1HURA

Human adp-ribosylation factor 1 complexed with gdp, full length non-myristoylated
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
180
structure length
180
Chain Sequence
GNIFANLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLSNQLRNQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN ADP-RIBOSYLATION FACTOR 1
publication title Structure of the human ADP-ribosylation factor 1 complexed with GDP.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 51
structure length 180
sequence length 180
chains with identical sequence B
ec nomenclature
pdb deposition date 1995-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00025 Arf ADP-ribosylation factor family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1hurA00
2ZE5A 2NZ8A 4UXHA 5GVSA 4NTZA 5HZHA 4P4UA 3U3KA 2NO0A 4X8HA 1G20E 4DCNA 4KFUA 3HDTA 4IKEA 4W5WA 2JLRA 3EZ7A 3V4RA 3ZQJA 4GOKA 4A0FA 2ECKA 4NH0A 1W49A 2ZXUA 1U9IC 4DXAA 2OEPA 2PCJA 3B1ZA 2AKYA 2JDID 3IEVA 2EFDB 3PVSA 4LJ5A 2YINC 1NVUQ 5EUQB 3THXB 2ZJOA 5TXGA 3PQCA 3VAAA 1XXHB 4XWAA 1N5IA 2YVUA 4CVNA 2C96A 1VCOA 3AVOA 2LWIA 2WV9A 2REBA 1KO7A 2F6RA 4GFDA 1QHSA 2A5YB 3E2IA 4MGZR 2VLIA 4PHFA 4KODA 4OBEA 5GJWC 4Z54A 3W5IA 4LHVA 2XEXA 3T12A 3UATA 4IVQA 5GVRA 2W83A 2FEMA 2PZEA 3CZQA 3ADKA 3ND9A 2A5DA 5J47A 2ORVA 3MWJA 1E1QD 5CK4A 4HYYA 4V0MA 1E69A 5EUMA 1GDDA 2AWNA 3NH9A 1OYWA 3QENA 4NYMR 4PC3A 4GZLA 3LNCA 1XD2B 4YONB 3IPXA 4ZKEA 5GJBA 1LTQA 3LFUA 4LPKA 3OFNA 4J0QA 2R9VA 1Q0UA 4F91B 1Q44A 3PV0A 5FI1B 1RJ9A 3CKLA 2QNRA 3T06B 1E2IA 4MRRA 1COWD 1E94E 2BEJA 1NF3A 2CNWD 2Q21A 1EWRA 2FWRA 1NVVQ 4PSVA 4Q21A 5F9FA 2W6JD 3DHWC 5EXXA 5FPSA 3M0EA 5G3ZA 1KO5A 5FUYA 1ZC3A 4ILEA 3TRFA 3F3YA 1D8TA 1W1WA 3VX3A 1CJVC 3PUZA 2BDTA 3T1OA 4Q4HB 4BE7B 3P27A 3WNBA 2ZR7A 2QP4A 1BOFA 2ONKA 1P2VA 3K9NA 4CRWB 1XEXA 4CDGA 2WWFA 5CIWA 4O2LA 1RW4A 1FZQA 2VP6A 3BH6A 4S2EA 1NLFA 3V00A 4IFBA 3ZZTA 5B64A 2VBCA 4HDOB 2P6RA 3TVDA 4NHOA 3NEJA 2ZJZA 2WSSA 3O8CA 3UWOA 2ZRCA 3BXZA 1UBEA 3CLVA 3MCAA 2WMOB 4TT3A 2ZJ5A 2ZJ8A 3OZXA 2AR7A 1TUEA 2A7QA 2ODNA 4GMXA 3I73A 5BN4A 1YZQA 3PEVA 1S4QA 1UDWA 2QP3A 3TR0A 2A5FA 4MUAA 5JWOA 2XXAA 3AVTA 1G7SA 2D62A 1HURA 1G3IA 3K70C 1NSFA 1N6IA 3OHMA 1ZU4A 1QRAA 2MMCA 3U2QA 1T3LA 5J4VA 3ND8A 3BC1A 2G83A 4TMWA 3H86A 1ZM3A 3UG6A 5KYKA 1ZMXA 1XX6A 2FSGA 1W36B 1ZP6A 4NYMQ 2WWWA 4PZZA 2GDJA 2C8VA 1VYVA 2J45A 5BW8A 2ZE7A 3U5ZB 1II0A 5J40A 1K5GA 2GBLA 3QPVA 2F9LA 3CR8A 3OEED 2GCOB 1Q12A 4NONA 5A4JA 4FMDF 1LS6A 4IOKA 3KQKA 1XEFA 1F60A 2NPIA 2DR3A 2VP4A 1XP8A 3MWKA 2P0EA 4QG7A 1E2NA 2CLSA 2JJ2D 3DZ8A 1OFTA 1G19A 4HDQB 1BYIA 1T5IA 4KYUA 4A8JA 4G5RA 1KI6A 4Q1BA 4JLNA 3I62A 2X8AA 4NCKA 5FUWA 1ZC4A 3TSZA 1SKYE 1YJ5A 2QGNA 4KFTA 4ZDKA 1FTSA 4Q01A 5JHGB 2EYQA 2QA5A 4OL0A 4AY2A 4PX9A 5JRJA 2X19A 2CE2X 2FDCA 3AUXA 4EQ6A 3SFZA 3GLGB 1XTQA 3NVAA 3X1YA 1TF5A 2ZREA 2OCBA 5JMTA 1U8YA 1V5WA 2ZI5A 3RRNA 3SR0A 1NMZA 1E4VA 2ZI4A 4KCGA 4DVGA 1Z07A 4C0JA 1PLLA 3Q5DA 3SYLA 1KMQA 2NG1A 1EGAA 4EUNA 2ZRAA 4OHXA 3KXIA 3MWYW 2G77B 2G88A 3B5JA 4TT3D 1PVOA 1S1MA 1XWIA 2FSFA 2LKCA 4KU4A 5DI9A 4NP6A 2HXSA 4M1WA 4TMXA 3U3MA 4A2WA 4Q4JA 5BWMA 3KUDA 5IF9A 2VQSA 5KNCA 3GLFB 3E5HA 2V54A 3QF7A 1YVDA 1E9CA 2ZE6A 4B33A 1US8B 1NVWQ 1UBFA 1QHXA 2QPTA 2Z43A 4KLNA 4BQSA 3SE0A 1H8HA 3THWB 4IHQA 3DKPA 5AJVB 3SC3A 2GEUA 4DLTA 2HF8A 5JZVA 2BVNA 1E6CA 1E2EA 5E3HA 3AV0B 1XD8A 3T1VA 3LQRA 2DWPA 2GJKA 4OHVA 4M9XA 5HZKA 1T4GA 1G5RA 4ZI2A 3LXRA 4JJKA 2NO7A 5FR1A 2LKDA 4KYIB 1E9EA 3SQWA 4MA4A 4Q9JA 3WP1B 2PX3A 4ZKDA 3GLIE 1NKSA 2DWQA 2D3WA 2G0NA 1P62B 3CX7A 1C9KA 2WJJA 3B60A 4I1OA 4NBSA 2GESA 2RAPA 4ERNA 2C78A 2WZQA 2JLUA 5LB4A 4G0NA 2QU8A 4AURA 2G9NA 4OK3A 3TUZC 4DSUA 4TSFA 3B8HA 2MSDB 3O8BA 4DT1A 4HB4A 1SVOA 3FGNA 2G1JA 3GJ4A 4LV6A 4EDHA 2P6NA 4C30A 4QNRA 3CWQA 5EXTA 1YHNA 1NMYA 1P2UA 1QBKC 4A1FA 2ZSFA 1J90A 5EZ6B 1OPXA 4TYWA 1XD9A 1S9HA 1E79A 4MYUA 3QBVA 5DLQC 5L8VA 3JZMA 5JLJA 1WA5A 2NOAA 3BB3A 5L3SB 1E2HA 1EFHA 1GOTA 4BLSA 1G3UA 3F8TA 4B6EA 5JECA 2O8FA 2QBYA 4HZUA 1V43A 5CLQA 3ZJYA 4JL5A 4Q9KA 3IGFA 4AKEA 1FQJA 5K8IA 3IDQA 1AGRA 4HAVA 2W58A 3I5XA 2HCBA 1GKUB 3QXSA 2PX0A 4DDWA 2XAUA 2OBNA 1QG2A 3IEUA 4QM7A 2DYKA 3K09C 3NG1A 4D4JA 2H7VA 3QVUA 3SI7A 4XWOA 3NBXX 4LJAA 3VX4A 1KI3A 1TMKA 4D0LB 1II8B 1W2HA 2KWIA 2VF8A 2V4ZA 4XIGS 2QAGA 1AN0A 1W48A 1ZBDA 2YWEA 1DAHA 4KVGA 4B44A 2IXFA 1XZPA 1UPTA 2CHQA 3K9HA 1TU3A 2KB0A 1DG3A 2WICA 3I4LA 4LHZA 2PT7A 4RVCA 4AG5A 4IXMA 1CXZA 4IEIA 1ELOA 3MUFA 4PAMA 4F38A 4BLOA 2AFIE 4ZCMA 1P4SA 2QGZA 2FFBA 3EIQA 3B82A 1GM5A 3LX5A 3WY9A 2ZI3A 2WM9B 4L8GA 1BMFA 2FN4A 3CPEA 3KTAA 3X1WA 4U02A 2AXPA 4DLZA 3CPHA 4KITB 2PLFA 1W0JA 2QZ4A 3N2IA 4V0ME 3BGWA 1U90A 1AGPA 1XCMA 3FPAA 1LF0A 2RGDA 3VHXA 4XVUA 3EZFA 3FOZA 3LWNA 4DBLC 1LW7A 2NO1A 4LGMA 1EFRD 4WXRA 2I4IA 1JJVA 1U8AA 2B7CA 3SJAA 421PA 5JBQA 4C7OA 4N1AA 1NBMD 1FUUA 3D31A 5JRZA 2GJSA 3L2OB 4KHZA 4C4PA 1DPFA 2ZRDA 1NG1A 2UZIR 4LBYA 3EIEA 4FCVA 4M1KA 1GRQA 2OFOA 4PPQA 1NP6A 1TAGA 2IUSA 1ZINA 3I92A 4MDFA 3M1IA 4P4TA 4QJ5A 2OM2A 1KDOA 3THXA 4BECA 1OW3B 1E2PA 1WE2A 1RRFA 5GJVC 4PHGA 3TR5A 1XXHA 3OE7A 3U44B 1UEIA 1N25A 5KSPA 1G8PA 1RJ9B 1MV5A 3C5CA 3BK7A 2VP2A 4B3GA 4EFMA 2TMKA 1GNQA 2W00A 1GG2A 3BIFA 4URXR 4R7ZA 1F2UA 2FSIA 2OCAA 3IHWA 2FGKA 2DB3A 4XOIA 2JGNA 3I8SA 4TTPA 2H5EA 5F98A 4OQMA 1G291 4ZDJA 5BYJA 5C4GB 1GUAA 5E95A 1LNZA 1KYIA 2ATVA 1NSTA 1VCNA 5FOUA 4WBSA 4E09A 4F4JA 4KBFA 3IIKA 3DMDA 3ZVRA 1SHZA 1W5TA 3FHCB 3SZRA 4TL7A 4DLVA 1Q1ZA 2VHQA 1NN3A 5L3VA 4FI3C 3GJ3A 3QJYA 4EPVA 5KSYA 2Q6TA 3FKSA 1FFHA 3T1TA 2GKSA 1AKYA 4OHWA 1VHLA 2F3RA 2D06A 2W2TA 5TARA 2HT1A 2IS4A 1QVAA 3FFBA 3O8RA 5FBLB 5HKKD 5FPHA 4JIMA 1GAJA 1Q1BA 3B13B 3MMPA 4FMCB 4BZXA 4ZIRB 1N6OA 1IXZA 2IHBA 2GEDA 2R65A 1E2KA 2HJVA 4Q4HA 4A6XA 4BFXA 3BRWD 1E96A 1TNDA 4JT2A 1K5DA 3VKWA 1DAMA 3GJ0A 1NN1A 3DL0A 4ON9A 1OH8A 3HU1A 2NTYC 2QM7A 1A2KC 1CS4C 5JS7A 2N46A 5JHHB 1PUIA 2OCYC 3H4MA 1S1CA 1Y63A 2R6CA 1F3OA 4PC6A 2CCJA 3GLHB 4TWZA 1R5BA 3KQHA 3EPJA 4RD3A 3LX8A 4I1VA 1GILA 2F43B 3GJ5A 3WNCA 3MD0A 2O52A 3C15C 5DE3A 2ANCA 5FPYA 1E2MA 2Z4SA 4NU0A 4B3CA 1X1RA 4UQOA 3KDSE 5BN3A 2BEKA 4DSTA 2B7BA 1YR8A 1KDTA 4Z1MA 4G5SA 2Z4RA 4NPHA 4TL8A 1BIFA 1EX7A 2REXB 1HUQA 1SKQA 5DYGA 1VCIA 2OBMA 4PANA 3QSYA 4A36A 4LJ9A 3L0OA 1EG7A 1P2TA 4I99A 1XPRA 2ZEJA 1CP2A 4A8JB 5FBQB 5AUQA 2VRWA 1CJTC 1AA9A 1KI6B 4XSGA 5IK2A 4UXJA 1E32A 4CT4B 4L9WA 4JJZA 2BBWA 3FMFA 3F5FA 4QBHA 5LB2A 2ZRNA 4JBYA 3FHOA 4ESHA 3TQFA 5FUVA 2ZU0C 2GCOA 1QHHB 3VQTA 5EE3A 4DDVA 4PO1A 4EQ6B 1OXUA 1G5PA 1SVKA 3RVBA 1KO8A 4ASUA 4ZDIA 3HYTA 4M9SA 4U5XA 1ZIOA 2R62A 2ZAOA 2ERXA 4C0LA 2IA5A 1N6HA 4G5OA 3CUEF 1TQ6A 1M8PA 1GSIA 4LJ6A 1RFLA 4PPGA 3VMFA 1Z22A 2OT3B 1CR2A 1KSGA 3A37A 1KI1A 5HR5A 1HY3A 2PZGA 2OBLA 5KPJA 5SZIA 1LB1B 2F1RA 3HJNA 2RHMA 1ZM7A 1G3RA 3GLGA 5DNYB 1Q1QA 3CF2A 2RB4A 4V02A 2RCNA 3PEWA 2C03A 4KFRA 4TLEA 4C2UA 1XMSA 2B6HA 2F1HA 2IF2A 4PSKA 1G1MA 1IN6A 1HQYE 3LLUA 4HDCA 3K0CC 2PEZA 1YE8A 1HH4A 3TE6A 4Q66C 1Z6TA 1UADA 2WKQA 5L3QA 1G7CA 2ODEA 4HZIA 5KTYA 2ZYUX 4HAZA 4OQNA 2WPDA 1ZNWA 1SXJD 2IF0A 4P3YA 4QBIA 3RLFA 3ETLA 1J8YF 1J8MF 1T5LA 4QKQA 1GVNB 2K5UA 3EAQA 1T6NA 3GLFA 4ESVA 2OCPA 2JEOA 4EFNA 2ZI7A 2YV5A 1Z06A 1TQ4A 4DUGD 2E1RA 1US8A 2BOVA 2RKOA 3CH4B 3QKTA 1GRRA 2E87A 5GJCA 5SZJA 3THWA 4LK2A 1M34E 1MOZA 2JA1A 2RGBA 2OG2A 3DKVA 3MJHA 4WIAA 3ZVNA 4AYXA 2ZUDA 1M1YE 3Q7QA 4BLTA 1M7HA 4QXAA 2AX4A 1E9AA 4KAXA 1PLJA 2Q3FA 3FB4A 3LY5A 4B76A 2CVHA 3D7MA 1WP9A 2CEAA 2ZTSA 4LCBA 3L8YA 3SEAA 3THOA 1Z2AA 1G4AE 4HB0A 3BE4A 2RGNC 3FWYA 1I2DA 1P9NA 1L4UA 2O8FB 1TQ2A 1NNEA 2OFXA 4HZUB 1ANKA 3WYFA 1B23P 3UPUA 5KDLA 2CDNA 1ZD8A 2V6JA 4MQBA 1Q57A 2GZAA 4GP7A 3U7GA 5H8WA 2ZSDA 2YC4C 2J3EA 4GPTA 3B85A 1KSFX 3RYTC 1AIPA 1WXQA 1JXOA 1MT0A 1OV4A 2GCNA 3X1XA 2GXAA 3HR8A 5DIFA 4UXIA 1E1QA 2IYWA 4MKHA 3TW4A 2Q9AA 3ZH9B 2RHDA 5L3SA 5G41A 1WBDA 3FMOB 4TMTA 3R8CA 5AUNB 3NDBB 5FTJA 1VG8A 3EZ6A 4OJKA 5C18A 1RKBA 1G8GA 4RSGA 1N6PA 3EC2A 2IX3A 2UVQA 3V9PA 1P60A 2HLDD 2ZYWX 3B78A 4A9AA 2VP0A 3VHLB 4DC9A 2QRZA 1DELA 2CNWA 2J0UA 4V0LA 4YXWD 4BGDA 2GEVA 1IXRC 3LBNA 4OQLA 2W6JA 3Q72A 5LDDC 1Z8FA 2ZSEA 5JCZA 4IDNA 4E07A 4HI0E 4BLRA 4BLQA 1CR0A 2QTHA 3WYGA 4HUQB 3KTAB 1YR7A 1IN7A 4M0LA 4UNRA 1T0HB 5FH9A 2GXQA 1E98A 1II8A 2F3TA 2QORA 4QHSA 3KJEA 1SHKA 2PBRA 3GFOA 3PEYA 3WMFA 4UNPA 3VR4A 3WXMA 4L15A 5DN6D 4DCUA 1XXHE 4EKDA 1D9ZA 4X8MA 4DLSA 5AJXA 5BQ5A 2NO9A 2ASEA 1NG9A 4C7OB 1AJEA 2CL7X 1TL7C 4FIDA 2D74A 1JBKA 4CF7A 2QQ0A 3EX7C 2VEDA 3A4MA 4M22A 4TN1A 1OHHD 1Z83A 3RSOA 5CB8A 2AKAB 4BFZA 4PQFA 4N0DA 5EP2A 3GJ7A 3R7WB 4JLVA 4CIDA 3SN6A 1AM4D 3Q7PA 1DO0A 1JPJA 2YWHA 2QTVB 3EWSA 2WKPA 2QMEA 2CLCX 4C0QC 1DVRA 1TU4A 2JJ1A 4Q02A 3W90A 4MKFA 3A1UA 2GJAA 2ZITA 3TMKA 1EX6A 3K70D 2IS2A 4US0R 4LI0A 5G53C 3W6PA 1TEVA 2WJGA 3K9LA 1OLOA 1S3GA 1ZJ6A 2BJVA 2R6GA 4Y0AA 4R71A 2HUPA 1F2UB 4P33A 3EZ2A 4A92A 2A3RA 1NJFA 3ONWA 4RZ3A 3ZS9A 1G8HA 4LJ4A 3ICQB 3QKSA 4ZI3A 2FOLA 3KQNA 3RAPR 3OEEA 2FNAA 4Q7JB 3DO6A 4C2TA 3WBKA 1LF5A 5FPKA 3AB3A 4OKSA 4OK6A 3RHFA 2ZI9A 4FINA 1KZ7B 1XTRA 2IYRA 5FTKA 3ADCA 3OEHD 3U44A 2JJ2A 3BAFA 2ONJA 2DPXA 4JVSB 4EJSC 2QP9X 4NMMA 5EE9A 2JIZA 3RNLA 5IRCD 1E4YA 2CE7A 1D2EA 4RD2A 3FHTA 3SFVA 4NYJR 4AI6A 2PZFA 3E70C 1HQCA 1IHUA 1MO6A 2RGXA 5KPDA 2V7QA 3MFYA 3EXAA 1EK0A 3GCGA 3Q3JB 4LYFA 4HAXA 1NKTA 4Q18A 1FL9A 5EE0A 2PMKA 4PFSA 2GK6A 3CRVA 2O0HA 4PTLA 5JEDA 5JS8A 4IDHA 2QL6A 1KO4A 5IT5A 2IUUA 2XTNA 1G5TA 3TK1A 3EA0A 2QEQA 3A36A 2ZRKA 3BB1A 3PR1A 1EWQA 1R0YA 3B1XA 1KI7A 1HV8A 1R5NA 3FFAA 4JVMA 3T5DA 4Q7KA 1SXJB 4ZIRA 4EFLA 2WKRA 2DFLA 5FFMA 4B43A 4C3ZA 2QMUA 1TTTA 2JCSA 2EWWA 2XGJA 4HAYA 2JJ1D 1M6NA 4D4MA 1M2OB 3QKUA 4I1UA 2QAJA 3AF4A 4QJ4A 1P3JA 3B9QA 4BPBA 3W34A 2Y8EA 4R9UC 1Z28A 1TX4B 5A5GA 3AKDA 1AS2A 1W5SA 2JLWA 3MSXA 4YQFA 2ZM5A 3RS2A 3K0SA 3TGPA 4NDZA 3GLHA 4QGFA 1KY2A 2IYLD 2J7KA 1N2CE 3W6OA 3GPLA 3RS0A 1K8RA 2F43A 3K0AA 1KSJA 3RSLA 1E1RA 2QE7D 3C8UA 4R2IA 3TLXA 2ANBA 2IYTA 3GJ8A 3DZDA 3EPLA 1W4BA 1UKZA 2IW3A 2AXNA 2ZAMA 1W4CA 2D2EA 4JVNA 2ZRIA 2UZ3A 5JEEA 1E99A 3AVUA 3LXXA 1XBTA 3GLGE 4HLDA 1VIAA 2V1UA 4IJMA 1U81A 4NYJQ 4KFSA 4RKFA 3FKQA 3AVWA 1KI2A 1JNYA 1YZNA 1KK3A 3B1VA 1VG0B 1YU9A 1WF3A 1XNJA 2CL6X 2JIZD 4DLXA 4EAQA 3AGPA 4FMCF 1UBCA 4LX0A 2PJRA 1ZUIA 2C9OA 3CB4A 4DEXA 5AK0A 4FXPA 3NWJA 2GXSA 5CM8B 3L0IB 2V7QD 4L16A 3B9PA 3EG5A 4XSHA 2AWOA 1Z5ZA 1QHHA 3GLFE 4BWYA 4TL9A 3C41J 1LY1A 3QBTA 2ZR0A 1X8JA 1NIJA 4ITRC 5ANRB 1XRJA 3OAAD 4Q48A 1M7BA 2KI5A 1H65A 2MMGA 4JS0A 4B35A 1OXTA 4A0GA 1W4AA 1MR3F 4D4KA 1A1VA 2JLZA 4LSGA 4P4SB 1SQ5A 3C4JA 5L3QB 5AUPB 3IBGA 1ESMA 4OQXA 2WIBA 1G3MA 3A8TA 4W5HA 4FN5A 3KJHA 4LV5B 4CEHA 1A4RA 1YZKA 3C5HA 1U2RA 1VECA 2IXEA 3H1TA 5C2JB 2GAOA 1P73A 1VG1A 5DI3B 4DLWA 4TLAA 2OUKA 3GEEA 1CLUA 4AKHA 2J0SA 1E9SA 4HLQB 1QF9A 3AF2A 3T15A 1UKEA 3OIYA 4I1SA 2NPFA 5K8TA 3GQBA 3P4XA 2NZJA 1C1YA 2QY9A 3AP2A 4BEJA 1IXSB 4P31A 2VA8A 4LDJA 3LO5A 2ATXA 1GL9B 2OV2A 4M1YA 2Q3HA 2QN6A 1BH2A 4RFVA 4K8OA 4RZUA 1KAOA 3K70B 1E1RD 1T8UA 2I3BA 3SS8A 1EFRA 3UG7A 3ZQ6A 4XVRA 2YOHA 5CYOA 4BZQA 1SGWA 5FL3A 4DWJA 2BBTA 1NBMA 1KY3A 4KBGA 4ACAA 1IONA 3I32A 4MYHA 1Z2CA 4IDQA 2F1JA 1QG4A 2AK3A 1GWNA 3MRSA 4DJTA 4QGGA 3EC1A 3WMEA 4D26A 1OIXA 1CKEA 3Q9LA 3QEOA 4JSTA 4PPFA 3HU2A 2I1VB 4D0NA 2V1XA 4BFYA 1XMVA 4OHZA 4K81B 2P2LA 4JL6A 3UK6A 4D6PA 3A1VA 1AQUA 3ZD6A 4LZZA 4QNMA 4LJ7A 1VCMA 1P6XA 2WWIA 1FOEB 1AKEA 3F0TA 4JZKA 3RWOA 3TAUA 5GADl 3AF0A 5EXPA 3W3ZB 3C16C 1E0SA 2REOA 4IXNA 3NTUA 2J0UB 4ZCLA 1OFIA 3AKYA 1ZIPA 2D2FA 3UANA 5C1BA 5F2EA 4MITA 3HR7A 4B6FA 5JJLA 3QXCA 1KJZA 5BN5A 1OFUX 4LY6A 1RIFA 2BJWA 2QT0A 2RMKA 2V3CC 1F6BA 4KLZA 2J0QA 1NVXQ 1CIPA 2O8CA 2VHTA 4A2PA 4QRHA 4NCIA 3NBYC 1ZM4A 3CWZA 5TV2A 3UKDA 2H8KA 4G01B 1XJCA 2AFHE 4JBXA 4Q47A 4NL4H 2ZS9A 4NKRA 4OYHA 4C0KA 2O8DA 2ZYTX 4V0OA 5TVKA 2ZSAA 3AVPA 1RYHA 4LV8B 2IS6A 3N70A 3BH7A 4Q1CA 1T8TA 2OHFA 3SJBA 4RFSB 5HKKA 1E2FA 2QG6A 1K6MA 3ZDQA 1A2BA 2P65A 2BMFA 1XU4A 1KKMA 2EYUA 4HUQA 1E0AA 721PA 5CDFA 2C9CA 1E2JA 1DOAA 1MRNA 2W2XA 4DIDA 4LRWA 4U00A 2WTUA 3D8BA 1R4AA 4JLJA 4Q7LA 2GA8A 4G3XA 3SOPA 5AR1A 5AJWA 5D3MA 1RYFA 2JATA 2CCGA 1KK0A 2Q9BA 3BH0A 3C14C 1TUIA 3NHBA 3QIAA 4Q03A 4DHEA 1XTSA 3U61B 4WVFA 2BHRA 2QQEA 2ZR9A 4LBVA 5JSZB 3G82C 3S1AB 1R7RA 1BKDR 1MO3A 3K8YA 1ZM9A 4BASA 2OAQ1 2ZJBA 3QVVA 5P21A 4NZYA 4QGAA 3QKSB 1KMHB 4MRNA 4XTRA 3R7WA 2XNDD 4UJ3A 5KNBA 2YJTD 1W4RA 2EFCB 4HLUA 2GBLC 2VIIA 8OHMA 4M9QA 5TMPA 3K0EA 4JKIA 1S8FA 3NC0C 3FMIA 3L8ZA 5KHOC 2FPKA 4MKGA 1S9DA 4M2LA 2WJIA 1N6NA 4B32A 2EVWX 1OXVA 1OKKD 2OO7A 3DM5A 3PITA 4PQRA 3N2EA 3TJZA 5JCPA 3REGA 1CRPA 4OI2A 5SZHB 4KXFB 4LYJA 4CEJB 4C0BA 1E9RA 2CHVA 2DWOA 3DPUA 1HT2E 1TQDA 4JLMA 3LV8A 2JASA 4A8JC 4DB2A 1OIVA 4D0GA 4GOJA 1MABA 3CRW1 3KXKA 3CX6A 4NYIR 3RRZA 4B3XA 3EPKA 2GCPA 4B3DA 2FPMA 1PJRA 2XOKA 4Q19A 1W7AA 2CMKA 1JXMA 2VO1A 1UJ2A 3RRMA 4UNQA 4D25A 2QROA 3HWSA 2QSZA 4V0NA 1VPLA 2G0TA 2H92A 4A0RA 3IQWA 3GFTA 4MKIA 2PMDA 2H57A 3CRQA 3EASA 4O25A 4DKXA 4TYNA 4MRSA 3R8FA 4CEIB 3AP1A 2J0VA 4JLBA 3GJXC 4H1UA 5FTMA 4C9BA 3GLHE 5FI0B 4AC9A 2O8BB 1XFAA 2CHGA 4L9SA 2R6FA 2WIAA 1U0LA 3PCRB 3EW9A 3IIJA 2ZRBA 3DOEA 4UNNA 2X77A 3WNDA 3BFXA 1NI3A 2HYDA 1LVGA 4M1TA 5DISB 4D82A 4O3MA 1MO4A 5TB5A 1NY5A 3ZLJA 1L8QA 3ZZUA 1E9DA 2ZI6A 2HDNB 5FBVB 3ZD7A 2FJUA 1FX0B 1QZXA 3QF4B 5H70A 2VYFA 3HPQA 3PIRA 2GVDC 1UAAA 1X3SA 4G5GA 4ARZB 2ZROA 3AVVA 2VF7A 1E3MA 1Y3AA 2BMEA 2WWYA 4DLRA 3LLMA 4Q4AB 2O5VA 2KBFA 1ZYUA 2WVJA 2Z0MA 1HTWA 3AKCA 4UKDA 2WBLC 2VL7A 1LV7A 2OILA 3A1WA 1SXJA 2Q0HA 3K0AB 3QG1A 4YMVA 2YWFA 3K1JA 1XZQA 3KL4A 3D3QA 3WRYC 1R10A 4DUGA 3CH5A 1GFIA 2JAQA 4JBWA 3AKEA 4L4UA 1TF7A 5FUXA 3R9IA 1WCV1 1XCPA 3T61A 5HCNA 4TLCA 2GTPA 1Z3IX 1AQYA 3QXHA 5BXQC 4TTRA 1GL7A 3P4YA 4LHXA 4PAOA 4LBZA 1XF9A 2P6UA 4NYIQ 2XB2A 2GVZC 1U0JA 1G4UR 1U9IA 3KZ1E 4KSCA 3QKRB 2CXXA 4JLOA 1ZW6A 3WP0A 1R8SA 1ZNXA 3UMRA 1GIAA 1T91A 2V6IA 4LC1A 2FFQA 4TQUS 5JJIA 4POAA 3FVQA 4AYWA 4PC7A 1JR3D 1G64A 2Z5FA 2IBMA 3JZAA 2EQBA 2QMOA 5E7MA 3TUIC 4EPWA 5FPTA 4YMTA 5CIQA 3K9GA 1J70A 2XOKD 4Q5IA 5F9HA 1EFTA 4XH9B 4IOMA 1P72A 4PHTA 4AWXA 3KJGA 3NC1C 2IS1A 1HT1E 1IBRA 1Q22A 3ECCA 2JLQA 3KKOA 1BS1A 1WBBA 4BFSA 2AN9A 5AWFC 5LD2C 2W0MA 3Q5EA 1SVLA 2H16A 4FWTA 3Q85A 4WXPA 1MRSA 1IY2A 2VSOA 2BCJQ 4PAQA 3X2SA 4D4LA 3A6PC 3GP8A 3VNUA 3SYNA 1NY6A 3T1QA 1YRAA 3KKMA 2NQ2C 4RD1A 2D4HA 2ZIAA 2J1LA 2XB4A 221PA 1GZSA 2NMVA 1P2SA 5KSZA 4CEHB 3VKGA 3KJIA 4OI1A 4TMZA 1N0UA 1YZTA 2ZE8A 2QAGC 2B8WA 2EFGA 2HLDA 1DS6A 5J5CA 1GL6A 2VSFA 3IQXA 3ZIAD 2IYSA 5DO9A 4IDOA 1TF2A 3EWAA 3NKVA 4YXWA 2OE2A 2OLJA 1NBME 3BB4A 1RRPA 5FBWB 4LOAA 1M74A 2XJ4A 4CW7A 2AHOA 4CYMA 1VYTA 1DE0A 2O0KA 4P4SA 4HB2A 5AUOB 3BS4A 3I1FA 3KX2A 2P5TB 4E03A 2AK2A 1SULA 3IBYA 4QOSA 4AK9A 2OSBA 3IPYA 4JT4A 1IY0A 2I1QA 2FE4A 1ETUA 3NXSA 5FL7A 5DN6A 2IWHA 2AD1A 1E9BA 5G3YA 2J9RA 5JWHA 3O8DA 5BYKA 5DI3A 3LQQA 1FP6A 1ODFA 5CITA 3NDPA 1OHHA 2EU8A 4GMDA 1GNRA 1CJMA 2HYIC 3MWLA 4PPNA 3U7EB 3A58B 4C0SA 1AS0A 5FTNA 1W0KD 4GZMA 3MGCA 621PA 4LPSA 1L2TA 3SQXA 3QXXA 1JAHA 3EIHA 3CRRA 2GNOA 5KO2A 4CT5A 3KQLA 3BFVA 3WHLA 1D2NA 2WAYA 3KKPA 4MGKR 4URZR 1G8YA 4B3BA 1Z29A 3IIMA 4R98A 4WZAE 4IVPA 3RC3A 1GRNA 3A1SA 3CF0A 5CYPA 5HPYB 3RANA 3GJ6A 3ZGXA 2GILA 2IC5A 2IXGA 3QY0A 1IM2A 1ZNZA 3TSWA 5JWRA 3MG9A 1PV4A 1IOZA 3U3JA 1CR1A 1KK2A 1RVDA 2D7CA 3PUYA 4IOJA 4WW0A 4GRAA 3SJCA 3VU9A 1MKYA 2GZDA 3ADDA 1U94A 2W0SA 3I72A 2O8CB 5CDFE 4IW3B 1A7JA 2FFHA 2E9SA 2ZSBA 4TYPA 3OEHA 4H9GA 5LBIA 4ZCIA 4AG6A 4WAUA 3I3SR 4MRVA 2FG5A 3WRXC 1DARA 3CNLA 2RGCA 1Z08A 2W2VA 4XD7A 2O8DB 1H8EA 1KHTA 3LVRE 1FUKA 3KKNA 3OIVA 4LUCA 4CGZA 1ZRHA 3RS3A 3SHFA 3HYRA 1JQLB 3FE2A 2D7DA 2XJ9A 3W5JA 2J59A 1U99A 2IT1A 4FMBB 3WBJA 1VTKA 2HEIA 3EA5A 4GNKA 4DDTA 1XPOA 4YDHB 2FPLA 5HE9A 1SVWA 4B34A 5K8LA 3VKHA 4KVAA 2ZPTX 1X86B 5EXSA 1JEEA 4O0MA 4HUTA 4B48A 1E9FA 2GETA 2HV8A 2A5JA 5FL7D 1NLYA 1KAGA 3JVUA 3O47A 4Q1FA 5DH9A 4QGHA 1DTSA 5D3MB 4B47A 4ACBA 1GP2A 1IJFA 1CULC 1S0UA 3VR2A 2XNSA 1OB5A 1N5JA 5J4HA 3U7FB 4RFSA 1I4DD 2FA9A 3PJRA 3AF3A 3LRPA 2ZRFA 5FOTA 3NBFA 4BRUA 3I5YA 2AD5A 1L7VC 3HP1A 4IOLA 3KFVA 1X1SA 1HEIA 1S2MA 4PHHA 2DFTA 4Q7MB 2HF9A 5FOXA 4A2QA 1NMXA 1Z63A 1AK2A 1CRQA 1GKIA 2BKUA 2FH5B 4GT1A 4GSYA 3P32A 3L82B 4DRZA 3DMNA 3BWDD 4RCZA 5FOSA 3UMFA 4URVR 4MDEA 4MRPA 3BORA 4B2LA 1P9RA 1RRCA 1DEKA 5JSZA 2XTZA 4KO8A 4DDUA 4W7SA 4KSBA 3S1AA 3W8NA 1UBGA 2ZRLA 1KKLA 2WOOA 1W36C 1IJEA 1MABB 2CK3A 4QBFA 1UM8A 4QL3A 1KMHA 2QE7A 4TLBA 1NLZA 1VIYA 2VH5R 4Q1DA 4JYBA 3CR7A 3QQ5A 1OH6A 2BBSA 2GWHA 2H1LA 3DDCA 4MGYR 5DYIA 1Z0JA 4OQFA 2OAP1 3TQCA 1OF1A 1OIWA 4BUJA 1D2MA 2C2HA 2GK7A 2VP5A 2ZETA 3A1TA 3GFPA 1P5ZB 3VR1A 2F55A 2IYQA 4ZPXA 4PZYA 2CJWB 1X6VA 2ZS8A 3PG5A 5HCIA 1G7RA 4GBMA 4XD7D 2KBEA 2IUTA 1W47A 1ESNA 3SBEA 2ZRJA 1H8ED 5JI3E 4CEJA 1F2TB 1HE8B 1CEEA 3P26A 4ZDWA 4U7DA 3QPUA 1KO1A 1YKSA 2KJQA 5JFGA 3U3RA 3LBIA 1LS1A 1JJ7A 1OT3A 4F4CA 1SXJE 2J7PD 4PO9A 2W6ID 3B1WA 1W46A 3T34A 5E7IA 1TPZA 1J2JA 2IEYA 1E0KA 1Q20A 3CZPA 4OJQA 1JI0A 4D80A 1G3QA 3BD9A 1XMIA 3BJIC 1NJGA 4JVLA 5SZKB 1U8ZA 2YZ2A 2BM0A 5E7JA 3OAAA 1RC8A 1FNNA 1ZVQA 2ZUCA 1KI9A 4NCNA 5H1YA 4WOPA 3K09A 1BYUA 4CEIA 3PUVA 2IHYA 5TY0A 3CF6R 3W3AA 3ADBA 4B2PA 2XSZA 1QDEA 1XMJA 2O8BA 5A0FA 1YZGA 1FTNA 3AF1A 4M1SA 3WMGA 4B73A 5JI2E 2JLXA 4W9MC 4GI7A 1JAIA 1W2GA 2ZJAA 2ZRGA 4P0TA 4LYAA 4Q1AA 3LVQE 1X8KA 2EFHB 2EW1A 4O2RA 3IO3A 2DFKB 4Q9HA 1G6HA 2A2ZA 2B21A 5F3WB 1FX0A 3QF4A 2B92A 3U3OA 3IUYA 4F92B 4QC2A 3VR5A 5DSZA 1A82A 1D5CA 1CTQA 4ARZA 4B74A 5C46F 1UEJA 2SHKA 4OHYA 1J99A 4M8NE 4PO8A 1ZM2A 3H84A 4Q4AA 3THYB 5B57C 4FW9A 3RABA 4KV9A 1R6BX 4YDSA 3CM0A 2KSQA 4AKIA 2CK3D 1A5TA 1KTVA 3LAWA 1Z0DA 1XEWX 1NN5A 4TTQA 2B8TA 1OJLA 3X1ZA 3PENA 3ICEA 3AQ4A 5DHFA 1GKYA 3CONA 4HAUA 3SBDA 4TMKA 4LHWA 2A9KA 1KNQA 1G9XA 5EP4A 4PC2A 3U7HB 3TKLA 1G16A 3ASYA 1HA3A 3M4YA 1Q3HA 3QKRA 3VFDA 5G40A 4D81A 5J4YA 5KUTA 3WYAA 2P5SA 2WOJA 3R9WA 5KSOA 3U6KA 1I4LD 3UIEA 1GITA 1TEXA 3GD7A 4EPXA 1XPUA 2FGJA 3FTQA 1ZD1A 2ZJYA 4YC7A 5CJPA 4GOXA 4OK5A 4AYTA 1NL3A 1FMLA 1CU1A 1JEDA 2ZANA 3B1YA 3HPRA 1OB2A 1E2GA 2FZLA 1IAQA 3OFND 4EJSB 2WWHA 3OIUA 4N3NA 3RS5A 2NIPA 2WAXA 3ZVLA 4ABYA 1G41A 3BERA 4Q00A 4QBGB 4HLCA 4RZXA 1Z6XA 4B3FX 4LBWA 4B71A 2GXUA 1P75A 1W44A 4N0EA 3EARA 4BFUA 1VMAA 1G6OA 2WWXA 1L4YA 4H1VA 2VHJA 4M53A 1WQ1R 4TMVA 2XSZD 4YLGA 2ORIA 4M9ZA 5E4FA 1DAGA 5DGXA 4XJXA 2ODWA 3GEIA 1T9HA 4II7A 3FYHA 4RD0A 1EXMA 3I61A 5EZ5A 3R9XA 1FPMA 3TIFA 2HT6A 2VHCA 1JB1A 4JLPA 2O0JA 3D6TB 2G3YA 1ZCBA 1XTKA 3PEUA 3NIBA 3QI2A 1XEWY 1OFHA 3G5UA 4IFEA 2QPAA 3SHWA 2WSSD 4RY2A 4JLKA 1SKYB 3RS4A 3TVTA 1TADA 5B58C 2EWVA 1D9XA 3B2EA 4HSEA 4D2IA 2FSHA 2J5XA 4WZBE 4Q1EA 1IY1A 2Z83A 4NCJA 2OFWA 2HCJB 4MGIR 1DO2A 5IDVA 2O8EA 4FCWA 4TYYA 2MSEB 3A4LA 3AGQA 2WJVA 521PA 3AUYA 3K0FB 1RE0A 1N6LA 3MAAC 4EPYA 4LC0A 2G6BA 3VR6A 2QTFA 2GAAA 4G1UC 2BM1A 4QHTA 1Q1EA 2XITA 4A15A 4IRUB 2PJZA 2XNDA 1DADA 1OH7A 3DOFA 2DFNA 1YR6A 3VU9B 3W8RA 4FD2A 5EE1A 3QOFA 1SVSA 4S35A 2FEOA 3NHAA 2N42A 2QENA 1WMSA 2X1VA 2VSXA 3U4QB 1NIPA 3CBQA 1OKKA 4P32A 2NO6A 3KFXA 1S96A 1N5KA 3GMTA 5CLLA 2BMDA 1QHGA 3OF5A 4JLDA 2ZS7A 3TSOA 2RGAA 4WA7A 1ZUNB 4DSNA 3LW7A 1PLKA 3GLIB 2C77A 1XTIA 5KDDA 3T5GA 2IYXA 2PL3A 2Z6VA 3AM1A 4V0KA 1S3SA 4KI0A 1VG9B 4JMPA 2WWGA 4URWR 4JL8A 5KU1A 1P61B 2L0XA 3B6EA 4AD8A 2X2FA 1Q3TA 1N0WA 2DCUA 5M04A 4RZ2A 4TZ6A 1VKJA 4LYHA 3OESA 4TQ9A 2QM8A 2RGGA 2CVFA 1GNPA 2ORWA 3KKQA 3L0SA 4X8LA 1RPZA 4OI0A 4RD4A 2JLSA 4FWIB 2WHXA 1P9WA 2PT5A 4V03A 1DAEA 4URYR 2QSYA 3T35A 3EZ9A 2C04A 1KIMA 1PZNA 3QE0A 3QXJA 1MH1A 3U60B 2CCKA 1SVIA 2YYZA 4G5QA 1KJWA 4PSAA 1YR9A 2ERYA 2C5LA 5L3RA 3SNHA 6Q21A 1KI8A 4RKEA 1H8HD 2QRNA 3SU8A 3LD9A 1I2MA 3AP3A 3SJZA 2ZJ2A 1Q21A 3K0CA 4Z8YA 3X1DA 2ODBA 3TH5A 3DEFA 1KSHA 5HTKA 1R5OA 5B2ZA 2CLDX 4MUBA 4QFMA 4LJ8A 4JKYA 4LWZA 3EPHA 1X8LA 3CW2A 1Z0IA 1XJQA 3V4FA 1BO6A 2X2EA 2XZPA 4I81A 2A30A 4M1OA 4BFVA 1XDBA 3I8XA 1UKVY 5J4KA 4GP6A 4Q9IA 3AVQA 1KDPA 1NRJB 121PA 1YQTA 3NH6A 4TLDA 2V8OA 3ZYCA 3CO5A 3IKJA 3MLEA 1J7KA 1B0UA 1FMJA 4TSFD 3W9YA 4LHYA 4EPRA 1KK1A 2VTKA 3UWKA 1G8FA 4E22A 2YC2C 4Q9LA 2QUZA 2VHUA 1T3HA 3H2YA 1JR3A 4BFWA 1E79D 2ZVPX 2RGNA 1YZLA 1KI4A 1FNMA 4YMSA 1EFCA 3PFIA 3TBKA 4XWKA 4C0AC 1FW6A 2UKDA 3BBPA 1XB2A 2R44A 3C7KA 2C99A 2FZ4A 1G7TA 3CNOA 3LH5A 4UNSA 2F7SA 5EE5B 1KOFA 3U6BA 2GF0A 3ASZA 2CJWA 4CZ2A 1OH5A 3J81k 4K46A 1WRBA 821PA 1JALA 2OESA 4A4DA 2QI9C 2A78A 2BCGY 4DEYA 1F2TA 1SVMA 1EFUA 2BWJA 2NGRA 4IEEA 4UJ5A 4DB4A 3RDPA 3RC8A 1P7CA 3NBZC 5EQTA 4B75A 2ZYVX 1DAFA 3G0HA 3CIOA 1UF9A 1XCGB 1XD2A 4IVRA 1XEXB 2LCFA 2QT1A 4FMDB 4GL2A 3ZIAA 1Z6GA 4A0HA 3A4NA 3H0KA 2R6DA 1FP7A 2GRJA 3KQUA 2PCLA 4TYQA 5EP3A 3IHLA 2IYUA 4I4LA 2IL1A 3IILA 5JJKA 2IYZA 4HB3A 3ZS8A 2YOGA 3CX8A 1Z47A 2GJ8A 2BIFA 2BV3A 1BMFD 1N3BA 1OXXK 2FV8A 2PH1A 4M1MA 2XXAB 1R0XA 3FDIA 3AVYA 1W0JD 2Q3MA 4DCSA 1E2QA 1ZUHA 1R2QA 3LW8A 4MYCA 1VHTA 2QMHA 1DAIA 1Z0AA 1IQPA 4TL6A 1WDTA 2J41A 1D6JA 3KXLA 1QVRA 2DBYA 2FX3A 2WJHA 2CBZA 2IEZA 4DIEA 4TZ0A 3KB2A 3SYKA 2P3SA 2R8RA 1E2LA 2C98A 2FF7A 2Q9CA 4WZ6A 3THYA 4A6PA 4PZLA 1KNXA 1W0KA 1AZSC 2JLYA 2DHRA 5UKDA 2IK8A 1N0VC 1Z0KA 1I4TD 1F5NA 4XTCS 2KE5A 3N5CA 2RH5A 2RGEA 4QHYA 3GEHA 4FCTA 2GJ9A 4BLPA 4DCTA 1OYYA 1OE0A 3OE7D 1FQKA 1O87A 2H17A 2G1KA 4ZV4A 1OSNA 4B2IA 4BEBA 2BKEA 4OI4A 1DAKA 3IO5A 5D3QA 3E1SA 5HE8A 1UDXA 2V9PA 3PUWA 2ZRHA 2HJGA 2C95A 3CNNA 3TW8B 2ZU6A 4PQYA 5H68A 3HU3A 4MH0R 4X8OA 5J4LA 2FU5C 4JYCA 1ONBA 1E0JA 1UFQA 5TDHA 5DHAA 1VYUA 3VR3A 2DY1A 2VP9A 1KDRA 1VDZA 4US2R 2J46A 5KDOA 4HAWA 4EJSA 2AL7A 2J87A 1ZD9A 1ZAKA 2HXYA 5B30A 2F1IA 2PEYA 3FKSD 1G17A 4QJ3A 2WMNB 3QNUA 2H18A 2OLKA 4TQAA 1II9A 3QUSA 4EPTA 4US1R 1KGDA 1KZGB 1SZPA 2V55B 5FR2A 4W5JA 2R2AA 2IWRA 1IN4A 3FMPB 3UMSA 4F7WA 5IHPA 2VPPA 4GDFA 4Q4JB 2JJ8A 1R0ZA 2YNMA 1C4OA 3DM9B 3W6NA 4HEJA 1KJYA 4LJYA 3TUJC 2O8EB 1RZ3A 4E5UA 4RJLA 3LBHA 3ZZ0A 2YHSA 5K8UA 4KJZA 1JPNA 1F48A 5EJEA 3M6AA 5AJYA 1DG1G 3VNVA 3QEJA 1EESA 2ZQ5A 2R6AA 1GTVA 3L0PA 2IYVA 2YWGA 2GF9A 2WSMA 4C0HA 3QPWA 1ZCAA 3SDZA 1Z6YA 3AEZA 1DBSA 4PXAA 4Q4LA 2BMJA 1YZUA 2C9YA 4IDPA 5AJZA 1MO5A 1WB9A 3UXMA 2FFAA 3TAHA 5CM9C 1CR4A 5ELXA 3U4QA 3KB1A 3KUCA 4HLUC 5EP1A 1UKYA 4AKGA 4Z1MD 1CF4A 2ZRMA 4F4IA 1PUJA 4DT1B 4Z51A 3K0FA 4BZPA 3AH8A 4RCYA 4XVQA 3Q8XB 4DLYA 2XX3A 2WJYA 1R0WA 2OXRA 2GHIA 2XZOA 2JDIA 2XZLA 5KOYA 4NCHA 3MJRA 2YOFA 1W36D 5IK2D 1CJKC 2F9MA 2JLVA 1XJ0A 2GZHA 2QPOA 1T3SA 3VTKA 1R8QA 4YMUA 2ZVQX 2QBYB 1G18A 2PLRA 5KNDA 4DZZA 5FBRB 5CJ2A 1IN5A 4M4SA 3RWMB 4BFTA 1O3YA 4A82A 1QHNA 3CRMA 5LD2B 3LA6A 2BBOA 5CB6A 1AZTA 3CPJB 3R20A 1RRGA 4HATA 3PXGA 5LPNA 4ASUD 4Y0VA 1U98A 3BFKA 1AS3A 1QHYA 2IYYA 2OZEA 3QG5A 1XTJA 1ZU5A 4L5BA 5C4MA 2BC9A 1E2DA 1HYQA 1JR6A 1Z6AA 4F93B 4R2HA 3P20A 2P67A 5FOWA 3LDAA 2XTMA 4DSOA 1N5LA 3NEYA 4M21A 3GLIA 2A5GA 2N1BA 3BOSA 2ZRPA 3REFA 4RD6A 1G21E 4BRWA 2J7PA 1HE1C 5FTLA 1IN8A 2W6IA 4DLUA 4PC1A 4NE2A 5CK5A 1CJUC 1YRBA 4PR0A 2QAGB 3P1JA 2CL0X 1LFDB 4JSYA 4MYTA 4AIIA 2EFEB 1ZNYA 4ZO4A 3L43A 2YKGA 3DVLA 1COWA 2MSCB 1Z0FA 2FMXA 3RS7A 2ZUBA 2OXCA 3OIWA 3AVXA 1CBUA 1QHIA 4Z8XA 3WHKA 1JECA 3JVVA 3TNFA 3PUXA 3B7GA 1JQJC 3K53A 3ZVMA 1M7GA 4JLAA 1N6RA 1U0HC 1JR3E 4YMWA 2WPDD 5FOVA 4URUR 3RRYA 1SXJC 1N6KA 1T0JB 1NVVR 4QM6A 4DCVA 1OXSC 1NN0A 4EIWA
chains in the Genus database with same CATH superfamily
2ZE5A 3NHFA 2NZ8A 1ISSA 3FWHA 2FPGB 4M99A 5M29A 3C0KA 3T9CA 5DCWA 4YO7A 4LOHA 4P3KA 4BX2A 3U3KA 3G2LA 4X8HA 3EG9B 3DL7A 4NBTA 4DCNA 3HDTA 2E89A 4IKEA 1F3LA 4W5WA 4X91A 5ELLA 5LYYA 3AQIA 1ZICA 1H3NA 2DTEA 3MJDA 3WYBA 3HLYA 5GZ1A 3NKFA 2ZXUA 2Z6QA 4MOWA 1O95A 1UJBA 2ST1A 3TTVA 4Q6WA 4RK7A 1RYEA 5DW0A 3FMGA 4WLVA 2VTEA 1VOTA 2W6PA 3IEVA 3EZXA 2NV6A 2FMIA 3KIPA 4BV3A 2YINC 1NVUQ 3A2KA 1VL8A 5TXGA 4B8YA 3JARB 1JZTA 2J5KA 3PQCA 3VAAA 2C3PA 2OPBA 2YVUA 4MVJG 3KPJA 2LWIA 2HNAA 2NU9B 4BNNA 1RHMA 3MYYA 1M8FA 1QHSA 2W4MA 4ZYWA 4CM5A 2IH4A 1Y82A 3E2IA 3LGSA 3JXEA 3Q10A 1EPUA 1IPFA 2WFZA 1PD0A 2FZVA 4OBEA 2M6KA 3STWA 1IU9A 1C8LA 4PX3A 3LC0A 1BAPA 4P08A 4DGQA 2BKXA 2QUHA 5KYWA 2MHCA 2EIHA 1DTWB 1DDGA 2W83A 2PZEA 3CZQA 1LRLA 1OX5A 2Y9MB 2B4TO 2BLNA 2HWWA 2VI5A 3OIFA 3V97A 3AOEC 3C74A 7AT1A 5J47A 5KC9A 2G36A 3IHKA 3PIIA 3W7VA 1E69A 3E82A 2PO5A 5CT9A 4ZHQF 5BMVB 2HGZA 3P2MA 4RJIA 2YN2A 1D7AA 3MTJA 5F7XA 1XD2B 4EITA 4B0PA 2R85A 1AK1A 2E4AA 3ESYA 2EATA 3LFUA 2RHCA 2VOJA 3NYWA 3OFNA 3OU2A 1GR0A 3PKZA 4LPKA 2NAPA 4MUFA 1N5RA 1LBSA 1Q0UA 1B6SA 3PV0A 1RJ9A 4JITA 3CKLA 4J3NA 4FB5A 1EVLA 2XWSA 4MRRA 5ELMA 1COWD 1PWEA 4PZPA 3O0DA 3CVOA 5LXTA 3AZPA 1H0HA 1N7HA 2BZ1A 2YUIA 3FPHA 1EWRA 3QMPA 4RIIA 2NYAA 4WLNA 4D99A 1OBCA 3DHWC 4QAJA 5EXXA 4KQGA 5FPSA 5G3ZA 1TK2A 4RQTA 4PYQA 3FA2A 4ILEA 3SR3A 1GGNA 2FJPA 3F3YA 3QMWA 5KQPA 3NC4A 2R86A 3V32A 1GDHA 2BDTA 2IUFA 3MCWA 1U3WA 3VXKA 2F64A 3P27A 2PM8A 1P0FA 2ZR7A 3MAJA 5KEIA 2HMVA 3QEAZ 1RYNA 1WSBA 3B89A 1S7CA 4UHEA 5JCOA 1RPNA 2WWFA 5CIWA 4UE3S 1RW4A 4S2EA 2BRUC 1QGUB 3FR8A 3WO0A 3PSHA 4GE0A 3TVDA 3PKJA 1SKBA 4XYBA 4IX1A 3MWEA 3O8CA 3DE3X 4YCJA 4YCLA 1YVUA 2AF4C 3CLVA 2EL7A 5LVAA 1BJRE 4B81A 5JD5A 2WMOB 4TT3A 5IXYA 3VDXA 3OZXA 2IUEA 4AJLA 1TUEA 4K87A 5BN4A 5AD1A 3L7CA 1SA0B 4RH0A 1I0ZA 4OHRA 4V38A 3BXPA 4DV6B 3GQVA 2YWBA 2WHPB 1DBVO 1L4GA 3ICOA 3HL0A 2B1GA 3F71A 4KRXA 4RV9A 2XXAA 2UXDB 2D62A 3B9RA 3EGDB 1T26A 1HURA 2YS6A 1L4MA 2ZR8A 4HPJB 1Z8HA 2C2XA 2XWPA 1A7AA 5BSMA 4ZK2A 3K70C 2GHQA 5JAUA 4E33A 5AW2A 2BFMA 3KT0A 1WXIA 3ZBPA 5JOQA 1QRAA 2MMCA 2V6MA 3MTIA 3MRVA 5KYYB 2NVUA 3T4XA 3U2QA 3ND8A 4N48A 3ZWMA 5FLEX 1V5FA 2G83A 4GPEA 3H86A 1Y3HA 3OJFA 4TMWA 4RH3A 1ZMXA 2ZRQA 4W8HA 2FSGA 2PU5A 4BDSA 4QARA 1GT6A 3FCXA 5EQDA 2ADMA 3L7IA 3V7WA 3VGJA 1RLUA 1RWPA 3WISA 1JDZA 4Y2RA 4RGBA 4EI9A 5BW8A 1CLEA 4LDPA 2F48A 5CFLA 3ABZA 1NTOA 1P31A 3QPVA 2F9LA 4W63A 4WESA 1L9XA 3OWXA 1HQKA 3LKDA 4NONA 3DLPX 2NP6A 3CUSA 4LYYA 1EFVA 1F60A 4BO9A 4F9EA 1KH2A 2VP4A 3MWKA 2PX4A 2NU8B 3EPRA 1XN1A 4ROTA 1Y8AA 4AZVA 4D9HA 2CLSA 4L73A 1DQYA 3FZEA 3QSGA 4TUYF 2JJ2D 4W9RA 2VATA 1TJNA 3QRWA 1YSCA 4IF6A 3ZGNA 4CL2A 1JDVA 1L5SA 2YWRA 1WZNA 2X5JO 4KXWA 1CYEA 4KYUA 1T8PA 2HA3A 2MR5A 3IELA 4C1BA 4I3FA 3CFYA 1HDXA 4G5RA 1R0KA 4Q1BA 3PE4A 1BXRA 1QGED 1R74A 2BSAA 2X8AA 4BLUA 1ESEA 3JQ6A 2PX6A 1JT9A 3TSZA 1FQOA 3M1YA 4KFTA 4BLWA 2QL9A 4NEGA 4MZXA 4MWZA 4V24A 5KTOA 4OL0A 1BQ3A 1IAVA 4HOYA 4AROA 1E1MA 4BV9A 3WSVA 3EGCA 4HQ6A 4JB2A 2FDCA 2ON6A 1XTQA 3GLGB 5I51A 1UWKA 2O2CA 4RLHA 2ZREA 4OSPA 2Q3LA 1LK5A 3GNTA 2PIDA 5FTWA 1WPQA 1NMZA 1E4VA 3ZBUA 1Z07A 3WLLA 4KJXA 3DGFC 1D4FA 2AHRA 2NG1A 2QIOA 3LT2A 1J8FA 1QRRA 4P2BA 3T54A 4UFNA 1OZGA 4LE2A 3CEJA 3UT5A 1XI2A 3B5JA 4FR0A 4JY7A 4TT3D 4DPKA 3OCXA 3E18A 4QPNA 1JHAA 3LRXA 5DI9A 5EKUA 1PVOA 3Q88A 5B5SA 2R6R1 3G49A 3W5VA 4Q4JA 3N3BC 3T9FA 5IF9A 1FX1A 3AWDA 3C7TA 2Q7DA 4TSRA 3E5HA 3Q6MA 4K28A 1CC1S 1WZCA 1G2IA 2ZYSA 3G2IA 3N6RA 16PKA 4K6MA 3T4EA 2QPTA 5H3HA 2ECFA 2DFDA 4B33A 4DY4A 3FSGA 4EGCB 4POOA 2HBQA 4BQSA 4OX9Y 2BFFB 1JSRA 2N75A 4WXHA 2DBRA 3B48A 4JT9A 4R83A 3HUTA 1G8AA 3F6YA 5TIIA 3DVSX 3T1VA 3U0BA 2P6PA 1Z13A 3IOEA 1W25A 4M9XA 1G5RA 1P0MA 3C3JA 3LXRA 5FFFA 3SG0A 4II2A 2JBAA 1EB8A 2FKAA 2LKDA 1U4SA 2R8EA 1T1SA 2HSJA 4K8RB 3GXOA 4DY6A 5CB4A 4GIBA 3WP1B 2PX3A 2C7QA 3GLIE 1NKSA 1POXA 4L8YA 1LBTA 4TX1A 1GKLA 2DWQA 5EC8A 2G0NA 4GGMX 3NOXA 1J9GA 1K86A 2ZP1A 4J3JA 2WU1A 1ZO8A 4NX2A 1R6DA 2ZJ1A 4Y2JA 1N7GA 3KOMA 3VNAA 2HZBA 1KORA 4AURA 4HDSB 4FFBB 3OVMA 5IFLA 1JXAA 4OK3A 3TUZC 4DSUA 4TSFA 3MHTA 1AV7A 1BRTA 2C8JA 1ODLA 1XQVA 3GJ4A 4LV6A 3WOHA 2P6NA 4BMVA 3L84A 3NXKA 1K9SA 1MD9A 4WCFA 2PWBA 1I7NA 5EZ6B 1U9YA 4ZJPA 4GBJA 1GHTA 2C1ZA 4U4AA 4NV3A 1LZKA 5DLQC 1CQZA 1WU7A 2DCMA 1OLSA 2OCDA 4KO3S 2JRLA 4MWTA 5DGIA 5KWIA 2NOAA 1QQTA 2GCGA 1D2CA 3BB3A 2J4CA 3JZFA 3UMJA 3WIEA 4BLSA 5L3SB 1OMOA 1B8NA 2GCEA 2R4TA 1ESDA 1QX4A 3NOVA 4MCJA 3LPCA 4NV0A 4PAWA 4X1KA 4HZUA 5BSGA 5A0TA 2UDPA 5K9ZA 4FJ1A 1P29A 4G9BA 3ETHA 3WWDA 3HN7A 2VLBA 1Y4DE 3KB6A 1M34A 3KYCB 4Q9KA 1P1RA 4GR9A 8AT1A 3G5AA 3GARA 2Z2IA 1CUSA 4QDTA 1U65A 1DCTA 1GADO 3K73O 3TBHA 3I5XA 2D2VA 4NENB 3KXDA 2QQ5A 4DDWA 2XAUA 1PUXA 3TLZA 3QLUA 1W0CA 2QD2A 1HKUA 4W1SA 1N8TA 4YJ3A 2F1OA 1Y8QB 3VSAA 1TMYA 3QVUA 4C07A 1JWAB 1Y81A 4FYIA 3VX4A 1NVBA 4D0LB 5ITVA 2Q3BA 4R4JA 1SB8A 2VF8A 5CU7A 7REQB 3ZI4A 1U0FA 2YHBA 4AVYA 2I6QA 3KUKA 3JYOA 4B44A 3TPFA 3WK5A 1KEWA 2IXFA 5E0KB 3ZWNA 3RYHB 5CD9A 1ODCA 3R0QA 5DV9A 3WJAA 3CVUA 1V3QE 3K9HA 3ZR4B 2KB0A 1Q6YA 1UBNA 4UHFA 1Q92A 4IXMA 3FPSA 2PUCA 2XHEA 4OMFG 2BEWA 3E3AA 3DMRA 4QUEA 1EFKA 2UZ1B 3E7WA 1CXZA 4F38A 2WJAA 2AFIE 1BS2A 1P4SA 1Z25A 1OOEA 1T4CA 4GEKA 4MI6A 3KKKA 2FFBA 5CVDA 2A1TR 2JGMA 2YUTA 2ASVA 3WY9A 4L8GA 1BMFA 3CPEA 2VT6A 2QW0X 4TVKA 3CPHA 2BMAA 2C20A 2QZ4A 4UPVA 4EI2A 4YHBA 4XVUA 3V2HA 3LWNA 3DH0A 2PGAA 4KO2S 2NO1A 4LIPD 3HBLA 1M6YA 2FPGA 1FLVA 2X7XA 1QK3A 2ENUA 2X9GA 4R8VA 4TV9F 1I10A 2XUIA 2H2WA 3KEQA 4IAOA 3SJAA 1C8KA 1YQDA 5JBQA 3EG9A 1NBMD 2GRUA 1ZGGA 2B2XA 3D31A 3KB8A 4PQEA 4UW9A 5ERXA 4PYIA 2XA2A 4KR3A 1JILA 1W88B 4UHKA 3LYLA 1Q77A 4YJDA 2HR1A 4FCVA 2G72A 4EHLA 5EYPB 4I6GA 4YPOA 1TAGA 1BA2A 2N0SA 1E6LA 2WMYA 3B6KA 2JKYA 2Q27A 3O4HA 4MVJE 5LIRA 3TM4A 2GEFA 4IWNA 1VSUA 5JVDF 4W82A 4BECA 1OW3B 1E2PA 1G9SA 1RRFA 4RJKA 3TR5A 3E15A 5HJEA 1P2GA 1BD4A 3HYCA 5KSPA 5I7HA 2UUAB 1QH1A 2WJZB 3A32A 4MW7A 2O5CA 3AEUB 3TEJA 3A3OA 4DIBA 1W73A 3H2IA 2W00A 1GNQA 3R40A 1GG2A 4B6RA 1DNPA 4MV3A 1F2UA 2C9ZA 4KPGA 5EJAA 2V6BA 1C29B 5F64A 4TTPA 3RASA 1SUCA 4OQMA 3PI6A 2D5LA 2IP2A 5EZSA 4KPFC 5JYDA 4R6WA 4DPLA 4YR7A 1HGXA 5KAMA 3JASB 3PFGA 1V37A 4U6SA 3TWOA 1NSTA 1JF8A 1Y6ZA 2PKQO 3OF3A 4BO0A 4F4JA 1NU8A 3DMDA 3ZVRA 2HF2A 1YS2X 2FX5A 4MIOA 3AFIA 4OLJA 4GW3A 5EZYF 3WRXA 5K0ZA 1NN3A 2VUSA 3GJ3A 2H2FA 4EPVA 3TFWA 5KSYA 4GGPA 3DDZX 5HQ3B 1FFHA 2O3JA 4M37A 2GKSA 4R68A 1AKYA 5H59A 5AK5A 5TEWA 3RS8A 3JZIA 3OJCA 5ED4A 4X20B 2HA0A 2PRJA 3BYZA 3JWGA 4OXNA 3ZE2B 3O8RA 4G2NA 4DR3B 3OFSA 4JIMA 1L5QA 4CTMA 4QUIA 5DJ5A 4FMCB 2Q4OA 4BZXA 1L3IA 3MJSA 4REMA 1Y4AE 2VNKA 4FEYA 3OLXA 4DV2B 3OOHA 1IUOA 1K5DA 4ZC1A 3WE7A 3O9MA 5BT8A 2IBSA 4MUEA 1OH8A 2O7QA 3ZU5A 3G0BA 3HU1A 3VAZA 2QM7A 3AEQB 3A14A 2A1UB 1Y5RA 1AGYA 1QGUA 2OV6A 4JQYA 3WGQA 2YDXA 5HIJA 5KVVA 4H6WA 4JGBA 1F3OA 1GN9A 1PBTA 1PK7A 2UUOA 4HJRA 4PC6A 2CCJA 3G85A 2GM3A 1Y6RA 4TWZA 1IZ0A 3OZTA 5BOSB 2GGSA 3NBQA 3IVGA 4I1VA 1PI3A 2F43B 1ZXXA 4JI5B 3HVRA 1GA4A 4D97A 4HWRA 2B1RA 2PN1A 4RTMA 1LDMA 4ETMA 1SA0A 3WNQA 4QYSA 1ZIXA 4FNGA 2XE6A 3FNIA 5AMXA 2WHPA 2OCIA 5TVGA 1DQPA 1X7ZA 3VZBA 4HQ0A 2BEKA 1RLMA 1GXSA 1GT91 2QZZA 3WTBA 2B7BA 3LC1O 2BZSA 3EGDA 1KDTA 1QNFA 4ND5A 4RQUA 4Z1MA 2DUWA 4ZYZA 5B3KA 3DE0X 3EMDA 4QPDA 4U6NA 3AYZB 2REXB 4F6CA 1G6Q1 4W5TA 5F78A 3KOOA 5SY9A 2VTBA 4PANA 5KYYA 1CVIA 4F06A 2ZM6B 5K3BA 2BF7A 4YT5A 5HEKA 2C54A 1FSPA 1BMQA 3HY4A 4A8JB 1S89A 2VRWA 5JC1A 3V8PA 1AA9A 1CNEA 2BFCB 1QP4A 4KR6A 4MHOA 5DCUA 3TD6A 2HWXA 1AY0A 4QBHA 1SKUA 3GXBA 4KGDA 3A7DA 5K3CA 5LB2A 3NTOA 3OPVA 4ZI5A 3NKLA 5K7SA 3K71B 3WSWA 1CP3A 2DQ4A 3HFGA 3ZDFA 4N6GA 3H1BA 4ZA2A 3VQTA 3WDMA 1T9GS 4NARA 4XIJA 2OBXA 3LTNC 3F98A 1OXUA 3MNFA 5JIBA 1Q7BA 3MBOA 3H9UA 3RVBA 4KKXB 4TLLB 1DRJA 3EQ7A 1JU4A 1VZ3A 1LV8A 2PZBA 3C3KA 4UUQA 2ZAOA 5E8JA 1IN1A 3BXOA 5MDHA 1BRMA 1OWPA 5ITWA 3ONFA 3QFSA 4K26A 1ZJYA 3ODPA 2QTRA 4UVIA 3VSCA 2QTLA 1RFLA 1A8SA 1VCHA 2CHUA 2OT3B 2VUIB 3IX7A 4C7VA 3QU2A 1KSGA 1ZAYA 2HNKA 3ET4A 4RESA 4ZV7A 2PZGA 3AFMA 4R9NA 1NPYA 3HB1A 1LB1B 1V5EA 3PPVA 1ZM7A 1G3RA 1JH8A 3JQPA 2FCAA 4I50F 3WWCA 1IMJA 1J9ZA 1EBFA 2H7CA 2RB4A 3I8OA 3QLEA 4WA8A 2H63A 2JLAA 2WHQA 3RNOA 4LSMA 4KFRA 3CEPB 4TLEA 4C2UA 3LTEA 1JMYA 2F1HA 1Q0ZA 3MTDA 1G1MA 1HR0B 3KPYA 4RGQA 3G7UA 1ZUD1 1YE8A 4YCDA 3TE6A 3BSFA 3JVEA 1ZK1A 2GYWA 1V7ZA 1JHMA 2GPYA 2WKQA 4DNOA 1J33A 4EVIA 3RVLA 4HAZA 4LF4B 1LPAB 4IM7A 5CA0F 2XGSA 3RLFA 2P8JA 3ETDA 4QBIA 3FNRA 1CRLA 4U2KA 3EUFA 1JFLA 4U7JA 1B16A 3D6MA 1GNSA 1ZFNA 2JEOA 4DJFC 3SZOA 1LPPA 2WFMA 1Z06A 3SM9A 4C1NA 1J0BA 1J2RA 2E1RA 2LCIA 4BXOB 5GJCA 1A9OA 2BFFA 1MOZA 2F17A 2JA1A 4WIAA 1JS1X 4DAEA 1IK6A 2R8YA 3WL5A 1RZUA 3AFNA 3DFKA 3GCDA 2Q45A 4BLTA 3ELUA 2OA0A 4DRXB 1E9AA 3FNGA 2Q3FA 1T5SA 3LY5A 2X1MA 3B8EA 5TJHA 4ZQBA 1JQ5A 1M75A 3D7MA 2CEAA 2I3ZA 2AB0A 3EHDA 1KERA 3A4YA 3L8YA 3ANXA 1R0LA 4HNTA 4FQ8A 4G8JA 4N6OA 1P9NA 2O7VA 1TQ2A 2FMKA 1M2VB 1IATA 2HRBA 3I5AA 3VZRA 3DO5A 4RMHA 3M4NA 2PPVA 4JASB 1JR2A 1DQRA 3UPUA 1ZD8A 1H1LB 1R6TA 4GP7A 4J2OA 3E3OA 3H8VA 3LZDA 1WUIS 4GPTA 5AICA 4RIGA 1KSFX 5CNIA 3D2LA 1VJCA 5F4BA 4DIFA 4QATA 3FN4A 2HCFA 3K9FC 2GXAA 1V95A 1U02A 3HR8A 3LPDA 5DIFA 2YFHA 4HFJA 1QO0A 3KV1A 4MKHA 5B2EA 1GPKA 5AM3A 2JRCA 3ZH9B 1SBIA 4JELA 1PGJA 3IUMA 5L3SA 1BDJA 5G41A 4TTVA 2IXDA 1N2GA 1XG5A 2Y1EA 3EZ6A 4OFXA 3U1BA 2GUGA 1RKBA 3RTEA 5L7WA 1N6PA 4B9EA 4N76A 1F0PA 4MEAA 3KYCA 2ZYWX 3CZCA 5A0VA 3P9QA 1NDHA 3I6ZA 3BDIA 1X19A 2CVQA 1QTNA 2OZLB 3IP9A 1YC5A 2PQ6A 2D0OB 3W8DA 3PC8A 4V0LA 5HUQA 2GEVA 2C0CA 4P4GA 2F8MA 4J4HA 2W6JA 1X70A 2NUBA 3QVJA 4FOTA 4G9GA 4XJTA 4NENA 2ZSEA 3NT5A 4ZANA 3L4BA 4A03A 5CBPB 4AUMA 4HI0E 4TXLA 1VJRA 2JCBA 1B0ZA 1Y8QA 4WZZA 1Z4NA 4N7RA 4QULA 3KZXA 3RT1A 1XMOB 1DI0A 1V3VA 3CQ9A 3EBOA 3IKMB 2GXQA 1L5MA 2F3TA 2QORA 2RC6A 4H6VA 1OJ7A 4QHSA 3VTFA 3WAKA 2XOEA 4KNWA 2P77A 4J0GA 2DFPA 3VR4A 7REQA 2XNKA 3SXJA 3L07A 2O2JA 4FDVA 3TJRA 4EAAA 4O4JB 5KQLA 3RTAA 4WINA 2PYIA 1JIJA 1LSUA 2QMYA 3T5CA 4IKOA 2X8JB 4CL8A 2VHXA 1QP0A 1T4MA 3HDQA 3PL5A 5C8VA 1T10A 1IZ7A 1CVRA 1XNQB 1WCXA 4HPWA 4KIFA 1K4YA 3URMA 4M22A 1I6WA 3RSFA 4P81A 4R6XA 2Z5LA 3WQRA 1CUDA 1S01A 1U80A 2WILA 1UOPA 3HUDA 1PF7E 5EP2A 5I4KA 1F8GA 3GJ7A 4OVKA 4JLVA 3KE8A 4B82A 3SZLA 4CIDA 1DO0A 3KR2A 2WKPA 4KK3A 3SZGA 2QD4A 1Q7CA 2ARKA 1DVRA 1TU4A 1V39A 2CXRA 2XOXA 4Q02A 3W90A 1PNQA 4DDKA 1EE9A 3GD5A 4EI7A 4YA6A 2ONZA 3TMKA 3QUQA 3WKCA 4C5BA 1ISIA 3K70D 3ACDA 1YGPA 3CLUC 5KTPA 1EDEA 3G5TA 3QNMA 3WHPA 4WY5A 4UARA 4XGQA 5CT5A 5ALWA 2AYXA 3E0XA 1OLOA 2R6GA 5ESRA 3TQQA 4Y0AA 2XUJA 1C1HA 1F8XA 5SV2A 1EVZA 1PQWA 3DUFA 4BQQA 2HKIA 3EYAA 1W88A 2BHSA 1T8RA 2SKEA 4ENTA 1Z0ZA 2X0EA 5B1YA 5EYPA 3QHQA 2L42A 4PW0A 5DGCA 3RAPR 3SC2A 3DT6A 4O3FA 1YI1A 1CZOA 2O4CA 3I01A 4IHAA 4JB8A 4U9HS 4W99A 3RTBA 2C7VA 3WBKA 1A9YA 3ED1A 4RCVA 5JWOA 3RHFA 4FINA 4ZCTA 2IYRA 2REQB 1PE0A 3BMCB 2G17A 3QFRA 3NNNA 4NS4A 2QF7A 3NFYA 3OEHD 4YNBA 4P92A 4PIVA 1KDVA 5IYZB 1HFKA 3IAS1 2EQ5A 3P4UA 3OZBA 2QP9X 1EHIA 4YYEA 1YDMA 2IU3A 4RL4A 1NXOA 5DK4A 3RNLA 5IRCD 3O1IC 4RHYA 4WEQA 2OYSA 3IVXA 1XP5A 1A7KA 4N0QA 3I5UA 2WPNA 2CFRA 1KJQA 4AI6A 1W1UA 4EG5A 4YRGA 3N0VA 3IJRA 1IHUA 4IHJF 4PGMA 2FAXA 5L6LB 4HXFB 1Y5LA 1GA1A 3JASA 3O21A 4KVFA 3NJ8A 2BDEA 1SCUA 1NKTA 2D2IA 4Q18A 4EYQA 5EE0A 3SEQA 4B3SB 3CS3A 4MX8A 3IS3A 1QP8A 1UBSB 1XFDA 2GK6A 1RXIA 3CRVA 4PTLA 3VR4D 2YIMA 3IA7A 4G5XA 5JS8A 2QL6A 5IT5A 1VDMA 2HHLA 2Z2XA 4MICA 3TK1A 5IJ0B 2DQKA 2J08A 4BO3A 5HQ3A 1KC3A 1P33A 4X20A 1KI7A 1EUQA 1HV8A 4KO1S 4RDHA 3V8VA 8LDHA 2P9CA 4D6XA 1AHNA 4DAOA 1Q0HA 3O8QA 3T5DA 2AG8A 1SXJB 1Z35A 4KP7A 4UVEA 4DTCA 3WGTA 2WKRA 4EFLA 1E59A 1U28C 3O2SB 5F2NA 5FFMA 4ID3A 5ILOA 1TTTA 4PZDA 1SG9A 1TJ4A 2JCSA 4QTZA 3LKZA 5B58T 4ISCA 4BE9A 5JYBA 5HKOA 5CTAA 1V5GA 4K05A 1M2OB 4QBTA 5K01A 1DWOA 1ENZA 3V1NA 1QP7A 3KD2A 3QKUA 2VDQB 2QAJA 3AF4A 3KJXA 1P3JA 3IODA 4I1UA 1RI1A 4ZQFA 3W34A 3W6ZA 3AEQA 3ZHTA 3KSDO 4PZEA 2GLUA 1GPYA 3K2QA 3CVWA 3TX2A 5LXTF 1W5SA 4LECA 2Z5VA 4D4HA 3MSXA 4YQFA 3K0SA 2QS9A 3FTEA 4NDZA 4UDNA 3SIXA 2YIVX 4A26A 1JKIA 1V4VA 5BOSA 2IYLD 1N2CE 1EK5A 1KFCB 1KC1A 5H0IA 3SNKA 4BRZA 2F43A 1KEKA 3K0AA 2GHRA 1KSJA 3B20A 3RUHA 2I2CA 4D3YA 1GU7A 4A16A 5GZ3A 4B7ZA 1E4EB 3EFBA 2IYTA 3TLXA 4EA8A 2PA0A 1B7GO 1NP3A 2P2DA 3DZDA 5FJIA 1SU6A 1UKZA 3ESZA 5G2OA 7MDHA 2IW3A 1B3BA 4S1NA 1Z4JA 1KYWA 2E5FA 5AH0A 1K5PA 2ZAMA 4ZVTA 1FVXA 3R74A 6CHYA 1GSHA 3O92A 2AW5A 3UMGA 2ZUEA 4JVNA 5HMMA 3WKBA 5J63A 5JEEA 1E99A 4S0XA 3GELA 1M2FA 3VKVA 2Q4TA 1S6YA 1ZXLA 4KFSA 4HMOA 2XCIA 1KI2A 3NV9A 4OLFA 1UJNA 3B1VA 2WT8A 1VG0B 4XPZA 4L85A 1WF3A 1XNJA 2ZWMA 4KQCA 3RVDA 2GBCA 4MKRA 3VZSA 1OZ0A 2BFCA 1UXOA 2PJRA 3QNWA 1NLUA 4ZU6X 1QS0B 3GRRA 2V0CA 5C8YB 5M5BA 3IDZA 2JB9A 3IQFA 1O5IA 5CURA 5AK0A 4Y2GA 2FN7A 1EK6A 3G88A 2Z04A 5CM8B 4ZVNA 2AWOA 1P7YA 2GN6A 2IU4A 3IUBA 4NRDA 2ZUUA 2XDWA 2RHHA 4TL9A 1LY1A 2ZR0A 1NIJA 2G71A 1PQUA 2ZWIA 5J2TA 3C5VA 1M7BA 1PNTA 2MMGA 2FPXA 1JE0A 1OXTA 2MYTA 3DV0B 1LCIA 3FFWA 3A1NA 1A1VA 4LSGA 1VKOA 1SQ5A 3C4JA 2VDWB 3M49A 4EYEA 1NDUA 3HEBA 4JR0A 3LKBA 5GTDA 3IBGA 4OQXA 1D3AA 1EP1B 4CMIB 3AF5A 2MCFA 2ILTA 4HS9A 4RHEA 4FN5A 3KJHA 2GERA 2NYRA 3BGSA 2VCYA 3DBLB 1J9EA 2QQGA 3UJPA 1HDOA 1FFEA 1H93A 1KZ6A 1GZDA 2DUUA 1O4VA 1BS9A 1JTFA 4ZO6A 1D0SA 1G5QA 1VG1A 2W42A 1PR6A 3NHYA 4DLWA 4YPVA 4XOUA 4D74A 1CLUA 2J0SA 1SZJG 1TZMA 5A7GA 3VR5D 1X7XA 1WQ3A 3E2PA 3R4CA 4FS3A 3D0RA 4K0RA 5ALLA 2WKWA 4GPZA 3ZW7A 4F2PA 4GI1A 4YDQA 2JFNA 4E2XA 5M2QA 3U17A 1THZA 4ROSA 2PK3A 4Z9AA 2CYBA 4IFTA 5EXEA 4BEJA 4P31A 3LO5A 4KMRA 2XMGA 1GL9B 1PFWA 1SZCA 3K15A 4FZVA 4RFVA 2X9VA 4YAGA 2P68A 3ADOA 4K8OA 5JQGB 1EKXA 4PS1A 2JIPA 2GN1A 4S3MA 2AE1A 2Z3VA 1T8UA 1NMSA 5AHWA 1ECGA 3MJFA 3ZQ6A 3B5IA 2EKLA 2NTNA 3HHPA 4AMUA 1PYDA 1RCUA 4S12A 5CYOA 1H0KA 4BZQA 1B15A 3QX9A 5K6AC 1ADFA 3LCVB 1B6TA 3LO8A 3PFNA 3Q2KA 4KBGA 5F1PA 5FT9A 4ACAA 2I62A 1IONA 3UK7A 3NATA 1VE3A 2WI8A 3P0EA 4IDQA 2QMQA 2PRKA 1J24A 3ANLA 3GAAA 3JAWA 1AO3A 1GWNA 1W6RA 3RADC 2IH2A 4QGGA 3WMEA 3ON5A 4NZ9A 3RVOA 4B0OA 4DRXA 4D26A 2WWRA 4GECA 3FR7A 1OIXA 4KDFA 2V3WA 2HQSA 3Q9LA 3QEOA 4LK3A 4PPFA 2OMEA 1RWVA 5D01A 5BW5A 4CMKA 3ZY3A 1RPTA 4TTTS 1KR2A 1GNVA 2P2LA 4DG9A 3EH2A 3UK6A 4D6PA 4OLBA 1M2VA 1P80A 1ZHHA 2I6UA 2PUTA 2QLLA 3BQMB 2FW8A 3G68A 4N3GA 4YRKA 3H4VA 2ID7A 2X9NA 4LJ7A 3U1VA 2WWIA 1NVDA 1WY7A 4JLUA 3RWOA 3JCZA 4WY8A 1EUDB 4F60A 1XLUA 1H1LA 4B79A 4M86A 2REOA 1AQ6A 1C3EA 3DLAA 4IXNA 4P83A 4UMEA 4MPTA 2O14A 2VNSA 1OFIA 2R4QA 4UASA 4BPBA 1J1UA 1L8AA 1ZIPA 3PGVA 4MWBA 5FBZA 4B6FA 3ONEA 5CB4F 4WFIA 3K4PA 2VJOA 4Z4CA 2RH4A 3RVJA 1OFUX 2AI1A 3DAOA 3KLBA 4YI5A 4LY6A 2IV2X 3TKAA 1OROA 4MK4A 4BO2A 5LYJB 4Y2UA 1SOAA 2H4FA 1XVVA 5JTTA 2RMKA 2V3CC 4KLZA 2J0QA 1KBOA 3H5NA 4BZZA 4LDZA 3ZWAA 3C5EA 4OQZA 3CLTC 1LRJA 4QRHA 1M1ZA 2W2MA 5AW3A 1E6EA 3BHMA 3DDHA 4U7WA 3G6KA 4YGXB 3RHTA 2FMTA 3AEXA 1X1TA 4FSDA 5SY6A 2O8DA 1LBEA 3OP4A 3R44A 3RT7A 2ZDHA 2ZYTX 4V0OA 3KSUA 1T8TA 2CFIA 3SJBA 2NSJA 2JK1A 4PRZA 2QG6A 3RUPA 4DMRA 3L0CA 1K6MA 4ETNA 1NVMB 1A2BA 3CG4A 4RABA 4YR9A 5CBPA 4UEKA 4PSCA 3T6KA 1PFQA 2GD2A 3UV7A 3PXDA 5F77A 2EYUA 3NONA 1P4HA 1NE7A 3P71T 1N8KA 5HQJA 5CDFA 1CHDA 1KQPA 4RSMA 1DOAA 1E7RA 4I4NA 2VPYA 3ZU6A 3IDSA 3PZBA 3OPQA 4X90A 4JD5A 5EIBC 3C6QA 2DHEA 1WETA 3TZ6A 2KLHA 2G06A 3B1KA 4O4JA 4UMFA 5AJWA 3V42A 1QF6A 1EIWA 1RYFA 3BFPA 2CCGA 3C14C 1TUIA 4D42A 2ZT7A 4IGIA 3ZD8A 2O2ZA 4NBUA 5EIEA 1PT9A 4HDRB 2R6ZA 1NHGA 3JQEA 4N8DA 4NNPA 4QREA 3TNJA 4V3CA 4COKA 5JSZB 1MW8X 1ODJA 1BKDR 5DTEA 3VZCA 1HF3A 1ZM9A 2I7CA 5A9SB 1BX0A 3CE6A 3AOGA 3H9GA 4GOLD 4QGAA 4WDQA 5T4BA 1KMHB 3RVRA 4D9JA 3EF3A 3AF6A 5DEIA 4LZOA 2XNDD 4LGYA 4FSHA 1KJIA 1KQ3A 4JWTA 1E5DA 4BX3A 3ZHQA 4ZN6A 4HLUA 1H6BA 1T5DX 1SCBA 3G0DA 3ZQKA 5TMPA 4JKIA 1S8FA 5H02A 4EEKA 4JXKA 5BUSA 1KWKA 2CFOA 3JPYA 3HFJA 4MKGA 5IBQA 2GF2A 2XUHA 1I32A 4F9FA 3EQ2A 3UT0A 1OKKD 3HI6A 5FNZA 2A84A 3BRCA 5H7XA 3REGA 4X7BA 3A9RA 4UTXA 2H4YA 3I83A 4KXFB 2I2AA 1HT2E 3BMQB 3HJHA 1FMCA 3PF9A 3TZQA 4D0GA 3HCWA 2PHZA 1XZBA 4YAEA 2WW8A 1J8DA 2CMDA 2JIDA 3CX6A 4MVWA 4PFJA 4Q3DA 3RRZA 2YFQA 3M2PA 2FZWA 4BO8A 4F12A 2XOKA 1U8UA 4Q19A 4D5GA 1W7AA 3COYA 2CMKA 4BWVA 3RIHA 1BQ4A 3C1TA 4JBIA 1UJ2A 3EJWA 3RRMA 1NXPA 5ABPA 4K1LA 1ECCA 1XNHA 3RC7A 2QROA 3TSCA 2REQA 3BMCA 2FG7C 2QSZA 4RTOA 4NOKA 4HYQA 3GFTA 4W9NC 4DMCA 1PG5A 2H57A 2NAFA 2WYOA 1YDGA 4J4BA 1E7SA 2Y1GA 4MRSA 4O25A 3AP1A 3UB4A 1A9PA 3NTLA 4DLAA 4KRGA 4JLBA 1ILWA 1SIUA 2OCXA 2Q1UA 3GJXC 3LK6A 1YAHA 4HN2A 1UC5B 5T3UA 3TO5A 4C9BA 5JARA 1ZRSA 2O8BB 1A3CA 3OCYA 1LLUA 1QOPB 1U0LA 2WIAA 2PGDA 1W76A 3WAJA 2C1XA 3IIJA 2AGVA 4JEHA 3M9WA 1YS6A 4J07A 1MNAA 4O29A 5DEOA 4O3MA 4RHFA 2ACVA 1R16A 2GKGA 3WYCA 1MJNA 3WA7A 3CWCA 1L8QA 2CXUA 2OD7A 5EI5A 3OM0A 1XOIA 4LW8A 5JS1A 5C7YA 4EA9A 5IU6A 2HJWA 5CA1B 1QZXA 2O48X 5H70A 4BO4A 4DV4B 3BTUA 1MX9A 2FK7A 4CPDA 1UAAA 2ZROA 4D1YA 1VMDA 3GUHA 5JSQA 5IJ0A 4G0WA 4OBWA 4ER7A 4HG2A 3NNDA 2YXEA 3AKCA 1P5JA 1ZYUA 1HTWA 2IXAA 2HA5A 2Q2NA 4ALLA 3BILA 3T7TA 4CV3A 1SXJA 4EHJA 1R88A 2YR0A 1JDBC 4Y2TA 3BZWA 5D5HA 2OAEA 2XCOA 1JFFB 3I6IA 1WTAA 1W5FA 5JCJD 1OVGA 4FC6A 3WRYC 1R10A 3QVTA 4DUGA 3CH5A 3HXMA 1WMEA 4CMAA 2VG8A 1I1QB 2B4QA 5I7FA 2JL1A 1TF7A 5FUXA 3VU1A 3ESXA 1M2OA 2ZCVA 1WCV1 1XCPA 2QUJA 3AIIA 3T61A 1XLTA 3BSWA 5MN5A 2GTPA 3V7NA 4CCYB 3ZHOA 4UMDA 4CODB 5BXQC 1YMUA 4BC0A 1HLDA 2O59A 4LBZA 1UFKA 3IAUA 2GVZC 1DSSG 1NVTA 2C2MA 2ORYA 1AHPA 4N3AA 5CG2A 5SYAA 3WP0A 2QAIA 2C5GA 4TRJA 3UZUA 1U8FO 2JBWA 1GIAA 1WLYA 3ZZ1A 2XV1A 3FVQA 3PNQA 4AYWA 1PGQA 4L0DA 1G64A 1D6MA 3JZAA 4QT4A 5A5FA 5CXXA 2CXQA 3NHSA 5BORA 3CLKA 3FYUC 4UAVA 1ECJA 3T4UA 1E4EA 1USKA 1J70A 1FA9A 4UD2A 1JEQB 2XOKD 1EFTA 3LHDA 1RQGA 1U6JA 3HFSA 1OX6A 3K30A 4L6AA 4RQAA 4RVGA 3C45A 3FBGA 4IOMA 2UYOA 1Z7GA 1CJBA 4MWEA 1TLTA 4RKRA 3AUFA 4JU8A 3KKOA 1WBBA 1GQRA 5KOIA 2HSWA 5AWFC 5LD2C 5IAOA 1SVLA 1MRSA 2VSOA 3N6VA 4J0IA 3WB0A 4D4LA 2RC5A 3ENZA 3VNUA 4IGFA 1ADCA 3T1QA 1R4ZA