA 2O8EA 1E2EA 3SHWA 2ZR7A 4OHVA 3GLGB 2WWFA 3P20A 2ODBA 1DAGA 2CMKA 3REGA 2QRZA 3DOEA 3OAAA 1WF3A 3KJHA 4ACBA 3JZAA 1X8KA 1OPXA 2ZSEA 2D2EA 4LPSA 1P5ZB 5TDHA 1W36B 4E09A 4HSEA 1UDXA 1P6XA 2Z0MA 4Q1EA 2HEIA 1U90A 4R2IA 2GBLA 3JVVA 3QXSA 4MGKR 1W5TA 4JBXA 1VCOA 4GOJA 1Z6YA 1FMJA 1OFHA 4C2UA 3NHBA 5DO9A 3ZIAA 1V5WA 2WJVA 2ANBA 2QGZA 3L2OB 5AJVB 2C9YA 3H86A 4TQAA 5F3WB 3NC0C 2GJ9A 1BS1A 1P2TA 1GRRA 1CJKC 4M9ZA 4XWKA 4QGHA 4YMSA 3EIHA 2ZU6A 3QG1A 1Q3HA 1ZIPA 3KJGA 1P9RA 2EFHB 2VEDA 5EE0A 4NKRA 1S9HA 4L5BA 4DHEA 2A2ZA 4YONB 3DDCA 2V1XA 4FMDB 4L16A 2NO7A 1G9XA 2VPPA 4HUQA 4EFLA 2ONJA 4JMPA 1N5LA 1IQPA 4G5SA 2XTMA 2XXAB 2CHVA 3LNCA 5JWRA 1DAIA 5LD2C 2FWRA 3SR0A 4WAUA 2REOA 2N1BA 3NIBA 5KNDA 3GLHE 5FPHA 4B73A 2J1LA 4TWZA 3KQLA 1CRPA 1KK3A 2OUKA 4TMVA 3EAQA 2ZREA 1P2SA 3PEUA 3PITA 3ZZUA 4CT4B 3MCAA 3AP1A 4A15A 3PG5A 4QGAA 4A82A 2ZEJA 2EWWA 4BLQA 1G17A 3BGWA 3FHOA 1IY2A 4Q1DA 5EE9A 3W6PA 1CJUC 1LVGA 2IYQA 2VQSA 5DSZA 1NMXA 1S1MA 2W6IA 2J46A 2ZXUA 2W58A 1E4YA 1XCPA 2VRWA 2VP0A 1R5OA 4BEBA 3SFVA 3K9LA 1ESMA 2J0UB 4BLOA 1W36C 4IDOA 1TEXA 2ORVA 2C96A 3U3JA 2BDTA 3EZ7A 1T0JB 2XTNA 4Q1FA 3K09C 3EARA 3QY0A 5DHAA 2G1JA 3MMPA 3NVAA 1UFQA 3ZDQA 2FA9A 3QXJA 4C0LA 3KQHA 3RHFA 1MO3A 3E5HA 4HB0A 3GEHA 4CEJB 2ZM5A 2XXAA 4NZYA 3MJRA 2BJVA 3GD7A 4TYNA 2J0QA 1RVDA 1QHHA 1FUUA 2VLIA 5FPYA 4MRVA 5L3SB 1BOFA 1ELOA 3CWQA 5DYGA 5SZHB 3D6TB 1SKQA 4IVRA 2UVQA 3MWKA 4DT1B 4PO9A 4WA7A 4ZIRB 1FPMA 4DCUA 2RGGA 2HCBA 3CNOA 5JWHA 4DXAA 4NYMQ 1XEWX 2GAAA 4OKSA 3PFIA 4QGGA 4YQFA 1SKYB 5BN4A 2C77A 3SOPA 2IUTA 2MSDB 2HT1A 1KI6B 1NN1A 4CVNA 2VHJA 4RCZA 4DLYA 3AB3A 2WKRA 1K5GA 3TR0A 3THWB 4QHYA 1KSGA 4D81A 821PA 2BBWA 4I81A 2YWGA 5FTLA 2CLCX 3RSLA 1XTRA 3DKVA 3FMFA 1OF1A 1N6IA 2RGNA 3NHAA 4EQ6B 1N2CE 1SVKA 1XTSA 4QBIA 2IS1A 2UKDA 2IWHA 1OXSC 3V4FA 3GJ8A 3C16C 2AR7A 1XCMA 1E99A 5CIWA 2DFKB 2ZE7A 4DRZA 3GLIB 1S96A 2BM0A 5HKKD 1FTSA 4ZCIA 3BD9A 5G53C 4AYXA 1OW3B 2ZPTX 5JSZA 4LV6A 4LJ4A 2EFGA 2A9KA 2NO1A 2GF9A 1MO6A 3TUJC 1VCNA 1UDWA 1N25A 1NL3A 3RYTC 3I73A 4X8OA 2Q9BA 2ZSAA 2G83A 4IDNA 4Q00A 3W34A 4BZXA 4ZDKA 3FOZA 1FQKA 1T4GA 3FVQA 1KI3A 5DISB 1G3QA 3C8UA 2A7QA 3MUFA 3T15A 3LDAA 1CTQA 4ZDJA 2FZ4A 2OILA 2VP2A 4BZQA 2E1RA 3FB4A 2P5TB 2ZRFA 4LY6A 1KSHA 3OZXA 2QPOA 4H9GA 1G64A 2PBRA 4JL6A 3VTKA 4NCNA 3CF0A 4C9BA 1V43A 2P65A 2WJHA 5DH9A 4AIIA 3IIKA 1MOZA 4BFSA 3IQXA 3Q3JB 5JS7A 1T8UA 1F2UA 5IHPA 2UZ3A 2WWWA 1GIAA 3THYA 221PA 4URWR 1VG8A 1J8MF 2QN6A 4RY2A 1RJ9B 4JVLA 5G40A 1I2DA 1KO4A 4M9QA 3ZYCA 5E7MA 3THXA 3RVBA 1OKKA 3L8ZA 2ZS9A 1JXOA 2FOLA 3AVTA 3PR1A 4PPNA 1AQYA 2YWEA 5JSZB 5K8IA 2J0UA 4Q21A 4GDFA 1MV5A 3K09A 1NG9A 5EE3A 5C1BA 1YZKA 2QMUA 3JVUA 1T6NA 1WMSA 1NLFA 3RAPR 1WXQA 3RRYA 4X8MA 1Q57A 2J45A 1KK1A 2D62A 1M7BA 2C78A 3B85A 5FTJA 4Q5IA 4PZLA 3B2EA 3LW7A 3SBEA 4JKYA 3CLVA 1OH7A 2SHKA 1E1RD 4EKDA 4L9SA 5HCNA 1XD2B 3BXZA 4B35A 5AJXA 2AD5A 2OBMA 4N0EA 3UXMA 4DDUA 2QL6A 1AK2A 3I92A 4KSBA 5FH9A 5FUXA 1ZCAA 2YOHA 3C15C 4PC7A 1DO0A 1E9CA 4B3XA 1JQJC 3ICEA 4HDOB 4NYJQ 1IY1A 1E9SA 4JLVA 5JCZA 3T12A 4OQMA 1A82A 1F2UB 1KO1A 2GJKA 1OKKD 1GILA 1SXJD 3DVLA 1CBUA 4PAQA 3THWA 1UBGA 1F2TB 2GTPA 1PUJA 2HF9A 3HR8A 4DLZA 4KJZA 3THXB 5KPJA 2QQ0A 3IEUA 1A1VA 4RCYA 2ORWA 4U5XA 1MO5A 3CZQA 3RRZA 1IXRC 4LC1A 1U98A 1XU4A 4UXHA 1CU1A 4A0GA 2IYYA 5H70A 4GMXA 4US1R 1TF5A 4NP6A 4P32A 3SJBA 4GRAA 1E3MA 2FPKA 1GITA 4MA4A 2FG5A 1Z6GA 2XTZA 1AS2A 3A1UA 4UNQA 2JDIA 4LHZA 2QP4A 1NN3A 3BAFA 2GVZC 1H8HD 3U5ZB 1KY2A 2DWPA 4FMDF 3LRPA 4JSTA 4BFTA 4PANA 4NYIR 5KHOC 2IYRA 3ADCA 1RYHA 3AUYA 3TSZA 3D3QA 5IK2D 2YYZA 1EX7A 1Y3AA 1W4BA 5FOUA 4HAXA 2DFTA 5FI1B 3MWLA 2FMXA 4EPWA 4KVGA 3TNFA 3D7MA 1ZC3A 4W5WA 4NL4H 2R6DA 1ODFA 1Z6AA 3U7HB 1NSTA 4YLGA 4MKFA 4JLBA 4OQFA 4YMUA 4DUGD 5HTKA 1RW4A 1CULC 5JJLA 1BYUA 3IO3A 4LBZA 3DOFA 4OJKA 3KTAB 4CF7A 2BEKA 4HZUA 3U44B 3A36A 1E2IA 1YJ5A 1O87A 3T61A 5DE3A 1YE8A 1NI3A 2VBCA 3QKTA 4RD2A 1S3SA 2ANCA 1RJ9A 2OAQ1 2FGJA 1VIAA 1GZSA 2JJ1A 1KDRA 2F1HA 2H1LA 1KY3A 1VG9B 4P31A 2PJZA 2ZI3A 1ETUA 2KWIA 1ZBDA 2GWHA 3LO5A 3SYKA 3BB4A 1VHTA 5HE8A 1NLZA 3CRVA 5FPTA 1JR6A 5C46F 5KSPA 1RKBA 1FP6A 2ZUCA 1TU4A 4RZUA 4U7DA 5M04A 1U8ZA 4A36A 2DB3A 1M74A 4LYFA 2B7CA 4DZZA 1VIYA 3ASZA 3L0PA 3A1VA 4OQXA 5TVKA 3LH5A 2RHMA 1JPJA 4AK9A 4LUCA 3C5CA 5K8LA 5F9HA 1XD2A 4B48A 3D8BA 4EAQA 5JRJA 3VKHA 2BBTA 1DAHA 1T3HA 4Q03A 2Z4RA 2WZQA 1Z6XA 3GJXC 4QBFA 1UKZA 5GADl 2QE7D 1IN8A 1QG2A 2ODEA 4A2QA 1O3YA 2P2LA 4BFZA 5BYKA 1E2LA 2WSSA 4TLBA 4FMCF 5JECA 4OQNA 3FGNA 3ZZTA 1R0ZA 3SZRA 2GZHA 4M9XA 4GSYA 1TUEA 1AS0A 1S9DA 2ZS7A 4TMXA 1NVVQ 5FOWA 3KKOA 3W8NA 2GETA 3EZ6A 5JBQA 1G291 5CJPA 3TMKA 3GLHA 4QG7A 1SQ5A 3FYHA 3MD0A 2EFCB 2FPMA 3CRQA 1N6LA 2Y8EA 1LNZA 4D2IA 4MKHA 1P7CA 1KZGB 4F4JA 1J90A 4I99A 4XWAA 1I4DD 1XB2A 4HDCA 1R0XA 3TK1A 4HLDA 4O2RA 2IYLD 4C2TA 2GCOB 1W0KA 2G1KA 3PV0A 4M1WA 4V02A 3ZD7A 1YR6A 1XEWY 4W9MC 2XNDA 1DAKA 1D9ZA 1QHGA 2R44A 2R6FA 3OEHA 5H8WA 2ZRLA 1U9IC 1XMVA 5EXPA 5HKKA 2O8BA 2QGNA 4B6FA 2FFAA 1ZCBA 3SI7A 1XPOA 4B2IA 2PJRA 1TU3A 4IFBA 4PSKA 2GK6A 5KSYA 3SE0A 1CR4A 4IJMA 1E2GA 5DN6D 5IRCD 2R6CA 1J7KA 3F5FA 4KFRA 5AUNB 3GJ5A 5KDOA 2P3SA 1ZNYA 2ZE8A 4RKEA 3KTAA 4EUNA 2EYUA 1IY0A 1G7SA 1XZQA 2QE7A 3NEYA 5E7JA 4OK3A 3ND9A 2W6ID 1JI0A 1S1CA 2FH5B 3Q8XB 1E2HA 3PUZA 2RAPA 4HYYA 2PT5A 5BN5A 1TUIA 5DNYB 2CL7X 4JVNA 5E3HA 1XTKA 2NO9A 2C8VA 2QSZA 4B44A 2GXSA 2QT0A 3QXHA 4GP6A 2OZEA 2RGNC 1K8RA 1KNQA 3GLIE 1ZM2A 5KNBA 3MG9A 1E9BA 1YR7A 2QMEA 4E5UA 2K5UA 2IS2A 4KITB 2ZVQX 2ZUDA 3CWZA 3FE2A 1D9XA 2YINC 4GI7A 2VYFA 2O8BB 1OIWA 2OG2A 4FCVA 3TAHA 1M7HA 2JLYA 4AKHA 4A8JC 2IW3A 3LBHA 4JL5A 2ECKA 4Q4AA 3VX3A 3AV0B 1HE8B 4B47A 1ANKA 2E9SA 4OQLA 3OEHD 4OL0A 1L4UA 1E9DA 1NY6A 1Q1BA 1FTNA 1HT1E 5ANRB 1U8YA 4R71A 4M1OA 3WBKA 2FV8A 2N42A 4D4KA 1IAQA 5K8UA 3CB4A 4CW7A 1LF5A 3GJ7A 2F55A 1FQJA 1G41A 1NIJA 3OIYA 2V8OA 1L8QA 1BKDR 1WRBA 3A1TA 3FDIA 1G8HA 2NTYC 3GFOA 2A30A 4CT5A 4HB4A 1BMFA 3VR6A 4TL8A 1FNNA 2W2VA 1OH8A 2FGKA 5DI9A 1NVVR 1T8TA 3DMNA 2V4ZA 1NBMD 2JCSA 3OIUA 3G5UA 2REXB 4XJXA 3W5IA 2NZ8A 1SHKA 1TQ4A 5L3QA 2XB2A 1A4RA 3EA5A 3QKUA 3T06B 4HAYA 1PLLA 1XJ0A 3X1DA 4BPBA 1E94E 2NIPA 5J40A 2F3TA 1KSJA 3PIRA 2Q6TA 1CJVC 4GOKA 4QOSA 2CCKA 4DLVA 3RSOA 4NYIQ 3W6OA 3U60B 3A58B 4LGMA 2QU8A 3NWJA 3SC3A 2REBA 3WYAA 3V9PA 2A78A 1PJRA 2XOKA 5FBQB 4D4LA 4ZCLA 3U7GA 2PZFA 4NU0A 2PH1A 2JLWA 5JZVA 1GAJA 1KI6A 2LKDA 2DR3A 3IIMA 5FUYA 4P3YA 3A37A 3GJ4A 4MDFA 3K53A 4ESHA 2ZE6A 2LWIA 3AUXA 3VX4A 3B6EA 1GL7A 2BMJA 4FWTA 2MSEB 2H92A 4KSCA 1LW7A 1M1YE 2IYTA 5TV2A 1MRSA 3QKRB 3CRRA 3L0SA 1RC8A 1QHNA 5EP2A 2NGRA 3QPWA 3IDQA 4Z54A 5JCPA 4MGZR 3OIWA 2YWHA 1I4TD 1VTKA 1G8YA 3VQTA 2VHTA 3W5JA 2GBLC 3LLMA 1WBBA 2OM2A 3ECCA 4TYQA 2MMGA 1X1RA 3B8HA 2O5VA 3PUXA 3J81k 2ZUBA 1VCMA 1XRJA 1ZINA 2V6IA 3VAAA 1G5RA 3A8TA 1E0KA 3OE7A 4ASUA 2WIAA 5TB5A 1E2QA 4XWOA 4JYBA 2QUZA 2XJ9A 2GF0A 2ZU0C 4G5QA 3I4LA 4UNSA 3H4MA 1OH6A 1Q12A 5CDFA 1ESNA 1LS6A 4NDZA 3HWSA 3P1JA 1XTIA 3CNNA 4HB2A 1DVRA 4MUBA 1NVWQ 4BLTA 3SQWA 3CKLA 3KKQA 2ZANA 4A6PA 4BEJA 1C9KA 1DBSA 1JEEA 4WZAE 3ZVLA 1ZAKA 3H0KA 4TMTA 4IKEA 4TTQA 4AKEA 4HZIA 3THYB 3GLGE 1Z0DA 2P6NA 3UKDA 2BHRA 2IF2A 4QL3A 3RRNA 3GFPA 3B7GA 2VF8A 2AKYA 1GUAA 4JLAA 2NOAA 4KAXA 2CL0X 1XEFA 4LSGA 3MFYA 2ZS8A 2DY1A 4LPKA 4XVRA 3W6NA 4Q4HA 5EZ6B 3Q5DA 3H1TA 2C95A 5G41A 1IONA 2FF7A 1D8TA 1ZYUA 3T35A 2F1JA 4TQUS 1IJFA 2ZR9A 4GZLA 2QNRA 1TF7A 2XOKD 1SHZA 2V7QA 4HUQB 1AM4D 3GPLA 2Q0HA 3OEEA 2QTFA 2G0TA 4B3DA 2XSZA 4AKIA 4AYWA 4F38A 4US2R 3I62A 1UKEA 2CBZA 2VIIA 3BRWD 1W47A 3FMIA 4NMMA 3QVVA 2PLFA 5HR5A 4FCWA 3U6KA 2VHCA 4PX9A 4RJLA 1CR2A 3PUVA 2GEVA 1HV8A 3QUSA 5FUWA 1Z2CA 2AXNA 1R0WA 3K8YA 3NG1A 5C4GB 1U81A 4B3BA 3RS2A 2FX3A 2E87A 3QBVA 2WPDA 3B5JA 3AGQA 3CM0A 2BEJA 2ZJAA 4V0KA 4URYR 1RYFA 1JNYA 3AKYA 3QPUA 4JVSB 1VG0B 2PMKA 4RSGA 4MYCA 4TSFA 2G9NA 2V1UA 2ASEA 3V00A 4YMVA 4E22A 1NMYA 2ZTSA 3IPYA 1JR3D 1SVIA 2BMFA 2FFHA 1OXUA 2Z83A 4XTCS 2Z6VA 3WYGA 1HY3A 2ZYVX 3EZ9A 8OHMA 5FPKA 5KPDA 4DEYA 3H84A 2IEYA 4GMDA 5J4LA 3IBGA 4Q9HA 4V0OA 1VKJA 4FWIB 3FPAA 1GRQA 2ZSDA 1NBMA 2I1VB 2Q9AA 5BQ5A 3SEAA 5AJWA 4LRWA 1G3MA 1KJWA 3AP3A 3U3OA 2GCNA 1A2KC 1OXXK 4OJQA 4Q19A 4B74A 1N6RA 2IYVA 2QZ4A 1X8JA 4G0NA 3ZS9A 2PT7A 2IHYA 3BFVA 5BW8A 3SJAA 1XBTA 3PCRB 2L0XA 2D2FA 4ZV4A 2O8DB 1E0JA 1SVLA 1QHHB 1Q1ZA 3LWNA 4MRSA 1PLKA 2HV8A 2OXRA 1CKEA 3MWJA 1CJMA 1SZPA 4C7OA 1ONBA 1ZM7A 2V54A 2ZJ5A 3MGCA 1F5NA 4BECA 121PA 4YC7A 4MYTA 2QMHA 1G4UR 3UIEA 5FPSA 2C99A 1J99A 4K8OA 1E2MA 1WA5A 2ZJYA 4WOPA 3U7EB 2QM8A 4D4JA 1D2EA 2VO1A 5AR1A 5BWMA 4UKDA 3IEVA 4EPVA 1P60A 3UPUA 3L0IB 1W36D 2CNWA 3EG5A 5B64A 4HZUB 2V3CC 1TNDA 5J4KA 1ZM4A 4EQ6A 1VYVA 2X8AA
chains in the Genus database with same CATH superfamily
1SXHA 3KK0A 1HLPA 4G97A 4GZMA 5DBOA 1H94A 1WMEA 1FE8A 1E4EB 4GGPA 3GI1A 1YJ8A 1RNLA 1VGRA 1E1QD 4HWSA 5B1HA 4F4IA 2R84A 4B45A 2IOHA 3U81A 2C7RA 1NNEA 4YJ3A 4D0SA 3B36A 5ECWA 3MHPA 1V3TA 2GAIA 4GWLA 3D4IA 4B6JA 3DW1X 1ZLYA 4BNLA 3H8JA 4KQKA 3S2EA 2J6CA 3Q12A 2HBYA 1PYDA 4MWGA 4HQFA 4D42A 4Z4IA 3OIGA 2P69A 3NBKA 1UPTA 1IY9A 1PZXA 4HYQA 2I6SA 2FEAA 2FG7C 3JWHA 3JYOA 3O4IA 4OOEA 3QVJA 4DQUA 3ABQB 5IUNC 2XCUA 4RDCA 3A4NA 2A67A 1TLFA 2PKRA 3BMCA 1JKFA 2HJ9A 5E38A 5IBCA 3PCTA 4XIFA 3PLAE 2VYND 3U4MA 2BJWA 3A11A 4LFBB 3CNQS 1D4ZA 2GSDA 3H1BA 4LVNA 4TSFD 1Y5NA 5EIBD 2AX4A 2JKZA 1E18A 2CCGA 1OXVA 1FXSA 1MRNA 1NDUA 1PGJA 1X42A 3HMQA 3LJKA 4PPFA 4RFVA 3VPAA 1OFIA 3VJKA 1AZSC 1B41A 2OCYC 5IC5A 4PE5B 4PU0A 1QZZA 4REQA 3VKVA 4AFNA 4J0EA 3F2IA 4AZ3A 2VRNA 3QVKA 3D4BA 2IH2A 1P81A 3N0XA 3UMSA 1JALA 4DA4A 1X86B 2EKLA 1OYOA 1GR1A 1JHPA 1G20A 1PYGA 2Z8YA 1G21B 2VTVA 2CVQA 3DZKA 3LGAA 4NFSA 4BFXA 3ZD6A 1RC8A 1QF6A 5IBPA 3TPCA 1VPWA 2B5WA 2VJMA 3EULA 4MMZB 1E1YA 1Z15A 2PX6A 2I2FA 3UF0A 2QMQA 3UQZA 1HQDA 4BMXA 4UHFA 3OQIB 1RRCA 4AS3A 5GVRA 4RJKA 1DKNA 2HMTA 1JFLA 4YRPA 3IUSA 5K0SA 1NQWA 2NZJA 2Q2QA 3ZJUA 1ORVA 1U99A 1N92A 3CEAA 3U1BA 1US8B 3VR2A 4F71A 2C9ZA 2JJ2D 4DXHA 2UUOA 1X1CA 5JH7A 3WB2A 2C2BA 4LF5B 2JJMA 1Q92A 3LPAA 2JDID 3N2IA 3P2JA 2JATA 3OH8A 4R2WA 4LYAA 4QGBA 4ATNA 3RSFA 1ZGAA 4BWFB 3NO4A 1XL0A 2FN8A 3R09A 4GZ5A 3OSUA 1JAIA 2HBRA 2J9RA 4B6PA 4UC0A 1NJFA 3QKSA 2NUBA 4BVFA 5IM4A 3X1ZA 1Z5GA 1CY4A 3NIGB 3OCWA 1IWOA 3WGUA 4DRYA 1OXMA 2C1ZA 2F8MA 2AMYA 5DOVA 2B8WA 2IQIA 2B2CA 2OQIA 3KKPA 3PFWO 4LE2A 1BGVA 4DAOA 4EY7A 1QCYA 1ORIA 4N0DA 2BKVA 1XHEA 2FTKE 1OZHA 3H7IA 1D2RA 4JLKA 1DGQA 4C4PA 2J41A 4RMGA 2RJOA 2YIVX 3OQMA 1JSXA 2AG6A 3KXPA 3KSBC 2X19A 3N2YA 1WE2A 1XTTA 4C14A 3NHWA 4FHZA 4E2ZA 3EWNA 4MARA 1DTSA 1QGOA 4PQFA 1PNOA 1SIWA 2I67A 3G79A 2JZOA 4ERXA 2PT6A 1KJNA 3UJ6A 1QYRA 3HVJA 1U7XA 1HDEA 1N1GA 3NETA 1QONA 4K1LA 3RFUA 3TE7A 1GKUB 1N6KA 4JC4A 5JHGB 1PHRA 2AMLA 2ZZKA 3CUSA 2F9MA 4BIMA 1A77A 1GTL1 1HNNA 1IXSB 1Z6TA 2H07A 5L3ZA 3EGDB 4QRHA 3SSOA 1ZD8A 2O06A 3NALA 3CVUA 1T0IA 2CLIB 1PJTA 5T5QA 1XROA 2IS4A 3JQAA 4GL2A 2YXNA 1DKQA 1FX0A 3O93A 2SCUB 3P0FA 3CH6A 4B32A 1X8XA 1A8QA 1LC3A 1US8A 2J5KA 2YVUA 3D6UA 4S1VA 5ELLA 5KKCA 3IMCA 4CLXA 5ISMA 3QFSA 2C2MA 3IB6A 1ATZA 1E3DA 3R9XA 2HF8A 4Q66C 1ZW6A 3NPAA 2POQX 5DGIA 1U8XX 2QJFA 1M2GA 3BOSA 2O2XA 2RGUA 3QKSB 3CPJB 1EUDA 3ESDA 4E11A 1GTZA 1UWLA 3L9WA 4EEZA 1PEDA 3OZTA 3FYCA 4DCGA 2I4NA 2H2DA 5IDXA 3NBXX 3U4GA 1MMFB 1UWKA 3HRKA 3JQ7B 2BIFA 2PKCA 5J4HA 4DBVO 3H9JA 4B2LA 4B3RB 5KSWB 1K6EA 2CUKA 2NV2B 3KOXA 3AUKA 3KB2A 4ZEVA 5LPNA 2DPHA 3L77A 2FU5C 2GBFA 4KYIB 3TH5A 3WLMA 1KEEB 4TWAA 2WP0A 1DAEA 4XR9A 3GHHA 1M7GA 2OHJA 3GEIA 1XRRA 1PEAA 1PD1A 2PUJA 4I5FA 5AI0A 1SA0B 4CNQA 4S1PA 1XD8A 5JJIA 1XTUA 2BR3A 3E1SA 3FZNA 3WAKA 1PZEA 1UPFA 4QBTA 1TPZA 2QXYA 4KYUA 3LPLA 4U7WA 5ILQA 1KE1A 3UOGA 2E4VA 4F7WA 3IDFA 1JHZA 3K9GA 1JFVA 1NUHA 2R47A 3CV3A 3CPEA 3G6WA 5MFPA 2NPIA 3VMFA 5KX5B 3GUYA 1GXSB 2FWIA 1IQ0A 3W3AD 5HJ7A 1J00A 1N5KA 3DW3X 3N8HA 1TYDE 3NYWA 1E3TA 3R8FA 4OJMX 2OT3B 2OK7A 4WVFA 2XWBF 2AS0A 4GSLA 4JX9A 2J0VA 4E5DA 5LD2B 2WU4A 4HEA1 1Z17A 2HA3A 1BCRA 1W6RA 2C29D 3C8MA 3T54A 1M0WA 3ZC3A 3H8WA 1H6CA 3VTFA 4G5YA 4XIYA 1Q3TA 1XA0A 3CYFA 3DZCA 3I23A 4IX1A 1GL3A 3C97A 3OKAA 1CUEA 1N7JA 2GRJA 1FFXB 1M1NA 1SXJC 4HGRA 2CJWB 3UCXA 4Z3DA 1L7OA 3A9TA 1PR1A 1Y0BA 2CHUA 3IAHA 3K2IA 1XC7A 4FHCA 3V7WA 1E6CA 4CIDA 1SNYA 4YMGA 4DQXA 3ILSA 4UW9A 5EP4A 1UDRA 3FPJA 5HILA 1QIGA 2HRBA 1Z3IX 4V0MA 1QHSA 4OHYA 4MV3A 4S1WA 3BE5A 3FOWA 4WZBB 3RJ5A 1GYPA 5MN6A 2O8FB 1ZCZA 2RGWA 3V3TA 1DX4A 1JB1A 1U2GC 3H6KA 4TLMB 2PLWA 4D0LB 4DLLA 1Y42X 4B81A 3BA6A 1Q7EA 3N3AC 1S4MA 2WMNB 5FCDA 4C0QC 4EMBA 1V5EA 3JAKA 4Z4QA 4W7SA 4PINA 4HMPA 1ZN8A 5JAIA 4FLMA 3EG9A 3AH8A 4TRRA 1RHJA 1UJCA 4X84A 3GCXA 2H06A 4J7CA 1GQYA 1QP8A 3UYLA 4BYMA 4M9CA 1T4CB 3NM5A 3NKVA 4IVPA 3JR7A 1Z07A 3ILXA 3LT0A 2FWNA 1GG2A 4DIKA 1SBNE 1TJNA 1ULAA 2I7TA 2ST1A 4H16A 2VA8A 1U4NA 5HJ2A 1CETA 4I4TF 1WXEA 4QT0A 2HLPA 1OZFA 1RZ3A 3SNHA 3HN2A 2DEUA 2NSLA 2WU8A 2ERYA 2O14A 4V3CA 5DDIP 4QA9A 5CH3A 5ELMA 3KR2A 3VVBA 4HAWA 3T1QA 1BQ3A 2DECA 4ZC8A 3FCUB 1QGYA 3MAJA 1XP5A 2BI8A 2H7CA 3OIVA 5E7QA 2BHNA 1IAVA 4TVBA 1EI9A 4P7JA 4HTFA 3ZQKA 4DGSA 1AKQA 4I5DA 1NLYA 3FNBA 1ULTA 1WP9A 3HHPA 2H9YA 1I1NA 4A92A 1F0YA 1I7PA 4GI5A 4H1TA 4Q9IA 4QVGA 4ZCMA 3EYWA 4JBLA 1BX1A 3T5GA 3ZCTA 4QODA 3ZV3A 2UU9B 4RYDA 3WWPA 5DXJA 2RJ3A 5BN3B 3M9LA 4HJRA 5AKXA 3H7AA 3EJWA 1X7XB 1CY1A 1NKSA 4Q93A 1YNOA 2QPTA 3W5UA 5B2FA 4ARVA 2V6JA 4ZHQA 3IGFA 2PXAA 3WLFA 1RLTA 2WF9A 3HKCA 3CUTA 4LOAA 3EW9A 3FVTA 4NMLA 4R9NA 2A94A 1N3BA 2RB5A 2HV9A 4QJ3A 2CVFA 1V5IA 3GCGA 1WCV1 2RMKA 4ZVOA 1X1QA 2WSSD 1JMVA 3T3NA 1QUEA 2IOFK 5HS6A 2VDMB 1XXHA 1DCTA 4TLDA 2QQEA 2O0KA 2OR3A 4HS9A 4TN1A 1KQFA 3AKEA 4LC0A 2DHDA 4DLXA 1UBCA 2X42A 4QGFA 2I4IA 4KQWA 4NBVA 1H5NA 2VSOA 3EVBA 3CW9A 4YJFB 4BQSA 3WIVA 1J0AA 2ZRCA 5H9WA 2C88A 3K94A 1EK2A 3W9SA 3OZAA 3AVXA 1YAJA 1M33A 4FXPA 2PX2A 3QENA 3ZGXA 4LECA 5KVAA 3A1DA 4DIDA 1V11A 3G2OA 2B3DA 2ISCA 2OGWA 3PVCA 2GPJA 4FFLA 4P4TA 5J47A 2OL4A 2F8TA 1EFCA 2ZB8A 3OA0A 1JG4A 1YZTA 3JRXA 2BI7A 5EA2A 1SB9A 5C4MA 2BVNA 3HCWA 5LQKA 2JLUA 3KFLA 5AW6A 2ZSIA 1SKUA 1ZUIA 1PR9A 3GVCA 5IU6A 2P67A 1JVBA 2XUOA 3MT0A 2UXDB 1V39A 3OM0A 2F4VB 4L1KA 4KLAA 4N7RA 4BUJA 1QM5A 1L3BA 4FIZA 4YNBA 2H8GA 1KO7A 3Q8WA 10MHA 1RJFA 3JPYA 4YAFA 1LUAA 4G85A 3TEMA 1ILWA 3R7WA 3S1AB 1SUDA 1XJQA 4BNZA 1SQ6A 3TM4A 4NENB 1JU4A 4PNZA 1Y4ZA 5L4SA 1BCSB 2FK8A 2QUBA 4DSTA 3ES9A 1GKLA 2VZ8A 4G25A 1SURA 2FEPA 2FW1A 4NXNB 3RC8A 5HBRA 1XXHB 1TZCA 2KB0A 3B70A 1OB5A 2PGOA 2QW0X 3PKIA 3SLGA 3A6FA 3AR6A 5C4IA 2RFLA 3M1AA 4LX8A 3VOAA 4W5JA 3T5DA 1H2AS 3ZLTA 1I1QB 4YRBA 3IP9A 3UJ3X 1EVJA 1V7ZA 4HDMA 1D1QA 1P2DA 1RQPA 4AG6A 4JS0A 2EU8A 1P1CA 1JTFA 1M6NA 3ACBA 2CE2X 2HOQA 1EDBA 4DR3B 4QXAA 4UU1A 5FB3A 1IN1A 1GZDA 1YRQA 4J49A 1M2HA 1TF2A 3A05A 4LRUA 4M1SA 5K3FB 3SYLA 3WJ2A 2I03A 1KJYA 3G6KA 1ECCA 1DQNA 2BP7B 4F11A 4FNMA 1SK9A 4L4YA 1R4ZA 3TIVA 3KUKA 5C8YF 4MV6A 4L57A 5EJ2A 2R79A 3TGWA 5HKAA 2QZJA 1NQVA 3E9RA 1WXWA 2QJTA 5JU6A 3O4RA 1WTCA 3L8FA 2YNMD 1MOSA 1JDSA 3TI7A 3PUWA 3TQOA 1GJRA 1QFSA 2IV2X 4HN9A 4ZQGA 1DIOB 3VZQA 3D8HA 2CSXA 3FTCA 5GOTA 4MCHA 5CT9A 3S1AA 2ET6A 1CUAA 2JHPA 2C59A 4CXMA 5L45A 1XLTC 4QXQA 2XB4A 3PPYA 1IDOA 2DVMA 1WU8A 2W8ZA 2YH2A 2GKGA 4CIWA 3D6JA 4JLOA 2D2IA 3LBFA 2FHPA 1JEQA 1T26A 4WBNA 4BNTA 3GLFA 3QVSA 1PJZA 2IF0A 1GFWA 3STWA 3ORYA 1A7AA 4DUPA 3AM3A 3OVMA 3OUUA 2ZI5A 1TKAA 2FN7A 2W2LD 3EIQA 4LBYA 4N3NA 4HNHA 3ZN2A 3QX7A 3UFBA 3O4JA 1TMOA 1YNSA 3FETA 4LCEA 2GNOA 2MHCA 5NLLA 3C48A 1TTHA 1AKTA 1OREA 2HDOA 3ZE9A 2J3LA 3PP8A 4WWHA 3W9UA 4IVQA 1L9KA 2CJYA 1TJYA 2WEKA 4KJXA 4LXTA 3RG2A 2IOYA 3NWOA 4JITA 4ND5A 5GONB 3SIWA 5FL7A 1NBOA 1ZL0A 2Q45A 3G5MA 1KC1A 3C5HA 4TKZA 3EPJA 5B1YA 3UWKA 4BUCA 3KU1A 4NSNA 3OX1A 2FSGA 2HN9A 2AG1A 2DTDA 2QROA 3EIFA 3HWRA 3MRSA 5CT5A 1XPRA 5BRJA 5CVTA 2XVXA 3FTDA 4JCCA 2EZ8A 4L3OA 3QJGA 4X41A 3ZZNA 4DUZB 1CUWA 1FMCA 4MKIA 4MWOA 5JADA 2NZ2A 4JI3B 2XZOA 3T41A 3CN9A 1KOGA 3C6KA 1E6WA 3C6XA 1KQGA 1WETA 1R88A 1GQOA 3MINA 4EFMA 2AYZA 3RYHB 1DMSA 1L5YA 3R9WA 1GNVA 1HQYE 1NF3A 4NZ9A 1R0YA 3ZS8A 2C82A 4TZ0A 1EVQA 4YXWA 3CVYA 3A9SA 4E32A 4ESEA 1TEVA 2IEZA 2Q50A 3BIXA 3E82A 5FDFA 1Y8RA 3DMPA 3IAUA 2WF5A 3KT3A 1E96A 2WJ4A 1SPXA 1C8VB 1H3FA 4Z0NA 4MJ7A 1IHYA 1I9CA 2PRKA 2V7QD 2WTMA 3WWEA 1NUSA 2GXUA 4RIHA 2C7VA 4WA8A 1AY0A 3OLCX 5IAOA 1CC1S 1QIFA 2I6GA 1EVYA 2GHRA 1EVIA 1KI2A 2MIIA 3PLNA 2ZI4A 3BL6A 3TMAA 3G0HA 4RZ3A 2A9QA 3B82A 2FW6A 1HE5A 2J87A 3D6MA 4TWBA 3KL4A 4KMOA 2FUKA 3BXHA 1P9OA 3P9NA 4FYWA 4IDCA 1QRRA 1U94A 3JQBA 1XRLA 3BXOA 4Q02A 2C3MA 4KO8A 1H69A 5AKLA 5IVDA 4BDSA 1SXPA 1NBAA 2ZRGA 3F3MA 3QMWA 4JIMA 1C9JA 1JEDA 5C18A 1VMEA 5LCXA 1AF4A 4I3HA 3FRIA 1BHO1 1SOMA 3QVTA 1RJDA 3TSWA 3KYDA 4NCKA 5ESWA 1WSAA 4RENA 5K5EA 3O2SB 3TQCA 1UDAA 4FDAA 1KBOA 3FKSA 4A8TA 4KIFA 5JPIA 3MWYW 1N5IA 2PWPA 4MR8A 5BSFA 3I9KA 2OE2A 2KJQA 1BMQA 3S7ZA 1EZZA 3VR4H 4P5DA 1ZRNA 1WSBA 3T34A 1YRYE 5HMMA 1T6BY 1U04A 3Q7QA 4DANA 4GC5A 3L04A 2WJWA 5JS2A 3WYBA 4B8YA 3QYPA 5LUAA 1CF9A 1EUQA 3VO2A 5M7EA 1NVMB 2Q99A 1P7YA 2VATA 1E0SA 4EI9A 5IXSA 2HMUA 2VDVE 1JPVA 3KEQA 4N54A 2FJUA 3CLUD 3L0OA 2V97A 5KYYA 2YV4A 2KW5A 5ELXA 3UMBA 4LHVA 2OB1A 2PLRA 5KTSA 2YJ5A 2MMCA 1O5IA 2ERCA 2X2OA 3EC1A 3H4TA 3PX2A 2D74A 1P2GA 4WN9A 1ZNXA 4MIYA 2PX5A 2QN3A 3L1UA 2QTMA 4HJXA 4DR6B 2XNJA 4M22A 4AQDA 4AN1A 3HN6A 5JEEA 3GDWA 1JZQA 4A9AA 1BVUA 1G8JA 2IDJA 3V97A 1JDTA 5C5EA 1ZM3A 5DYIA 5LOVB 5DHTA 3GK3A 2Y0PA 3GMTA 1Z06A 4BRUA 3BWDD 1ULHA 2AFHA 2FLKA 3F5MA 3N53A 1GN8A 4GLLA 4FGKA 5TPZA 3UAVA 8LDHA 4G0VA 4AX4A 3RSQA 2YJTD 1JDUA 1KEZA 1T9CA 3A1NA 1FYFA 2A58A 2ZBVA 3AERB 4JUIA 4KIUA 3IP6A 3U9TA 4ZI7B 3GHYA 1C9DB 1SUCA 1KAGA 1P7VA 1DDIA 1IC6A 2J9FB 4Q47A 1FUYB 4ALMA 1GTG1 3ASYA 5L3VA 3ZVMA 5ALKA 2X4IA 1B73A 4M21A 2RCNA 3LQFA 1HM5A 4QEKA 3VR4D 5AQ1A 4XWYA 1P80A 3GFTA 2GJ8A 1TUGA 5EY5B 9MHTA 1RJGA 3NTOA 4J94A 4OIMA 3D8TA 4IS2A 4XRRA 5EZSA 3WNQA 2HHCA 4B33A 1XWWA 1PGOA 1RYMA 3HABA 3MTEA 1IUKA 1ZICA 3EOAI 5C53B 3GARA 1ISIA 1RDFA 3UMRA 2YXLA 1D2NA 3UWMA 4FCTA 1YQTA 5KNDH 1AXGA 5KOJB 4B6OA 2A1TR 4R8SA 1LF0A 1AF7A 2AXPA 2DUUA 3JAWB 3FUTA 2J32A 3H97A 3ZWDA 4HS4A 5C3UA 2WWIA 3UV3A 3KYBA 2HRRA 1NT2A 3DBLB 3C4JA 3HA5A 4JLWA 5FWAA 3WNDA 3E61A 5EJMA 2IXEA 3S5JA 4U6SA 3V8EA 4WOCA 4FILA 4XLTA 1BN7A 4F92B 1O89A 4WTOA 4CU5A 2Z1DA 4RKYA 3U7JA 5GM2A 5KMGB 3BBLA 1TEZA 3D4PA 1NVGA 2QY6A 4LJ6A 2I7XA 4KO4S 1ECLA 1U7HA 4OMFG 1VG1A 3U49A 5E95A 3JZFA 4Z8XA 3WIEA 2D7DA 4G67A 4RF2A 2C57A 3H1PA 1BA2A 3E5MA 3JQ6A 3JVIA 5KO2A 4TSKA 1R9MA 3OZUA 3P19A 3SE7A 2HWUA 3K6RA 1AVTA 3ETJA 5HFJA 4D45A 1PK8A 3TS1A 4LY0A 4J4BA 5CW2A 4ND6A 3AF0A 3MQ2A 3GRCA 1PLJA 1UXGA 3HCBA 3CX7A 2C2XA 3HSKA 4QDKA 4W5NA 1J23A 1WNFA 2HJRA 2P6UA 4ALJA 5BQFA 3ZJ4A 1H2WA 3DR5A 3LT1A 5AI5A 3G9XA 3PC6A 4COOA 1C0KA 2H2FA 5BN1A 3QEBZ 1SG0A 4Z9XA 2NO0A 2EARA 3HYRA 4GYWA 4N65A 4HUTA 2GESA 3AYXB 1JPUA 3PZBA 1DSSG 4C20A 2XOXA 2QTZA 1XZAA 3PC8A 2VF4X 3NW9A 1PW5A 5ADHA 1MKYA 3EXEB 5CIYA 2ZJ4A 2V74B 3ZDFA 3T1OA 2X6QA 4NG5A 3R0VA 2R6GA 4OSEA 3OQPA 4M9SA 4MQ6A 4Q4CA 1ND6A 2P4HX 3QE3A 1Y7HA 2AVDA 4DY4A 2HMYB 2E85A 3EDCA 4O5AA 3RK0A 5SZJA 1Z0IA 4C4AA 5B7PA 5KJEA 1UBTS 9ATCA 1KH3A 5ARBA 4RQAA 3CH7A 2OV1A 2ID4A 4H3KB 1U8EA 4EB6B 4ZYYA 2OEPA 1NE7A 4M0UA 1GRNA 3LTEA 2AD1A 3KZ1E 4IDGA 4CF3A 2GZ3A 2F2TA 3ZCUA 1W0JA 4DV1B 1W0JD 4KGXA 5AW2A 2FZLA 4CIXA 2VJMB 3I1FA 4ZOAA 1SC4A 3GXOA 3JALA 1L8OA 1T3SA 4U39A 1DV1A 1GZUA 3OQIA 3WRYC 3ZCVA 4EY5A 3M49A 5ES3A 3HH8A 1CRPA 3WIBA 1S2IA 4P81A 1AV7A 1Q6ZA 2RC6A 2EKPA 4OB6A 1WDTA 5T4FA 3T5CA 4AN0A 4BNDA 4CRWB 1C1YA 2O8NA 2V7UA 3KU4A 4ROTA 1OXBB 3Q3HA 3S2FA 3QF4A 1DG3A 4AJPA 5F9FA 4Q3DA 1HYGA 5ALSA 1VMDA 3VHXA 3G23A 3G3EA 3HUFA 4FEGA 1OX4A 4XIJA 3G8DA 3RVLA 3VGJA 1ZNWA 1H6DA 3EXEA 4FFMA 1ODLA 1UXOA 1W1IA 3V1NA 1K8QA 2VZ9A 2PSFA 3DNFA 4C6RA 1T8PA 4D82A 3ZDYB 1PFQA 1EFUA 4MUHA 2YV5A 3TLMA 4ER5A 4EX7A 4YAKA 2G0AA 1MENA 1RJWA 3HDGA 5A62A 4DR1B 5AESA 2OHFA 2PE5A 1Y89A 2OP1A 3HS3A 1S8OA 1SKYE 4QOEA 3AB8A 4JP1A 3U0VA 3H75A 1NRWA 4B3FX 2E55A 2PEZA 4YUXA 4GPZA 1ZVQA 1VDZA 3V8RA 4PBSA 4UOQA 1ZN2A 4ZFNA 3B1WA 3HDQA 4MPRA 2FSFA 3AFHA 2JD0A 2F59A 3BQNB 1Z8HA 1QBKC 4M6WB 5E9JA 5PGMA 3TIGA 5IT0A 4RTOA 4U7GA 5IUKC 3A4IA 3H5LA 4U3JA 5JPCA 1MABA 3BORA 3IT3A 5M34A 2PKQP 2YC2C 3SU8A 2Q1SA 5E0KB 4Y98A 4JEUA 5LL6P 3KXDA 2X1HA 2A59A 1NVUQ 1UBEA 3DLCA 4MULA 5HJ5A 1JHMA 1PFUA 2A5YB 2IHBA 4GXRA 2V5VA 2AWNA 3HP1A 3VKGA 1KMHB 5CLGA 3VHXB 2R6JA 4BRWA 4Z3KA 1ABBA 1V35A 3UA3A 1K88A 1Z4OA 3T52A 4A0FA 1QRUA 3Q7SA 4O1MA 3AJAA 3ELUA 4EG4A 4WOJA 3NJ4A 4B3SB 5H4HA 4M1MA 1EUDB 2FE4A 3AW8A 3WBFA 1XU9A 1Y7PA 4AWBA 2B8EA 1IXYA 4PLWA 3LQRA 1Z5OA 3WAJA 3EH2A 4EF5A 2N75A 2JKVA 4PYNA 1TYBE 3HY6A 3STUA 3CXRA 2VNIA 5A4JA 2B20A 4QULA 1JEAA 1KI7A 5JI2E 1YGYA 2X3FA 5EG5A 3JQEA 1RKUA 2YYYA 1I7SB 2Q0SA 5DNDA 1TECE 2X77A 4AAYA 5F33A 2BE7A 3I0MA 4CF5A 2VDNB 2HXYA 2INGX 3BH0A 4EJ0A 3X1MA 2L42A 3BRCA 4OHKA 1CE8A 3HB9A 4PXSA 3U7FB 3EF3A 2FWPA 1P17A 4Y9UA 2W71A 2OM6A 3UT0A 4DDKA 2VUHB 2WW8A 3BS4A 2DUNA 4M6WA 4WE3A 1MPTA 1RQGA 4PIPA 2PH5A 3KKEA 5I01A 2QT9A 2O0LA 1XVUA 3B3QA 3PFNA 1A71A 3MELA 3W79A 1QB7A 1J5PA 1YRAA 4NTZA 4QKQA 1FFEA 5AW1A 3FN4A 2RIPA 1OT5A 4NVRA 2K4MA 3LMKA 3T3DA 1KWKA 4S12A 1THTA 2CV0A 1JXQA 4JMLA 1CQIA 2HHHB 2MINA 2O57A 1CUDA 4KN6A 2PGAA 2GJAA 1OYYA 5ALIA 1I13A 4FI3C 1DT3A 4EUEA 3C3DA 3QJYA 4K9OA 4QEZA 3PQ8A 1X80A 4X63A 5JHHB 3MLAA 4J1SA 4PYMA 3SJUA 2J6HA 1Z2DA 3P9SA 4JJKA 5LWHA 2FEOA 1QQTA 3DQPA 2ZJ2A 2VJYA 1U2SA 2FQ1A 2JI9A 3DWEX 3IURA 3QBJA 3L8CA 3QFHA 2FEXA 4JOQA 4R9RA 2G67A 3ICWA 3IYLW 3HDJA 3F73A 4MPPA 4K6FA 3ZOZA 5HOEA 4DMUB 1G5PA 3R20A 4DUGA 3ABZA 1SUWA 1WO8A 2FSPA 2G88A 1KVUA 2XYHA 3LPNA 3ODPA 3R3UA 3UOAB 2O1WA 5FF9A 3NASA 5JZ9A 2PGNA 4QOJA 2YY7A 5DBIA 3AW9A 4IIDA 1L4MA 3P32A 3IDOA 4FNGA 4D97A 2RKOA 4F6RA 1OGYA 2VQFB 5EI5A 1YVPA 5SZIA 4M1EA 2XNDD 3MJSA 1P0IA 2QVGA 1C30B 2PK3A 4NV1A 3MMSA 1S4QA 1GWNA 2DCMA 1KMCA 3LECA 3TCXB 4BP1A 2NNLD 4FFPA 4R4JA 4IAOA 4IHJF 3UPTA 3D6FA 1Z0KA 2O8FA 3BJZA 3F6PA 1T8RA 4LK2A 1D2AA 4J6FA 2VJOA 1J0DA 4HQOA 2ZSKA 4PQRA 4NAUA 1W5AA 3Q41A 5CH5A 2J5BA 3P0IA 3QXCA 2O8CB 3B6IA 1O94D 4KWCA 1CZKA 5MGNA 2HPZA 2ZRQA 2IYPA 4GOOD 4PO3X 4MYRA 3A1CA 3QYAA 1QP7A 3SKVA 2W8BA 2OOKA 5IAEA 2B1QA 3A9RA 3SSAA 2XB9A 3KS9A 4UD2A 4NFHA 4BN4A 4CEHB 2AFHE 4WXYB 5DWQA 2EZ4A 5K1ZA 1KOFA 2I3GA 3GLVA 4LVOA 3DFUA 4KEAA 5ALZA 3RBXA 2HF2A 4XX0B 1SIBE 1L5MA 1N2EA 3MTGA 4F4UA 4K26A 3WGVA 5JARA 1FW6A 1P1IA 3K73O 2QA5A 1I0IA 5L3SA 4BNGA 5IBQA 3CBQA 4UUNA 1KZ1A 4PWYA 3AKCA 4N48A 2XVAA 1QIKA 1AN9A 4GICA 1CQPA 4I1IA 4X85A 1NPTO 2GTIA 1XWIA 2HDNB 1FOEB 2XUGA 3IUNA 2HREA 4XDGA 4EZBA 4KB5A 1YR2A 4UNPA 2ASVA 3MILA 2D4HA 2GM9A 3CRZA 5LWQA 4B0PA 2YASA 4KVAA 2EG9A 3F7MA 2DQ4A 3OCZA 4P2BA 2PXXA 1CIVA 3E7WA 1FRVA 3GFSA 4QFMA 1KDOA 2YHAA 2ID7A 4RZXA 1N5OX 4TVOA 4Z4EA 4NQZA 2LP4Y 3KB8A 4XB2A 2Q5FA 1C29B 5AUPB 3QBEA 4YACA 2BFPA 4UDXX 4BO2A 5D51S 2IK8A 1K5DA 1E5XA 2XEDA 2YWDA 3SN6A 3BFKA 3FWYA 2WWGA 1FBTA 3T0IA 5JBNA 3IOYA 1DDOA 1FXUA 2GJSA 1YS7A 3IJPA 4L5JA 4ZAVA 4NK5A 2Q28A 5G4KB 1CJSA 1APBA 1U2RA 2AYXA 4Y9SA 1F7VA 3NBFA 2OBNA 4RKFA 4OREX 3ODGA 4DDMA 1SCUB 3OHMA 1Z4PX 2Q3MA 2JIMA 3K1JA 4NEQA 3QE9Y 2GF2A 4UTNA 1A98A 2CFRA 3F8TA 5B4UA 2H2WA 2ZW9A 3OUZA 4ES6A 3ITEA 4F5DA 5HGXA 4PPGA 5TC4A 5F4ZA 1NJSA 2YBEA 2V59A 3RGWS 2OZKA 4DYHA 2J3QA 3CLHA 3I9MA 1ZESA 4IXMA 4YY3B 5FBKA 3VR1A 4CL0A 4UHDA 3LLCA 1QYWA 2O7NA 4CHTA 4DQVA 4EFDA 2ECQA 3GUUA 4TTPA 3OTOB 2I5PO 1T6YA 3LCRA 2CXNA 2RONA 3FUVA 4ZDIA 2WOJA 2QUKA 5A7GA 1LBEA 1JAXA 1J07A 3AUTA 4RPCA 3A1SA 5FTKA 4C0SA 4Q7JB 1LGYA 3JQQA 2EF1A 1H0RA 1K7SN 3SJZA 2NP7A 2ZRHA 4RXUA 4PHHA 3TW0A 2ZVDA 3CCCA 3LQYA 3R5FA 2FXIA 5A3VA 2NPOA 3S3TA 2IXFA 4KN5A 4S05A 4G0PA 4OG2A 3CSSA 2O2EA 1YI0A 1N3LA 1IMOA 2HTEA 4H6XA 4CM4A 5JD6A 1YR3A 2IPNA 2VNKA 3VYVA 1YF3A 3A6LA 4CLRB 4IEIA 4QTYA 1PQ4A 1Q1AA 2Y1LA 3AR7A 2HYIC 2BWJA 3LUBA 3UWPA 2GK7A 2PZAA 1IE3A 3CW8X 3AR9A 4HNRA 5KKAA 3FDZB 2EGHA 1Q21A 4LYYA 3TJZA 3DTTA 1IG0A 1QDUA 1N6OA 3T0GA 1QHIA 1SCUA 4AJ4A 1TQ8A 3KG2A 421PA 3SC2A 2FP4A 4C0BA 3DDUA 1NYRA 5DFAA 5HZHA 4FBLA 2NV0A 1GL9B 2Z4SA 3M5DA 4NENA 1G60A 2DQYA 1QK4A 4ARZB 4HADA 2ICAA 1DPFA 1OLUB 2YN0A 3H16A 1U1CA 5JFGA 4OGKA 3T7TA 1L6RA 3I12A 2QBYB 1K6MA 4EY8A 3JQAD 2YDXA 4UD6A 5KSZA 2P8SA 3VR2D 3CF2A 3L6UA 1JG7A 2WD9A 3L40A 1N1MA 2FSIA 5ALMA 2D00A 3OIFA 4XXHA 1R64A 5DYWA 4QUKA 3MT9A 5DU2A 2D0IA 1PRYA 3USZA 1I4OA 3NOQA 4J4HA 3IT1A 5HF5A 4CEIB 2XX3A 1EK5A 3EYAA 5H82A 2HIHA 6CHYA 4CZ2A 5AW8A 4HH3C 2EF0A 4IOLA 2WFZA 4E03A 3IPCA 1FU8A 2VP5A 4S0ZA 4CKEB 3KBOA 4BB0A 3O84A 3EEFA 1LPPA 1XT6A 4V0RA 5LZ7A 3A4TA 1CX9B 3TRFA 3P45A 5HOQA 1XXHE 3UY4A 3LY8A 4QSHA 3BWBA 4HDAA 2YJ4A 3KZMA 1KJJA 3EWSA 3PHCA 3NBYC 1KDZA 2HQOA 4IDPA 4LQ4A 2ZWAA 1PE0A 3UWOA 1F2TA 4BB9A 3G9QA 1E1MA 2RGCA 1ORDA 5I7RA 2CHGA 4F8YA 1O6ZA 1KVSA 1N75A 3A4LA 5I8PA 2JW5A 1ISHA 3KOUA 5AJHA 2ETVA 4DLTA 3W2GA 4QPZA 4GI3A 2CBGA 3BZBA 4UXJA 2FQWA 3H0CA 4JUDX 3CX8A 1LK7A 2ONKA 4MQ5A 4YFYA 4IOJA 4YPFA 3SBOA 3IE1A 5IYZA 5ALLA 5IXYA 2VP6A 2B2XA 5FFMA 4IKOA 4GF5A 2WYOA 3IAM6 1LLDA 3O9ZA 3ED5A 1JG3A 3GBPA 4HAVA 3TQSA 4AC9A 1TYEB 3GNLA 3QUQA 4NH0A 1K4MA 5EXXA 3F46A 2JBHA 3F6YA 1FZTA 4QLOA 1UAAA 1E5TA 2BGNA 3DNPA 1VJDA 2BEWA 2R7AA 4R0VA 4UOZA 5E3JA 4ZOQI 3FNQA 3H5TA 5K0EA 1YFLA 1GA6A 4M89A 3FPGA 4EB3A 3ZWBA 2P6MA 3N2ZB 4DDTA 3STXA 4DZRA 2WSYB 4QECA 3UV6A 3RANA 2WB2A 4MW9A 2GD2A 3G8YA 4ETIA 4U8GA 1RMYA 3H5AA 3NP9A 5C8ZA 3U31A 4KR6A 4NPCA 3Q6IA 4QTTB 1PEKE 1QHYA 4RUKA 3DMHA 5HKBA 1UC8A 1XCLA 4GBED 3E9EA 4EG6A 4GPTA 2BTQA 2FJPA 5JNSA 5JZMA 3MF4A 5AW5A 3VNAA 3M81A 4NU8X 1BU5A 5EGNA 2JFHA 3TXYA 5GJVC 2P1DA 2I9KA 1E3IA 2X13A 2NPFA 2PS1A 3B6JA 3OE5A 5EKDA 3TAUA 3D5QA 4KODA 1U9IA 1YU9A 1EDZA 2FEWB 1B6GA 3SVZA 4AO7A 4Z3OA 3U44A 1W0KD 2GNPA 1HR0B 1NI5A 3ZLVA 3ZWPA 2IP1A 2NVBA 3PDWA 1REQA 3FPFA 1X1SA 3HWWA 2A5FA 4HLQB 5JI3E 2PL5A 5AK6A 4BTLA 2OV8A 1CY2A 5JMOA 4O59O 4ASUD 3FYUA 4QHSA 1EINA 5AI4A 5E9WA 1KAOA 3IR5A 1ZI6A 4PSCA 4RJIA 2JIOA 4YJKA 4ND7A 1EFLA 1RLOA 1N0WA 2C2HA 2QG6A 2VRCD 1M2OA 1GR0A 4P7GA 5FT9A 1PSWA 4KR9A 2QWXA 3KKMA 3R6LA 5CLLA 1Y48E 4E5YA 4D8YA 1BFUA 2GUGA 3CGWA 4HDRA 3ZV7A 3GQBA 2IODA 4BEVA 1LI7A 3TD9A 1GNRA 4YDHB 5EESA 1X13A 3RUCA 3AFIA 4Z2AA 4V2IA 3V4SA 5LLDA 1XDBA 3WOVA 3UBTA 4RIGA 3LL4A 2YZ2A 4QPJC 1P2FA 4KGDA 3V8NA 4E21A 5HXAA 1DEKA 3Q0TA 3L7AA 4QQKA 2I65A 3QM1A 4PY2A 4ZZ3A 4BLPA 2LIVA 3DT8A 4B34A 5AM1A 1I3CA 3HA2A 5TF0A 3ABRB 1KYIA 2JLQA 1EJ2A 1KS2A 4AJEA 1I2AA 4LISA 3AR8A 2WHPA 3C0KA 3AEUB 4KRXA 1JJFA 2ATXA 3CO5A 5COQA 2F8LA 3WJAA 3S8EA 1GN9A 1N34B 3DO8A 3FWPA 4B9EA 3EIUA 1X7YB 2VUTA 2Q2NA 3A6HA 1G3IA 3QNUA 4M53A 2DFNA 3HCCA 2PS0A 4ZAFA 3QEMB 1KIMA 3K8QA 1M34B 1MZVA 4G86A 4TLAA 2E89A 2ZT6A 2CL6X 1REQB 3D4LA 3OU6A 3T5AA 1R5NA 3N2EA 1P3Y1 4QQFA 2M1ZA 1GKYA 1KYVA