1HURA

Human adp-ribosylation factor 1 complexed with gdp, full length non-myristoylated
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
180
structure length
180
Chain Sequence
GNIFANLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLSNQLRNQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the human ADP-ribosylation factor 1 complexed with GDP.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
molecule keywords HUMAN ADP-RIBOSYLATION FACTOR 1
total genus 51
structure length 180
sequence length 180
chains with identical sequence B
ec nomenclature
pdb deposition date 1995-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00025 Arf ADP-ribosylation factor family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1hurA00
3EC2A 4LBZA 2ZETA 3CWZA 4AD8A 3G0HA 2JLVA 5KHOC 2KI5A 4LBYA 2QE7A 4EQ6B 4LPKA 3TSZA 2XNDD 5B57C 2F9LA 3CR8A 2PLFA 4DSUA 1OYYA 4DZZA 1AQYA 3U7GA 1ANKA 2QPTA 1PVOA 1CJKC 2B7CA 1ZJ6A 1D2EA 4JVNA 5LD2B 2KSQA 1ZUHA 2H16A 2WJJA 1H8HD 1WE2A 3WYFA 3Q85A 2F55A 5AJXA 4PC3A 1YQTA 1UBFA 4MUBA 3RRNA 5CDFE 4MRPA 2GK6A 3SBDA 3SEAA 2A7QA 2E87A 1NMZA 2QSZA 3GJ5A 1XZQA 5SZJA 2IYWA 2ZYWX 3VFDA 4BLSA 2ZRIA 2WKRA 4MRRA 4MRSA 4TMTA 4JLJA 2ECKA 5DI3B 4QHSA 2F3TA 1OIXA 2F43B 3G82C 4F4JA 1HEIA 4KCGA 1NVUQ 4BLRA 1ZUIA 2GEDA 3K9NA 3SQWA 2V8OA 4AWXA 3THYB 1Z08A 2HT1A 2F1HA 3L0SA 5FOTA 4RD0A 2KJQA 3CZPA 4EDHA 2H92A 2CCKA 3SZRA 4OJKA 1SVIA 2CL7X 4XD7A 1OH5A 3ZGXA 4JYCA 4RJLA 1US8A 4QGGA 1KSGA 4QOSA 3I5YA 2P6RA 4B34A 1P9RA 3ZQ6A 1N0UA 3WYGA 2ONJA 2Q21A 1DAHA 1G8PA 5FPSA 3CBQA 2GBLA 4P3YA 3PUWA 5G53C 3C5HA 2OXRA 5GJCA 4UNQA 1H8EA 2ZU0C 4LJ8A 3D6TB 4R7ZA 1KK0A 3P32A 1JBKA 3PUZA 4ZI3A 3TAHA 3QUSA 4CW7A 4ERNA 1B0UA 1XWIA 2QM7A 2QPOA 1XPRA 2B7BA 5TV2A 1HQYE 1L7VC 3VU9A 3RS3A 4YMUA 2PJRA 4LC0A 2V7QA 4NU0A 1RFLA 4ZDIA 1EFHA 4LZZA 2VP5A 5DO9A 4TLDA 2ZI3A 4M9ZA 2REOA 2PEZA 1SQ5A 5EE0A 2CEAA 5EZ6B 2IS4A 2OZEA 1F48A 3MWLA 3OIUA 5KNDA 2ATVA 4BFVA 1XJQA 1R7RA 2CJWA 2L0XA 5BYJA 1LFDB 4A0RA 1LVGA 2O8EA 4BQSA 4K46A 3TR5A 1NN3A 2C96A 2XZPA 1HE1C 1I2MA 4A8JB 3L82B 2IA5A 3FOZA 1W36B 2JJ2A 3ASZA 3H2YA 3O8CA 3SFVA 3NHAA 3ZIAD 2IYUA 1OSNA 1G5RA 2V1XA 1MT0A 4LK2A 1XPUA 1U81A 2O52A 2SHKA 3TE6A 1KZGB 4BEJA 5JWOA 1T6NA 4XIGS 2Q9AA 4DT1B 1T0HB 1KK3A 4ZCMA 1KOFA 4KVGA 3DZDA 1J90A 1DO2A 2KE5A 4JBWA 3UK6A 3NH6A 4Z54A 1VCIA 3RRMA 2MSDB 2UVQA 4XWAA 5A5GA 2ZJ2A 3LY5A 1G21E 3RRZA 3MFYA 1HT2E 421PA 1FQJA 3WHLA 1M74A 4CT5A 2EYQA 2F1RA 1RVDA 4XWKA 3UPUA 3TMKA 4EAQA 2A5YB 1II0A 3VR5A 4GRAA 4PR0A 3QXSA 4ZDJA 3VX4A 2ZRGA 1JPJA 2A5GA 1SULA 2J7PD 1T3HA 1IY2A 4JT4A 1C1YA 1E6CA 2PBRA 4LJAA 1E2FA 3D31A 2OO7A 1W0KD 1ZCBA 4RSGA 1AGRA 1DS6A 3FMFA 1RRCA 1W4AA 2VEDA 2OXCA 1BMFD 3NC1C 4LC1A 4ZV4A 1SVOA 3QG1A 4Q7LA 3K0SA 3U5ZB 1SKQA 1NLFA 1K5GA 1N25A 2W0SA 4BLTA 1N5IA 1YE8A 3AVTA 1IQPA 4DIDA 2WAYA 4A82A 4D4JA 5L3RA 4J0QA 3RHFA 2WSSD 5KPDA 1F2UA 4AI6A 2W6JA 1JR3A 4NBSA 3DOEA 3SQXA 1NNEA 4ZDWA 4V02A 1HYQA 4DEXA 4D4MA 4UJ5A 3BFXA 3RS7A 1ZP6A 4PANA 2XB2A 1EWRA 1MH1A 1XEFA 2VBCA 2ASEA 2X2EA 4PAMA 4AIIA 4LV6A 1E1RA 5AJZA 1ZNXA 1JQLB 3A36A 3QG5A 2ODEA 3RSOA 2R62A 2NO0A 1OIVA 2ODNA 4MKFA 4RCZA 1E9EA 1OH6A 4JKIA 2YZ2A 3VHXA 3ZJYA 3K0AB 2FJUA 3PEVA 2Z5FA 2X1VA 3I3SR 2A5FA 4DJTA 2IHBA 3RWOA 1XF9A 4D6PA 2QBYB 1Y63A 3TNFA 2J9RA 3EW9A 4QG7A 3L2OB 4UXHA 3OFND 3EAQA 1KHTA 1OLOA 3GFPA 3UG6A 3WMFA 2FEMA 1U0HC 3RLFA 4TQUS 3BB1A 1OH7A 3QEJA 1A2KC 2C98A 1IXSB 4OI2A 3T1OA 1GL7A 2XZLA 3QPUA 4PHTA 3KUCA 4TSFA 1NLZA 2IT1A 1TMKA 3E5HA 2J59A 3NBXX 4A9AA 4I81A 1Z0DA 1KO5A 4RD2A 1Z22A 1WMSA 1FQKA 2CVHA 3CNOA 3MJRA 1G7RA 5FL7D 3UATA 1GILA 1S2MA 3ZVLA 4IDOA 2ZRMA 3MRSA 5EE1A 5LB2A 3U7HB 1VYTA 4MGIR 1YRBA 1E99A 2YKGA 4Q9JA 2LKCA 2WWXA 1X3SA 4LHXA 4C3ZA 4WXPA 3VX3A 4WW0A 1T8UA 4C0LA 2HYDA 3KKMA 4EQ6A 4WXRA 1E94E 4JS0A 1IOZA 1K8RA 2PMDA 1NVVR 3GMTA 3FWYA 5KPJA 1IY0A 2BM0A 2VP9A 2VP6A 3S1AA 1MOZA 4OK6A 1YZGA 1P4SA 1TU3A 4Q1BA 4HLQB 3CH5A 3B1ZA 4TL7A 3P1JA 4KV9A 2NOAA 3PUYA 1QHNA 2QUZA 2WPDD 1PZNA 2YOGA 2RCNA 5HE9A 5SZHB 2QTFA 2IX3A 4CEHA 3CZQA 3BOSA 4F4IA 3A1UA 4EFLA 4KSBA 3RAPR 2VF8A 3GJXC 1IHUA 1ZM4A 3B82A 4URWR 1E2DA 3DMNA 4IVPA 2QAGB 4O25A 2EW1A 2VYFA 2C9CA 3LV8A 5JEEA 4ZKEA 5J5CA 1FNNA 2JIZA 4EPXA 3HPRA 5LD2C 4PC6A 2HCJB 1AM4D 1KJWA 4IVRA 2J3EA 4TMVA 4MRNA 1IAQA 3OAAD 5FTLA 2GJ8A 2CHGA 221PA 3R9IA 2GZAA 2EU8A 4UKDA 1U9IA 4HZUA 1KYIA 1RYHA 2ZS9A 3Q9LA 4DXAA 3GLFB 4JL6A 1ZRHA 3QVUA 4R98A 4FMCF 2XXAB 5IF9A 4MKHA 3ZD7A 2AFHE 4HB2A 4EIWA 4WZ6A 2R8RA 1SKYE 2PZGA 1R4AA 2OFWA 4R9UC 2CDNA 3WNDA 1E2IA 3KQKA 2GWHA 3ZIAA 4A0GA 1R0WA 2ZE8A 4DRZA 3ZVRA 5DLQC 1EFUA 2O8CA 3K1JA 2IYZA 4QJ5A 1II8B 1S9HA 2LWIA 1XNJA 1KI3A 5DN6D 3KQNA 4LJ7A 5HZKA 2ZE5A 1GG2A 1NP6A 2YVUA 4Q47A 4PPQA 2NG1A 2WSMA 4HB3A 1KAGA 2FFAA 2QI9C 3T1TA 3CRQA 4AG5A 3I5XA 2ZTSA 3THOA 4V0ME 3JZMA 1W0JD 3LVQE 2G9NA 3FVQA 1GFIA 2YWHA 2FFHA 3EPKA 3SNHA 4IXMA 1Z6GA 2WJYA 4OHVA 2KWIA 2IYRA 5TARA 3W6OA 4WZBE 2V3CC 4YMVA 2DWPA 5FUWA 4KLZA 2YJTD 3KZ1E 3PUXA 4E03A 4CF7A 1JECA 2CHQA 1W46A 4QXAA 1ZM3A 2JLUA 3ICEA 3AGQA 1DO0A 1MO5A 3VNVA 1L2TA 2EFEB 3U4QA 5JBQA 5IT5A 4DB4A 1JXOA 5AUQA 4GOJA 5TVKA 4BE7B 3AUYA 1AS0A 3X1ZA 5CJ2A 5IRCD 2R6GA 1RE0A 2ZROA 1J7KA 3GCGA 2H18A 2FH5B 4PHFA 2GCNA 3DDCA 4P0TA 1LW7A 4G5QA 1G4AE 3WNCA 3CO5A 4PHHA 1DEKA 3DM9B 2XAUA 4KU4A 2RHMA 4YXWA 2CJWB 4HDCA 3CB4A 2WSSA 1NVWQ 2YINC 4KI0A 2J41A 3RS2A 1E2LA 4A8JC 4ABYA 1UAAA 3JVUA 3OF5A 1G3QA 1F6BA 4G5SA 1TQ4A 4RCYA 1YZUA 1ZC4A 2ZAMA 1V43A 4D4KA 4KITB 4B43A 3RDPA 4AYWA 4JVLA 2F7SA 4I1UA 3OZXA 1E0AA 4US0R 2D7DA 4GT1A 5CK4A 3VU9B 4YC7A 1LS1A 2Q3HA 4Q1CA 2G77B 2GAAA 1F3OA 1GNRA 1VIAA 1H8HA 1TEXA 3MD0A 4QHYA 4R2IA 4II7A 2YOHA 1BYUA 1G8HA 4A0FA 2GXSA 4HZUB 2P5TB 3NH9A 3KTAA 1Q21A 3UKDA 1XEWY 1D9XA 1F2TA 2Z83A 3AF4A 4KBFA 4YMTA 5DI9A 1U0LA 1P3JA 2DFNA 2FU5C 4IOJA 4UNNA 3FFAA 2YC2C 1QG4A 4NCNA 3REGA 2GXAA 5LDDC 4XH9B 1Z3IX 2C8VA 3KB2A 2CHVA 4QM6A 2BJWA 4Q19A 3NEYA 2IEYA 4P33A 4URUR 1A2BA 2NIPA 1D2NA 3BFVA 5EP3A 1Z5ZA 1VDZA 4TTRA 4NZYA 2CL0X 2PT5A 4QM7A 2WWFA 1GITA 2IHYA 4QJ3A 3RABA 2JDID 3ZH9B 5FPKA 1F60A 4JLPA 1NMYA 5FL7A 2P67A 3FHOA 4HAZA 4PPFA 4KSCA 4TLCA 4HLUC 3ICQB 2BWJA 1LB1B 1M7GA 3QKRA 1DAEA 3QY0A 4IDNA 4MYCA 1P60A 2JA1A 4A0HA 5F9FA 3CH4B 2RGEA 5C2JB 4OK3A 4E5UA 4IOMA 1CJMA 3TLXA 3VR1A 1RPZA 4ARZB 4XSHA 4BWYA 1W1WA 4UXJA 1W4CA 2FFBA 5KSPA 1WXQA 1P2TA 2YOFA 2Z6VA 4DWJA 1CBUA 2AHOA 4HDOB 4E22A 1N6OA 3SYLA 3RNLA 3F3YA 4M1SA 2XOKA 1A7JA 3ZD6A 2ZE6A 2GF0A 4IHQA 3SDZA 1IM2A 2W58A 4IOLA 1Z6XA 3U3MA 2XXAA 2QRNA 3CR7A 1HE8B 1IY1A 1E9SA 3A58B 5CYOA 4PXAA 1XTKA 2RGDA 3O8RA 3HP1A 2BKUA 5FOVA 4ACBA 4OQFA 5CITA 4Q7KA 2R9VA 2R2AA 5UKDA 2FNAA 2BMFA 2FX3A 3QOFA 3GLHA 4X8OA 3U6BA 3OIVA 2EYUA 3ZDQA 2Q3MA 4PO9A 1YZKA 4DDVA 1CJVC 4Q9HA 5DISB 3VKHA 3IHWA 3QPVA 3R8CA 2GCOA 5JI2E 1YRAA 5JS8A 1RYFA 1G5TA 2QAGC 2VHCA 1DG3A 4A1FA 4I1VA 2ZS8A 2OCPA 3SYNA 3NG1A 3THXA 2HJVA 2PLRA 4PSAA 3K09A 3KX2A 3SC3A 5E95A 3CRRA 2GCPA 2F9MA 3HDTA 4QBFA 4GP6A 4KYIB 3T34A 4JLAA 1D9ZA 1VIYA 1CF4A 1XTIA 4NCHA 2JJ8A 1LF0A 4M1YA 1NSTA 3EIHA 1S1CA 3KQLA 3CWQA 1QHHB 1DOAA 4C0JA 2FG5A 1U8AA 2LKDA 4RY2A 1E4VA 1ZIPA 3LFUA 4BFTA 4US2R 2OE2A 1LNZA 4FWIB 2CLSA 4UNSA 2JASA 3KQHA 1CXZA 4KJZA 1JAHA 3AEZA 1QF9A 3ONWA 4M21A 4MKGA 3RWMB 5JJKA 3K9HA 3FTQA 3ZLJA 4AY2A 3BS4A 4Q1FA 5G41A 5KOYA 1RC8A 4BRWA 1YR7A 1TPZA 2WMNB 4TZ6A 1XMSA 3EA5A 4DCUA 2BV3A 1JEDA 2LCFA 1QHIA 2FSGA 4LCBA 4D26A 3P20A 3L8YA 4R71A 2WWGA 5DIFA 4LBWA 2WICA 5JFGA 2VHUA 1FL9A 1UBGA 2D4HA 1AKEA 3REFA 3CONA 4C0KA 4LV5B 3L43A 5AR1A 2QQ0A 3VQTA 4QC2A 1HY3A 1W4BA 1UF9A 2OCYC 4BASA 4ESVA 4Q7MB 3DZ8A 4TYWA 2QN6A 2J0QA 3T35A 1ZW6A 5TDHA 4MRVA 2WV9A 1JR3D 3LX5A 2J0SA 4N0DA 5EXTA 4AURA 121PA 2X8AA 2WJHA 2B8WA 3ZS9A 3VR4A 4JL8A 3K9LA 1EFRD 3QSYA 1E0SA 2PMKA 2XTNA 1E4YA 1VHTA 4Q4HB 5FPHA 2RKOA 4RKFA 1XDBA 3W8NA 2ZUCA 3AP3A 1SKYB 4WIAA 1IN8A 1KNQA 2G0NA 2QTVB 3AVOA 4L9WA 3WRYC 1KK2A 1ZAKA 4OBEA 3ND9A 2WM9B 2DWOA 3FB4A 3RC8A 1WDTA 3K8YA 5EP4A 1IN4A 3KJGA 3ND8A 1R6BX 5J4LA 2ZYTX 1DELA 3CPEA 1G6OA 2JLXA 2WAXA 2HXYA 1YVDA 3KKQA 1IXZA 4A6PA 4DDWA 5IK2D 4PPNA 1ZD9A 4US1R 2VO1A 2F1JA 4ASUA 1MABB 1RIFA 1PJRA 3I1FA 2QAGA 1U2RA 3I8XA 4HLUA 4MGKR 1NMXA 2C95A 2A2ZA 2IS6A 3GD7A 1TL7C 2PL3A 2QL6A 4JVSB 2PT7A 1HUQA 1NLYA 1EX6A 2QY9A 4Z51A 4ZIRB 4L4UA 1QHXA 3QNUA 1Q22A 1ZVQA 3GLGA 3O47A 1N0WA 1PLLA 521PA 4DLRA 3PFIA 3R8FA 4A36A 2HEIA 2QU8A 3D3QA 3NDBB 1TF7A 1BO6A 2WVJA 5HTKA 4LYAA 2J0UB 4FIDA 1OB5A 4AKHA 2AWOA 4TLBA 1GL6A 1YHNA 3TAUA 5TB5A 3VTKA 1OKKD 2XGJA 2QORA 2ODBA 1N0VC 1P2VA 1Q1QA 5KNCA 4C2TA 3PUVA 2AK3A 4F92B 3SN6A 4EFMA 1E79A 3W34A 4XSGA 4LYJA 3CM0A 1U98A 1D5CA 1ESMA 3HR7A 3HYRA 3P4YA 1WP9A 3WBKA 4BFUA 2EFDB 3RYTC 2ZRHA 2HLDA 4GZMA 2JDIA 4G5RA 4D25A 1XTSA 2TMKA 1U94A 3E70C 5JCZA 1JQJC 4AC9A 4NYIR 3U3JA 2YV5A 2ZRFA 3TW8B 1VPLA 2A30A 1E2KA 4TQAA 3BD9A 3IPXA 3PCRB 4LJYA 4XTRA 4ZDKA 1ZM9A 3ZZTA 4Z8XA 2AWNA 4V03A 1KDTA 3A1VA 4K81B 2O5VA 3T5DA 3ZQJA 1EGAA 4JJZA 2MSEB 5JHHB 2IF0A 3L0OA 4P4UA 3TKLA 1KY2A 1N6LA 2JIZD 1M34E 3TJZA 2ZI5A 3U4QB 8OHMA 2YHSA 4D0LB 3EPHA 3K0AA 1RKBA 2BIFA 4M8NE 1GUAA 1XTQA 2DFTA 5BQ5A 1XZPA 2C2HA 3BH6A 1V5WA 1TAGA 1M8PA 1R0ZA 1HA3A 1G7SA 1W49A 3R20A 2WOOA 3LDAA 3GJ7A 4N3NA 3K70C 1CR1A 1GRRA 4OHWA 2C77A 2VA8A 4A4DA 1FW6A 4F38A 4JZKA 2IYQA 3AVQA 1SVMA 1UKVY 3D7MA 5BWMA 1J70A 1DAKA 2BCGY 2R65A 4Q9IA 4RD6A 2R6AA 3CKLA 3GLIA 3TUZC 4LI0A 4TYQA 1Z0IA 5G3ZA 3I72A 2ZI7A 1R5OA 1R8SA 4Q18A 5M04A 4C0QC 2VQSA 1T91A 5B58C 4NPHA 4B32A 2O8EB 1GNPA 4O2RA 3BWDD 1P61B 4TT3D 2QMUA 3FHCB 2VSXA 1XJ0A 2J7PA 1DAMA 2AK2A 2OM2A 3QXJA 2W2TA 3G5UA 4LSGA 1J8YF 1QHGA 1KKLA 2NO1A 1WRBA 1BMFA 2JGNA 1X8KA 3TQFA 4D81A 1R10A 5DNYB 2RGGA 4KFUA 2CLDX 5D3QA 1LTQA 1SXJD 3NTUA 3GLIB 1FTSA 3T1QA 4TMWA 2IUSA 2GF9A 2GK7A 3AF2A 4WBSA 4A6XA 2W6JD 5CYPA 4ZCIA 4C7OA 1E2MA 3RRYA 3SJBA 1X8LA 4FN5A 5IDVA 821PA 3KJIA 4Q1DA 3FYHA 2Z43A 4U7DA 1U8YA 4Q9LA 3QI2A 4CIDA 1JR6A 2IXEA 3T1VA 2WOJA 3OIWA 2ZYUX 4ZPXA 4MQBA 4RZ3A 1E1RD 4DBLC 1N6IA 3EZ2A 1Z0AA 3L0PA 4C0SA 5E7MA 2ZRLA 4N1AA 4KLNA 3K0FA 5B30A 1MRNA 1R2QA 1PUIA 5H70A 4OQNA 3EX7C 3QKSA 1QHHA 1WA5A 1VECA 1N6HA 3EZ7A 4TMKA 2MSCB 1ZU5A 3EARA 4I99A 3QKTA 1EK0A 1KNXA 4C4PA 4W9MC 1AKYA 3NHBA 1QBKC 1DPFA 2QMOA 2VSFA 1W5TA 1ELOA 1NSFA 4QRHA 2FSFA 3UMSA 5EUQB 4BUJA 2ZRCA 3DM5A 3HYTA 4YDHB 3K0EA 1GVNB 2A78A 2GZHA 4TSFD 1UBEA 4KODA 4JLNA 1NIPA 3MWKA 4QKQA 2AX4A 2ZI4A 4M9XA 2XJ4A 5FR2A 4TTPA 2IBMA 2ZI9A 1UEJA 5J4YA 1HURA 1T3LA 1WBBA 2ZUDA 4ASUD 1OPXA 4KAXA 3AVXA 4A15A 1NG9A 1P7CA 1M1YE 3CX6A 4QNRA 4OQMA 2D62A 4KBGA 4B2LA 1KSFX 2ZXUA 1LY1A 3B1VA 1GKIA 2RAPA 2G83A 4P4TA 4AKEA 5C18A 3GJ8A 5F98A 1Z6YA 4XVQA 1I2DA 4HAUA 2QBYA 3WBJA 1TF2A 3H86A 5FL3A 3QENA 3VAAA 1ZMXA 1OHHA 3QF4A 4M1MA 4DLSA 4ESHA 1W5SA 1S4QA 4PAQA 4GOKA 4PSKA 1CIPA 2QMHA 3Q7PA 4B74A 3BH7A 4BEBA 4FD2A 4AK9A 5C4GB 1HV8A 2HF9A 3AKEA 4M1OA 4Q66C 1XTRA 3S1AB 4B6FA 1G3MA 2ZEJA 4MGZR 3KXLA 2XX3A 2B8TA 3A1WA 1VG1A 2DWQA 3LVRE 1AS3A 3ZYCA 2OCBA 4HAWA 3GLFA 2F3RA 5TXGA 4IFBA 2OILA 4JLVA 2FA9A 2P6NA 3I32A 2FN4A 2V55B 4B75A 2IW3A 2VTKA 2XITA 4URXR 1E9CA 5K8IA 3NBYC 3X1DA 3DHWC 4LY6A 1G16A 3MWJA 3T15A 1AZTA 1XMIA 4P31A 2BKEA 5J47A 1KMQA 1JAIA 3KL4A 2IYTA 2Q6TA 1NJGA 2PZFA 2GZDA 2GEUA 1VHLA 4RZXA 1E2NA 1NN0A 4Q4AB 1TADA 3P4XA 1FMLA 1E96A 1W4RA 4IFEA 4URVR 4M1KA 2QP9X 2MMCA 3B5JA 4LJ5A 5CIQA 2C78A 5L8VA 3U6KA 2NQ2C 1OXXK 3A37A 3HWSA 1BKDR 1TNDA 3CNNA 3MLEA 3NKVA 4O2LA 3OEHA 4YLGA 4CZ2A 1AZSC 2IXFA 3N70A 4G0NA 3OESA 5AK0A 1JJ7A 1QDEA 1G8YA 4TL6A 1X1SA 3V4RA 1X6VA 4GSYA 2J0UA 1RZ3A 2IWHA 2KBEA 2JLYA 4NYJR 2HV8A 3GLFE 4G5OA 1UM8A 2OT3B 1MV5A 4GOXA 4QGAA 1N6NA 2ORWA 1XU4A 5AUPB 4DHEA 4XTCS 5EJEA 4BGDA 2J45A 1OFIA 1SVKA 3OIYA 4IOKA 5FPYA 1XD2B 2DFLA 4POAA 4NP6A 1UFQA 2DY1A 4TLAA 3KJEA 1TQDA 3DKPA 1KDOA 2J0VA 4LYFA 3LW7A 3THYA 2ODWA 4QL3A 4O3MA 3TK1A 2OSBA 2XSZA 5EUMA 4C7OB 1MRSA 4PZLA 2QGNA 2NPIA 4ZI2A 4G5GA 3IPYA 1XD8A 4AKGA 4HUQB 2FPKA 4BPBA 1RJ9A 3KKPA 5FOSA 1E9FA 1CRQA 1GP2A 1XRJA 3LBIA 4PZZA 4URZR 3SJAA 4TQ9A 5FTMA 5C1BA 4DCSA 2CNWD 3C14C 1VYVA 2H17A 4IDPA 3GEEA 1UKEA 4B3CA 1HTWA 1AIPA 4C0BA 4QBGB 3IIKA 2D2EA 4L5BA 3PEUA 4LX0A 4U02A 2A3RA 2OLJA 1IN7A 3X1YA 3IKJA 3W8RA 1SXJA 1E9BA 2NPFA 1UKZA 4EJSB 3KXIA 2BBSA 2DBYA 2ZVPX 4JSTA 2VP4A 4YXWD 1S3SA 2V9PA 5CB8A 3I4LA 2IYYA 2QZ4A 3CF0A 2HXSA 2WJVA 2O0KA 1WCV1 1OFTA 1GKYA 1K6MA 3GJ6A 4TMZA 1ZC3A 3LAWA 4IJMA 2FZ4A 4KFSA 3U60B 4QBHA 5LBIA 4DLTA 3OHMA 4TTQA 3OFNA 2AD5A 1G20E 3SJZA 4DEYA 4L9SA 3B9QA 621PA 1H65A 1W48A 1NY5A 5GVRA 2ZU6A 2BBWA 4JLOA 4A2QA 2OBNA 5FPTA 4BECA 3N2EA 4H9GA 5DE3A 2YYZA 4Q02A 3C16C 3BC1A 3KUDA 3GQBA 4G3XA 3V9PA 4HEJA 3K9GA 4EPVA 1KI9A 1M6NA 3NC0C 4PQFA 2OUKA 2K5UA 4XOIA 5FTJA 1EFTA 1Z6AA 2D2FA 3SE0A 5LPNA 2OV2A 2RGAA 3TVTA 3GLHE 4V0KA 3CNLA 1SHZA 4OI4A 3V00A 3KFVA 3EIEA 4JT2A 4M2LA 1B23P 1OW3B 2CE2X 1TQ2A 4RFSA 3BORA 3QQ5A 4PSVA 1KO1A 4X8LA 3QBTA 3QF4B 4B44A 1FX0B 1E32A 2B6HA 1G3RA 2N42A 2OFOA 2VSOA 1YJ5A 1DADA 2ZUBA 3CF6R 4I1OA 3QEOA 1YZQA 4DC9A 4PFSA 4KFRA 4XVRA 5CK5A 5BYKA 5FOXA 2FDCA 1VCNA 3E2IA 1YZLA 4ZCLA 4Q4LA 1QVAA 3BIFA 2O0HA 3MGCA 4X8MA 5IHPA 5FI0B 2IUUA 4H1VA 4JIMA 4TZ0A 6Q21A 1Q44A 2ZRBA 1NVXQ 5ANRB 2VP0A 5TMPA 1EXMA 1Z07A 2RMKA 4JLBA 1W2HA 3IDQA 1UJ2A 1N5KA 4C0HA 2CK3A 4CYMA 2XOKD 5SZKB 3SJCA 2OCAA 3HR8A 1L4UA 3DPUA 1A82A 4C9BA 4B6EA 2IEZA 4NE2A 3IILA 1GM5A 3KXKA 3NBZC 2R6FA 4RFVA 2EFCB 1ZD1A 4WAUA 2R6CA 3BB4A 3E1SA 2XJ9A 1XBTA 3BB3A 5JJLA 1J99A 1TUIA 3BH0A 3NEJA 4BZXA 2VHJA 3GEHA 3SU8A 2J1LA 3BGWA 2REBA 1UPTA 2FWRA 2IS1A 4EPYA 3CX8A 1E2QA 1P9NA 1S9DA 2FGKA 3DO6A 4JLDA 1KJZA 3F8TA 4HDQB 1CJTC 1AN0A 3SFZA 1E2GA 4M4SA 5DN6A 2O8FA 2BDTA 5BN4A 1E1QA 3WRXC 1Q1BA 3C8UA 3AGPA 1AGPA 4OI0A 4IW3B 5DGXA 3L8ZA 5KSZA 2AXNA 1NBMD 1D8TA 1XEXB 2ZSAA 3C4JA 1YU9A 3OEHD 4QHTA 4RD1A 4TWZA 2OLKA 1N6KA 4D0NA 4FMDB 3GPLA 3F0TA 1P72A 2WZQA 1JI0A 2FE4A 2IXGA 3QF7A 4MH0R 1UKYA 3T06B 1G8FA 1G7TA 1M7BA 1SXJC 2ZQ5A 3FKSD 5CIWA 4EPWA 3QKUA 3WMEA 1JXMA 3ADDA 2HUPA 3W6PA 4P32A 3R7WA 3VMFA 3FKQA 4YDSA 3WY9A 4G1UC 1I4LD 5FTNA 3AF3A 3DKVA 5AWFC 1KI2A 3TQCA 1KIMA 3EZFA 2OBMA 4LDJA 5HKKA 2ZREA 1CULC 1OXTA 2QT0A 3A1TA 5K8TA 1A1VA 1P2SA 1XEXA 1BYIA 2X2FA 4OKSA 4RZUA 4CDGA 2P0EA 3RS0A 4PHGA 1T8TA 3A4MA 3CX7A 3AM1A 2V6JA 1YKSA 3SBEA 1US8B 4L16A 2AN9A 1XXHB 4A2WA 4HI0E 3M6AA 4HATA 3U7FB 1N6RA 2HT6A 4MITA 1TTTA 5EQTA 3RS4A 5G40A 4IEIA 1Z8FA 2OG2A 3QE0A 4UJ3A 3U3KA 1XXHE 2ZJZA 1EFRA 3C7KA 3EZ6A 2CLCX 3QXHA 1GTVA 4W5JA 1NKSA 5JRZA 3H0KA 2RGCA 2PH1A 3CRVA 1N5LA 4R2HA 4WA7A 4B47A 1G3IA 3HPQA 2O8DA 2VL7A 4LWZA 3VR2A 2DCUA 1RW4A 2G3YA 1VKJA 1E69A 3DEFA 3W6NA 4ZIRA 1DG1G 2GJ9A 4AKIA 4LPSA 4KO8A 1G291 4QFMA 4C30A 4BLPA 4Q01A 3ECCA 4N0EA 2RB4A 3ZVNA 3BE4A 4OHZA 1TQ6A 2EQBA 2WKQA 2KB0A 2PZEA 3LBHA 4D2IA 5IK2A 4G01B 3U44B 1ZCAA 2RGBA 1BIFA 1QRAA 2GEVA 2UZ3A 1IN6A 2QE7D 4DDUA 3W5IA 3B7GA 3MMPA 4Z8YA 2FMXA 3LRPA 2IC5A 3EC1A 1G41A 4V0OA 3TSOA 3CPJB 3W9YA 2A5JA 4P4SB 3FE2A 4EFNA 5AUOB 3EA0A 3TH5A 2YWFA 1VG0B 5P21A 2Q9BA 5A0FA 4W5HA 4MYHA 4LOAA 5AJYA 1KO8A 5CLQA 3K53A 3TIFA 1U8ZA 1YR8A 4IEEA 4BFSA 2FOLA 4LBVA 3B9PA 4DSNA 1DE0A 4FI3C 1XCMA 1TEVA 4Q4AA 2GXUA 3H4MA 2YWGA 2YWEA 4EKDA 5HZHA 1RRPA 5HCIA 1CR4A 3SI7A 2NO7A 1ZD8A 3V4FA 5EP2A 2GRJA 3KKOA 3N5CA 1TF5A 3GJ3A 1KGDA 2IYXA 4BFWA 1Z2CA 2VP2A 3LA6A 1GDDA 4LYHA 4Y0AA 3CIOA 3L0IB 2GDJA 4W7SA 3WNBA 4XD7D 5A4JA 2HLDD 2DHRA 2O8BB 4DUGA 2ZSBA 4TMXA 3CLVA 1MR3F 2PEYA 1KI6A 4KYUA 2YNMA 4V0MA 3PVSA 5CDFA 4B71A 1KI4A 2WIAA 2GVZC 1D6JA 1M7HA 1YZNA 4BFYA 1IN5A 2BVNA 2R6DA 4CGZA 4HLCA 4M22A 4IDHA 4HAVA 3Q3JB 2BEJA 2REXB 4TL8A 1C4OA 1OFHA 1CR2A 1S96A 3LWNA 4FCTA 3PEWA 1E9DA 2ZSDA 1Z06A 3AUXA 1G3UA 4RVCA 4ON9A 4PC2A 1CS4C 4LHWA 2ZRJA 5ELXA 3M1IA 2CK3D 3W5JA 3QVVA 2QQEA 2Q9CA 1OB2A 3A8TA 4PQYA 2ZR7A 4FCWA 1DARA 1GAJA 1QVRA 4BFZA 4CEIB 5FBRB 3CUEF 1EESA 1JNYA 4MDEA 2P5SA 2XB4A 5KUTA 1G4UR 3AVVA 1ZU4A 5AUNB 1DAFA 3FGNA 5KDLA 3TW4A 4CVNA 2EFGA 4L15A 1KAOA 2ZJOA 1Z2AA 2XNSA 3TVDA 1LV7A 3RS5A 1ZNZA 4TLEA 3R9WA 2ZE7A 5AJVB 4EJSC 2UKDA 5KYKA 3IO5A 3Q7QA 3LLMA 1GKUB 1A4RA 1X8JA 1NN5A 2VPPA 1NY6A 3QIAA 4MGYR 3UG7A 1ZNYA 4RFSB 4TT3A 2ZANA 2A5DA 3OE7A 3IGFA 5JS7A 4URYR 3THWA 4CEJB 4CEIA 3WMGA 1AS2A 3AQ4A 3B8HA 2ZRDA 4JSYA 2C03A 2P65A 3MUFA 2ORVA 4B3BA 4DVGA 2WWYA 1CRPA 4ACAA 3IQWA 4OQXA 3CRMA 3HJNA 3OEED 2FPMA 4HB0A 2ERYA 2O8CB 1E0KA 3W3AA 1LS6A 1KSHA 4AYXA 3ZVMA 4LJ9A 1KKMA 1G64A 1R8QA 1VCMA 2H8KA 4XWOA 1GNQA 2XSZD 1G18A 4PC7A 1WF3A 1XD2A 5GADl 5E3HA 3KKNA 5GJBA 2P6UA 3FKSA 3MAAC 2ZI6A 1Q0UA 1R0YA 2G88A 1NI3A 1XPOA 2CXXA 2VHQA 3C5CA 4JKYA 4RZ2A 2IYLD 1XFAA 1OF1A 4MDFA 4OHYA 5K8LA 3DVLA 2P3SA 4QNMA 3NIBA 4IDQA 5E7IA 5CB6A 4FCVA 1E3MA 1W2GA 4LUCA 4Q48A 4UXIA 4DSOA 2I3BA 4CT4B 2CNWA 3GJ4A 1W0KA 4C2UA 1OXVA 4O0MA 2W6IA 1Z0KA 1N5JA 5FUXA 1KMHB 3BERA 2GTPA 4A8JA 1AA9A 2GNOA 3FHTA 2GXQA 4Q4HA 5KSYA 3SR0A 4TYNA 1ZNWA 3SS8A 4D4LA 1RRFA 1F2UB 5DYIA 1ESNA 3IUYA 3RVBA 3W90A 2FFQA 5JEDA 1JEEA 2QP3A 1VG8A 3GP8A 1W7AA 4TYYA 4Q4JB 1ZBDA 2BMJA 1P5ZB 2Z4SA 4CEHB 3K0CA 1BOFA 1F2TB 2NO6A 3X1XA 2ANBA 2BOVA 4LHZA 2ZITA 3GLGE 1XMJA 4Q21A 1X86B 3PV0A 1BH2A 4JL5A 2ZIAA 2WWIA 4MUAA 1L8QA 4S35A 5L3SB 1LF5A 3RANA 4DIEA 3GLGB 4HAYA 1WBDA 2N1BA 1OH8A 2OFXA 4JBXA 4B3DA 4UNRA 1FNMA 2QP4A 2IL1A 1S0UA 2IYVA 1U9IC 3PQCA 3LXXA 5JZVA 5KDOA 3EXAA 2V4ZA 2ZR0A 2IF2A 2QPAA 1U0JA 3MG9A 3ADCA 1MO4A 3ASYA 4ITRC 1NVVQ 1TUEA 1M2OB 3SHWA 3UANA 2F1IA 1Z47A 1ETUA 5GJVC 3CW2A 3I73A 2OAP1 1N3BA 3LQRA 4D82A 3LD9A 4NYMR 1I4DD 1S3GA 4B3GA 1R5BA 1ZM2A 1OJLA 2CBZA 1WB9A 1E9AA 2JLRA 4BZQA 5KU1A 4Z1MD 1CR0A 2WJGA 1Z0FA 2Q3FA 1P62B 1KI6B 2NZ8A 4MKIA 1Q3TA 4UQOA 2ZPTX 4CEJA 4DLWA 1W44A 2RH5A 1VMAA 4M1TA 5DH9A 2ZM5A 3O8DA 3J81k 4NONA 5JWHA 1SGWA 4C0AC 4ILEA 1UDXA 2W00A 1OYWA 2QTHA 4FMCB 2OHFA 4LJ4A 3K0FB 1TX4B 4DCVA 4NTZA 1FP7A 1G8GA 1SXJB 5J4VA 1O3YA 4JLMA 2ZJ8A 1W36C 4Q1EA 2JJ1D 4OYHA 1IJFA 1G17A 4OJQA 5EXXA 3O8BA 2D7CA 3PR1A 2XZOA 5G3YA 3TBKA 1IJEA 2ANCA 3B1WA 3F5FA 5D3MA 4HLDA 3B6EA 5JI3E 2I1VB 1GOTA 4M9QA 2CE7A 1P9WA 1NJFA 2FGJA 4TYPA 1T9HA 2ONKA 2Y8EA 2ATXA 2DYKA 3R7WB 3K70B 1ODFA 3EPJA 1SVSA 5JECA 3PG5A 3FFBA 1ZM7A 1Z83A 2VH5R 4U5XA 3BFKA 3KJHA 2J7KA 2VRWA 1FOEB 4RD3A 4NYIQ 3BAFA 2GAOA 4I4LA 3TGPA 3K70D 3H84A 3SHFA 5D3MB 3FPAA 3PIRA 3FDIA 1ZIOA 1GZSA 1J2JA 2NTYC 3T61A 2IYSA 5KTYA 2C99A 1T3SA 2XTMA 4ARZA 5BN3A 2O8FB 1COWD 4KVAA 5FTKA 2RHDA 1E1QD 2O8DB 2JLSA 4FXPA 4MYTA 1KO7A 3I8SA 3IBGA 1EWQA 5E7JA 2QSYA 1NRJB 2RGNC 2X19A 4Q1AA 5GVSA 3VKWA 4LV8B 3LQQA 3CRW1 1YR6A 1SVLA 4FW9A 5FI1B 1UADA 5DI3A 1CU1A 4FMBB 4MA4A 2NZJA 1Z29A 2HCBA 3AP2A 1QHYA 1KSJA 1XEWX 4KHZA 1UDWA 4FWTA 2Z0MA 3UMFA 4RKEA 3MWYW 4KFTA 3NDPA 5J4HA 3LO5A 3JVVA 4DLYA 2GVDC 3OE7D 2HF8A 2EVWX 4E09A 1SZPA 3MSXA 3U61B 1NBME 1Q1ZA 1X1RA 4GZLA 2ZJYA 2QAJA 1KMHA 1R5NA 3AB3A 1W0JA 2YC4C 5HKKD 4F4CA 2IS2A 5CM8B 1CJUC 1SHKA 2FSHA 1VG9B 4OHXA 3TUIC 3B78A 3A4NA 1G1MA 3GFTA 4JJKA 3EWSA 3Q72A 1UEIA 1AK2A 2QM8A 3TUJC 5FUVA 2HJGA 1R0XA 1G5PA 4YMSA 4Q7JB 1I4TD 1XXHA 2GHIA 4QGHA 4Q4JA 2XEXA 3EG5A 3W3ZB 5BN5A 3IIMA 4JBYA 2ZAOA 4PZYA 4DLVA 1Q1EA 2WHXA 3I62A 2ZJ5A 3Q5DA 1RJ9B 1GL9B 2BMDA 2W6ID 2J5XA 1MABA 3IO3A 4GI7A 3UWKA 3VHLB 2PX3A 5BW8A 4A2PA 2QENA 5E4FA 4M1WA 4DLXA 2DR3A 3B85A 1XTJA 2QEQA 3IEUA 5FOWA 1G19A 2EWVA 5SZIA 3PJRA 3IIJA 1II8A 3B1XA 1NKTA 1FZQA 2AL7A 3BXZA 1XD9A 2GBLC 3C41J 1L4YA 2ERXA 2ZJAA 4B35A 3FMOB 5LB4A 5KSOA 2MMGA 3EPLA 2HDNB 1CTQA 2DPXA 4BRUA 2V6IA 4M9SA 3PXGA 1OV4A 2ORIA 5FBLB 4Y0VA 1TU4A 3U2QA 3GLHB 4YONB 3NWJA 2AKAB 4QGFA 3P27A 3AVWA 2H7VA 1KI7A 4AYTA 2EWWA 2JLZA 2BEKA 2UZIR 2FPLA 2WTUA 2E9SA 1XJCA 3JZAA 1P73A 4HB4A 1OHHD 1T5LA 4YMWA 2J46A 3T5GA 4D80A 1UBCA 1Z28A 4A92A 2GJKA 3QXXA 4OQLA 4GFDA 5JRJA 3DOFA 3LBNA 3QBVA 3CPHA 3VKGA 1JPNA 4DCNA 2R44A 4NHOA 2CL6X 1ZUNB 5EP1A 2DFKB 2ZRPA 4LGMA 5JCPA 1MO6A 2FEOA 2IUTA 1Z6TA 3K09C 2VIIA 4F7WA 4Q03A 3R9XA 1T4GA 1HT1E 3EWAA 1CLUA 3KDSE 2WMOB 4B3FX 4DUGD 2BMEA 2BM1A 1Y3AA 4H1UA 5FBVB 1G7CA 2W2XA 5JJIA 4HUQA 2AKYA 4UNPA 3LH5A 1AJEA 4B2PA 1CEEA 2WPDA 4RD4A 2ZRNA 3QKRB 1EFCA 3U7EB 2Z4RA 2V1UA 2O8BA 4OK5A 2F43A 1VCOA 4F93B 3AKCA 4ZO4A 4LJ6A 1AQUA 2JJ1A 4NH0A 3AVYA 2JJ2D 4YQFA 5FFMA 4I1SA 1NG1A 2DB3A 3NXSA 3ADBA 2OESA 4DDTA 3B1YA 4IKEA 2CVFA 1E9RA 1OFUX 4PC1A 4V0LA 3VR6A 3X2SA 4GDFA 4GNKA 1DBSA 1P75A 2O0JA 2KBFA 4HZIA 2BCJQ 3AP1A 1OT3A 3KTAB 2WIBA 3LLUA 2X77A 2H57A 5C4MA 5EE5B 1Q3HA 4PTLA 2AR7A 5DHAA 1CKEA 3HU3A 4LHYA 4GMDA 3UIEA 1NF3A 3MJHA 4P4SA 1XB2A 3C15C 3IHLA 3P26A 1XCPA 3U3OA 2D3WA 3T12A 4DLUA 5FH9A 1E2JA 2ZR9A 2PCJA 2QGZA 4LHVA 1G6HA 4PAOA 4OI1A 4NCJA 3EASA 4B73A 5AJWA 2QRZA 3THXB 2QMEA 2VLIA 1XCGB 3DL0A 2P2LA 1GSIA 1KY3A 4W5WA 5J4KA 1A5TA 1NN1A 2C9OA 4NCIA 1COWA 4GPTA 3TRFA 2CCGA 2CCJA 4PO8A 5K8UA 3VR3A 4QBIA 5KNBA 1O87A 5EE3A 2WBLC 3PITA 3X1WA 4FMDF 4CRWB 1SVWA 1E98A 721PA 3RSLA 5HR5A 1W36D 2JEOA 3M0EA 1SXJE 1FUUA 4KXFB 1P6XA 4X8HA 2JLWA 3OEEA 4NDZA 5CM9C 2GKSA 4HSEA 4NMMA 2PJZA 2Q0HA 5L3SA 5EE9A 5HPYB 3KQUA 3BBPA 4NYMQ 1GIAA 2HYIC 2QG6A 3QJYA 4WOPA 1GRNA 2J87A 5TY0A 2QROA 4V0NA 3IQXA 2PCLA 4DCTA 2ZVQX 3PENA 1ZINA 5FBWB 3SYKA 1KJYA 2XNDA 3UXMA 2JCSA 5FR1A 4B33A 1XMVA 1K5DA 4PO1A 4DT1A 2W83A 3AKYA 3H1TA 4Q9KA 2N46A 4GL2A 1E2HA 1U99A 4JVMA 5CJPA 1MKYA 3AF1A 2CMKA 4WZAE 1PLKA 4PQRA 3ZZ0A 5KO2A 1T5IA 1QG2A 1BS1A 2GILA 2AD1A 2I1QA 1EX7A 5KDDA 4OL0A 2V54A 4BFXA 3BJIC 2JATA 4FINA 4Q00A 1OXSC 5F2EA 1IXRC 1F5NA 2XTZA 5BXQC 3IEVA 2RGXA 1Q20A 1FMJA 1QZXA 2RGNA 4QJ4A 2BJVA 1PV4A 3K0CC 1FTNA 1KDPA 3CF2A 3GEIA 5FOUA 2QT1A 2FZLA 1JR3E 2W2VA 1DAGA 3I61A 3ZS8A 1FX0A 2BBTA 3B2EA 4E07A 4F91B 1KI1A 3HU2A 2ZSEA 1KTVA 5F9HA 4JLKA 4NKRA 5FUYA 5L3VA 1JALA 1E2EA 1E2PA 3THWB 3ADKA 3AVPA 1IBRA 3Q5EA 5DHFA 5JSZB 5L3QA 1FFHA 1H8ED 2C04A 2WWHA 2QA5A 4GBMA 1QHSA 3AKDA 3IBYA 3WHKA 1WQ1R 3B13B 3U44A 3HU1A 5EZ5A 5EXPA 1D2MA 1FPMA 3N2IA 5DSZA 2JAQA 1DTSA 3A1SA 5GJWC 4Z1MA 2V7QD 2ZYVX 3GJ0A 4EUNA 4L8GA 1KI8A 3AH8A 2VF7A 2G6BA 1YZTA 4LRWA 1JB1A 3WXMA 2H5EA 4B3XA 1FUKA 3NVAA 1OKKA 3LX8A 4S2EA 2JLQA 1G9XA 3AF0A 4HAXA 4IRUB 5JSZA 1PUJA 5L3QB 1E79D 2C9YA 1CP2A 2B21A 4K8OA 2AXPA 1OXUA 4EPTA 4TN1A 2GJSA 1RRGA 2W0MA 2GETA 4IXNA 4BZPA 4NL4H 2G1KA 2QNRA 5F3WB 3KB1A 3OAAA 5C46F 4Q5IA 1N2CE 3RC3A 4EJSA 2NMVA 2H1LA 4GMXA 2B92A 5EXSA 1OE0A 3EZ9A 4GP7A 3ETLA 4WVFA 3PEYA 1S1MA 1FP6A 3D8BA 1Q57A 2GESA 4HUTA 1J8MF 1DVRA 5JLJA 4NYJQ 3WP0A 2I4IA 2PX0A 4B76A 4EPRA 3LXRA 3MCAA 5FBQB 1NIJA 1NL3A 2A9KA 2ZRAA 1JJVA 2ZS7A 1OIWA 1NBMA 2OEPA 1E0JA 1KO4A 2IWRA 1VTKA 4M0LA 3UWOA 1EG7A 2FF7A 4ZKDA 1KZ7B 5H68A 5JMTA 4HYYA 3QKSB 3DMDA 1YR9A 3SOPA 4B48A 2FSIA 3M4YA 2OAQ1 5J40A 1VYUA 1C9KA 5HE8A 2GA8A 4DSTA 1HQCA 1II9A 4PX9A 1S8FA 2D06A 4XJXA 4AG6A 4DLZA 1GWNA 5CLLA 1ZYUA 2AFIE 2GCOB 3FMPB 3FMIA 4JYBA 4M53A 3EIQA 3WP1B 1Z0JA 1ONBA 1Z63A 3A4LA 2BHRA 3TR0A 1Q12A 3I92A 1PLJA 3BRWD 5HCNA 4DB2A 4BLQA 4XVUA 5H1YA 2BC9A 3BK7A 3Q8XB 5B64A 3B60A 1XX6A 5B2ZA 2WJIA 4U00A 1KK1A 4TL9A 2WKPA 2GJAA 2ZSFA 5H8WA 2FV8A 2E1RA 2EFHB 2NGRA 2D74A 2NO9A 2WWWA 5DYGA 1T0JB 4NCKA 3TSWA 3VNUA 2VHTA 3AVUA 1DAIA 2ZRKA 3LNCA 2C5LA 3UMRA 1KDRA 1IONA 1W47A 3QXCA 1HH4A 2F6RA 3GFOA 2IK8A 3A6PC 1U90A 3U3RA 4IVQA 2OBLA 4DKXA 2ZJBA 3LW8A 4BLOA 3GLIE 4JMPA 3AV0B 1P2UA 4D0GA 1GRQA 3NBFA 4B2IA 2BBOA 1XP8A 1N6PA 3WYAA 3ZZUA 4PPGA 2G1JA 5JHGB 3KFXA 3QPWA 5JWRA 2G0TA 1MO3A 4MYUA
chains in the Genus database with same CATH superfamily
3RS9A 1NOIA 5JQGA 3CWZA 5K0SA 2Z2YA 3JATA 1C0PA 3K0HA 1ZI8A 5JYEA 5K3BA 3G2MA 3GEBA 1O57A 2JLVA 2P5UA 5EHIA 4J0GA 5E4JA 4EQ6B 4JHLA 3JQ8A 5CVEA 1NRIA 2F9LA 4MQLA 2PGJA 3CR8A 4F8YA 2PLFA 4DSUA 5CFOA 3MCUA 4JBNA 5HCUA 4DZZA 5I4CA 4B4KA 6ADHA 1ANKA 2A1IA 3OTWA 3L8DA 3R3YA 5D3ZA 3PJFA 1ZJ6A 2O48X 3VO2A 4WBNA 1L7EA 2QYOA 4Y1GA 3Q85A 2F55A 4IPTA 3P0HA 4PC3A 3H2GA 1YQTA 3K9WA 3KQQA 4GG1A 3NRCA 3SBDA 4MGHA 3OETA 3SEAA 5A4MS 5CDGA 2E87A 4MICA 4EITA 2FVYA 2QSZA 5SZJA 1RC8A 1MB0A 3DG9A 2I78A 3C3XA 5T57A 4R01A 3FIJA 3VFDA 4LFAB 4TMTA 1IB0A 3T0GA 2NXJA 2F43B 3FPBA 3R7SA 1BXZA 1NW8A 3UWDA 4KCGA 1H1DA 4BLRA 5A3QA 3THYB 2HT1A 2J09A 1HF3A 4JWTA 4RD0A 1FDVA 2H92A 1XCBA 4HDRB 3LY8A 3LCJA 3R3WA 1QV7A 3G85A 5JCOC 3VSDA 3UAXA 2ZJ6A 4YQZA 3O1JC 3WNZA 1OJ7A 1KSGA 1P1JA 4DMFA 5HQ3A 1LEHA 1B00A 1G2IA 1N0UA 2FR8A 4O29A 3ZQ6A 2Q21A 4EJFA 5EXEA 3TLEA 1OFVA 3HE3A 1AUXA 1I5EA 3PC8A 5BSWA 2HWYA 4P3YA 4DFDA 2X86A 2ZWVA 5GJCA 5AHRA 1H8EA 3N8DA 4LJ8A 4D4IA 2VHXA 1KK0A 3B52X 4HPJB 4XDHA 5AW0A 2O19A 3ZWNA 3QE3A 4EI9A 3MBOA 4ERNA 1B0UA 5DHSA 2QM7A 2QPOA 1IRIA 2B7BA 2E7ZA 1L7VC 3VU9A 4NARA 1ESZA 1N1MA 4HWOA 4NU0A 1NASA 3D8NA 3DVAA 2J6HA 1WTAA 3DH0A 1FFAA 1X7ZA 2BYTA 3S27A 3MB5A 4BLUA 3OU6A 2ES4A 2XWPA 2CLLB 1U2GA 3WAJA 5DO9A 3BTUA 4O4JF 5CD9A 1GGEA 4K6KA 1P0FA 2REOA 3DULA 1FU8A 1SQ5A 3N0RA 2CEAA 1K6IA 1T5OA 3LP5A 2XCUA 2H6EA 4YLYA 5F2OA 1F48A 4EJMA 4ZO7A 3L8FA 4PLPA 5IC4A 5KNDA 4BFVA 4Q1VA 1R7RA 1KP3A 1EBUA 1LVGA 4C7KA 4BQSA 5J2UF 4O6VA 5IJ0A 3RTBA 1PDWA 4TS1A 3DTNA 3IVAA 2UYOA 3TR5A 1WSAA 2C96A 2FP4B 2IY8A 2XZPA 3FYUC 3JTMA 2AH5A 4OM8A 4A8JB 4G8BA 4EY3A 1KC1A 3O8CA 1W36B 1DOZA 1FSSA 2D5AA 4R6WA 3SFVA 3HCPA 4OY3A 2NNLD 3L40A 3QVKA 3ZIAD 2O2EA 1OSNA 4E2YA 3IP5A 5AW1A 1R0BA 2WUVA 1KEEB 1WLYA 1XPUA 5AXAA 2G9VA 3OQ1A 4RORA 1MZVA 1NXXA 2SHKA 3OZVA 4CQMB 1T6NA 4LOLA 1T4CB 3Q3CA 2QD2A 2CB9A 4BBAA 4J3FA 1KK3A 1AMOA 2IBSA 3JQ9C 3EIXA 3H5VA 1J90A 2H2WA 2DBZA 3KCNA 3HXOA 1DO2A 2KE5A 3NH6A 3A6GA 4RV5A 3TL3A 4HDSB 1SCUA 2OQRA 4Y0NA 4A5SA 1UPAA 2ZCVA 5DJ5A 3E7DA 2B20A 3U81A 2EX1A 3UPTA 2PRIA 2M2IA 4L2IA 1XWWA 5TMBA 3ET4A 1CDOA 1HT2E 2FX5A 421PA 1H0HA 2OQ2A 3WHLA 4CT5A 2EYQA 4U7TB 2J3MA 1PT7A 2E85A 3Q0EA 1WB6A 2IXTA 2QRJA 4ZDJA 1QPBA 4KDRA 5CB4B 3QELB 4YP7A 3HKBB 2HBYA 1WSDA 2ZSIA 1SULA 1CUVA 5TQ0A 4KQXA 1LDGA 5BVHB 4IIGA 4C5CA 2I9KA 2JFUA 1Y4SA 4RMJA 4Y2JA 3BYZA 2PTGA 1AB6A 1E6CA 1XZLA 3Q9UA 3QWFA 4LJAA 4JNCA 3UEOA 1KQGA 1ZCBA 1N2HA 1DS6A 2HI0A 2XF8A 3OWHA 4U4AA 1AO3A 2MINA 5FQOA 4YJHA 1X3LA 4IGIA 4HDSA 1GZ4A 1SVOA 2NNWB 3C97A 3VTFA 3K0SA 3U5ZB 1K5GA 3DC7A 4BLTA 1N5IA 4YT5A 3FUVA 3J81A 3LZ6A 4A82A 3H9CA 3RHFA 4K28A 1GPJA 2EZ4A 1A1SA 5CGZA 1YB4A 1JHAA 3CA8A 4F56A 1PP4A 1XZIA 5AW6A 4YCBA 1ZZEA 4BNMA 1HG0A 3OSZA 1V6CA 3VC1A 4TKMA 2ZUFA 5CVVA 5A4FS 1CV2A 3AG5A 3HL4A 2DGDA 2LD4A 1P1HA 2Z3WA 1O5TA 3BFXA 2PBZA 5KNBH 1DC3A 1XEFA 3KAJA 3DZHA 4ZV7A 5E1DA 1WPGA 5EJ7A 4WERA 3T9AA 1ZNXA 1IEWA 2VDVE 1E7RA 3PKJA 4HWKA 4L6AA 3RSOA 3S29A 4ZI5A 2NO0A 4BZZA 2ODNA 4RCZA 1JQBA 1P29A 2K87A 4JKIA 4BV3A 1YACA 3VHXA 2NYAA 4EI8A 1OH6A 2WEKA 3CLSC 4EKNB 4HVCA 4JOQA 4AZ0A 3KYCA 5LOVA 2J8ZA 2OGUA 2D2XA 2IHBA 2HJSA 3ETGA 2NVBA 1V45E 1XF9A 2WU8A 1V3QE 4TV8F 5A05A 3I37X 4E2FA 2R7LA 3EW9A 1B73A 4UXHA 3OFND 1KHTA 3GFPA 4YJ2A 4QVGA 3DHYA 4HXFB 2GPJA 1U0HC 4X0EA 3RLFA 4BQIA 1M1YB 1P1KA 2WWRA 3QEJA 2XZLA 4OI2A 3AJ9A 1XMOB 1P81A 1PF7E 3QPUA 5DF1A 1JQDA 2EATA 1NLZA 3I6MA 4ZICA 2IT1A 3VR4H 3GDGA 4B3TB 2YJ4A 1PKXA 1V9CA 5K5EA 3RFUA 5CG2A 1FDTA 1Z0DA 1KO5A 1TVMA 3OG9A 4N7MA 2OQVA 2PKRA 3R75A 4EB3A 2GHRA 2BFFA 4LTMA 4OQYA 3UATA 3GCXA 2HRDA 3H8JA 4IUYA 4XCXA 4MTCA 3ZVLA 2V9ZA 4IHJA 4PICA 4J8PA 2HU2A 5EE1A 5LB2A 3HA2A 1P2FA 1QANA 4MGIR 2IZ1A 1Z15A 5LQRA 4ALIA 4ENUA 1G20A 1JXQA 3ZDEA 3EULA 4Y2GA 2FUG1 4IHKA 3WHIA 1XTZA 2YQ5A 3DXYA 2NU8B 5I7UA 2P5YA 4YYEA 2WPNA 2VTVA 1PEDA 1FJHA 2VA9A 4D8XA 4EG7A 5LLDA 2X9GA 1YAHA 1N8SA 4D3FA 1WPRA 2BFEA 3IAM1 5ITZA 5MF6A 2UXDB 3B1FA 2J9XB 1UXGA 1K8RA 4BQOA 2PMDA 3UO8B 4ENVA 1Y0BA 4NNJA 4A8PA 4XFKA 5AIBA 4MS4B 1IY0A 2BM0A 2EFYA 4FOOA 3S1AA 5C2JB 5ES4B 4OK6A 5A5EA 3WL8A 3VPSA 4HLQB 3CH5A 1TVKB 1ZHFA 3P1JA 3AR7A 4KAJA 4Z9BA 1HNXB 3TQSA 1PZNA 2RCNA 4FEEA 4LE0A 4CEHA 1JSLA 2HA5A 2WUDA 3A1UA 2QL9A 4KSBA 4F4IA 5IVHA 4KNYA 1LXCA 1E2DA 3P2OA 1EJ2A 3QE4A 4CUKA 2VT2A 3AJRA 5ALEA 2YHUA 3AKZA 5B6PA 1JYEA 3IHTA 4ZKEA 1FNNA 3BULA 2CXTA 3T4EA 3DEYX 5L6MB 2GEFA 5LQMA 4HCJA 1NQAO 4PC6A 4H1HA 5LDGA 2HCJB 4NIMA 1KJWA 5AOBA 2J3EA 4CNQA 1IAQA 3A1FA 3R9IA 2EU8A 4GM1A 4O1IA 3WLMA 1E18A 4HZUA 1ZJ4A 2TSYB 1R6DA 3PI6A 4D96A 4DXAA 1LLFA 4JL6A 4B6JA 2R11A 1ZRHA 3F4LA 3KOUA 2IXDA 3QVUA 3RC9A 4ENPA 5B7QA 2IZZA 4GUAA 3OUZA 2XXAB 3VAYA 5AVUA 4FDMA 5IF9A 4JLWA 4XGQA 3ZD7A 4MOWA 2GN2A 4N5MA 1UANA 2G80A 2NV0A 2NYRA 4KW7A 4MJ3A 2NVUB 4EIWA 4YAIA 4WZ6A 3IMKA 4GUDA 2R8RA 3QE2A 4MS3A 3HI4A 2I66A 4BO6A 3U13A 1R4AA 2J6BA 1C30A 2CDNA 3WYCA 3WK4A 4DAOA 2NO4A 4WLVA 1MIOA 5HGXA 2DX7A 1LX6A 3ZK9A 1R0WA 2VXCA 2ZE8A 3BMQA 5ICFA 4RM2A 5TQ2A 2VUIB 1GAWA 2BFBB 2PFKA 2VCYA 4IO1A 1FLVA 4QJ5A 4CCSA 4AP9A 1D1PA 1DZ3A 4KDFA 4UHKA 5DN6D 3O8LA 3C6YA 4W6ZA 1KXZA 4QLOA 4HDMB 4ONEA 3SHQA 3KQNA 3D54D 5CA1F 5KTPA 4NC9A 1P39A 4LWPA 2GM5A 1E6LA 2YVUA 1IEVA 4ZGBA 4YJ2B 1L3IA 2XDQA 3AQIA 4KLCA 1M1YA 1O54A 3IRVA 3LVQE 2CW5A 2A58A 2ATEA 2C8KA 2PZKA 2E4ZA 3QVGA 1RS0A 1J23A 4AZ3A 5CCEA 1J1ZA 5IPFA 3SNHA 4IXMA 1Z33A 4CE6A 4GXNA 2AR9A 3OE5A 5AW7A 1GT6A 2IYRA 2JI8A 2PD4A 4OLFA 4PLZA 1QO7A 4YMVA 5D84A 4KLZA 1L5SA 1YQ9A 1N9GA 2AOVA 4KV7A 2AEJA 5CD1A 3STVA 3KZ1E 4UU0A 3GFGA 2PGNA 4KXNA 5IJWA 2HNBA 1JECA 3DNMA 1X1AA 2JLUA 3C1OA 3WISA 2GGSA 1DO0A 1LI4A 2HF2A 4YRJA 1OZFA 3PE4A 2JI4A 2TYSB 2NSHA 2Y27A 3GGOA 1W2WB 3RSFA 5AVQA 5A2QA 4GOJA 1WUJS 4IJWA 2PMFA 2FHPA 5CH8A 1ORVA 5CJ2A 3UJDA 1EP3B 4L22A 1J7KA 1ACJA 1VL1A 4Q34A 4REQB 2ZBPA 3RFTA 3SMQA 4PHFA 3DDCA 5EWJA 2HLHA 3NIWA 3AONB 2YS6A 3I12A 3R3HA 5K0NA 1Y1PA 2HBRA 3CO5A 4G37A 4PHHA 4ZZ1A 3QU7A 5HM8A 2Z5VA 3QGMA 2XAUA 4KU4A 3HB4X 5HGJA 1YK0A 3DAYA 4PE5B 3UWPA 2XHEA 4ZYXA 3JPYA 4HQ0A 3AJDA 4HDCA 1E1KA 4JAVC 4OCZA 1O97C 4G89A 1E2LA 4A8JC 2H7XA 2RK3A 4ABYA 1T2NA 3GUUA 4NMWA 3JVUA 5T6MA 4ND3A 1JHRA 3LXUX 4ZVUA 1ZC4A 3DPIA 5LN1A 2QI9F 3QVOA 1WHSB 1H05A 3C7TA 3QVTA 2ZBRA 3BWYA 4I1UA 5REQA 4MVJE 1DQSA 3FSGA 1Q74A 3A2LA 4DGSA 1E4OA 2J5RA 3GP3A 3GY0A 5CNIA 3F3KA 4IDFA 5CK4A 3TPCA 3I6IA 3VU9B 2HXGA 3UGKA 2JG3A 2O2DA 2Q3HA 2GN6A 5CT4A 2Q4OA 2GAAA 1GNRA 4S0XA 4WPGA 1QONA 2VJPA 3CLUC 2EZ8A 3CZAA 1VKRA 1G8HA 2FSSA 2OC4A 1HR0B 3K3PA 4HZUB 3NH9A 2AX3A 2IOHA 3JD0A 4R0MA 3P2IA 1D8AA 4LE1A 2D5CA 4QO7A 1WXDA 1URPA 1RZUA 4DPKA 3E53A 1XVTA 2DFNA 1A69A 1P91A 2HRQA 4W5RA 3UAYA 3G6KA 1CY1A 4C7JA 3PVCA 2FRDA 2CWWA 3O4HA 4YAJA 3TOCA 5IU6A 2V0GA 1T26A 3LT5A 3ZWPA 4MWSA 2CHVA 5K03A 3BXGA 3F6BX 2JGKA 4EF6A 3VDXA 4MZXA 3KSRA 1ODIA 3NEYA 4P33A 4AWAA 1E66A 1ZIYA 4WFQA 1ISRA 3S8EA 1F8YA 3BFVA 5EP3A 2HIAA 2FWAA 2DZDA 4TTRA 3WNVA 1PS9A 2Y66A 1UFVA 1RQRA 2ZYHA 3GDFA 4UDNA 5B3JA 3SK0A 2IHYA 2JC3A 4YJGA 2JDID 3GRVA 3F2IA 3GIWA 3E18A 3U39A 4CU5A 4DBLE 1B8NA 3SGLA 2J33A 1TJPB 3K1ZA 2OMKA 5FL7A 3A06A 2CLEB 4HLUC 4Z7QB 3ICQB 5CHYA 5JD3A 1EA7A 3M6FA 1LB1B 3KPUA 1OA1A 4BAZA 2FY8A 2O20A 1H5UA 2D0DA 1N7GA 4IDNA 4A0HA 1OZ0A 2GPTA 3UMBA 4EVQA 5CVTA 2GBPA 1LRLA 4HFJA 4L3VA 3A0UA 1W19A 3TLXA 3V46A 5JAPA 1PR0A 4ARZB 4DRXA 1NJ8A 4OHCA 1J9ZA 4UXJA 3ZI4A 1EDEA 5KSPA 5A4AA 3HKDA 4DWJA 1P2TA 2OHHA 2YOFA 2QIPA 2Z6VA 1CBUA 3OU2A 4HDOB 4I4TB 5BV7A 1WP4A 4UBNA 3KNZA 3MC1A 4NPAA 3PZRA 3RNLA 3F3YA 5KOJA 1A77A 5FV4A 1A7JA 3ZD6A 3ELWA 4M0DA 4UOZA 3N3AC 4F3YA 2VDLB 1AK1A 3LUCA 4IOLA 3U3MA 4F8EA 4QOJA 1QMPA 4Q3BA 3MCWA 1OGJA 2TMYA 1HE8B 2PUGA 1SIWA 2YWJA 1IY1A 4YCJA 4K86A 2XZTA 3P5SA 2OBYA 1BX0A 3D6UA 4KPUB 5FOVA 3ZU4A 2LCQA 1VZ2A 3HB9A 3ED1A 1GFSA 3ETNA 1GA4A 4Y2HA 1TD9A 4DSAA 1VRCA 5UKDA 2BMFA 1R9MA 2I55A 2QD4A 1XDSA 3U6BA 2FMTA 5GM1A 1SIOA 1BWSA 2EYUA 2Q3MA 3ZDQA 2WWTA 3MPOA 1YZKA 1P9LA 3HDJA 1KJQA 3R8CA 1TIPA 3U4GA 4QLBA 5CCXA 2XUFA 4ENSA 1YH3A 4JR1A 4KKVA 3RTGA 1O6GA 1I2CA 4DV3B 1DG3A 3G9QA 2B34A 4R8SA 2VNJA 4A1FA 3SYNA 4BGVA 2ZJFA 2F17A 2PLRA 4PCLA 2O2IA 1QYRA 5CNJA 3LLSA 5EJ9A 3A1EA 4GM0A 4FQ8A 4A10A 5CGQB 4EEZA 4Z53A 2R84A 3HDTA 4IH9A 2XKKA 2WUWE 2WJZB 3FUCA 3K8ZA 5BNZA 1STOA 5JFTA 4S05A 5FLEX 1FYFA 2JJ8A 4M1YA 4AT1A 4BNZA 4MW1A 3CLUD 1NSTA 2GPSA 1S1CA 1A4XA 2GWRA 2OAGA 4JVOA 4QLAA 1QHHB 1R0RE 4BQRA 1DOAA 2OZPA 5C0OE 2CLOB 2NU6B 2J3LA 1CEQA 2OAEA 3AEUA 3G2OA 4EUEA 3LFUA 3L6BA 4BFTA 1QOQB 2VCEA 3M3DA 4PCUA 1QZ3A 1G38A 3TKYA 1CXZA 3L7YA 4AZ0B 3W9BA 3ONWA 1QF9A 3KKEA 1XOIA 3PRJA 4MKGA 4V39A 1S2NA 2I5PO 1C4XA 3FTQA 3AHGA 3ZLJA 2HJ9A 4AY2A 4NJEA 3E4CA 1OBCA 3FHLA 2QW8A 3OY2A 3OJEA 2WMNB 2ZTMA 2FP3A 2Q2OA 4KP7A 5LIRA 2NVWA 3GWZA 2I03A 4JUAA 1E7MA 5BUSA 3NPMA 4G26A 2QJWA 4D26A 2FQYA 1ZY2A 1E20A 2NZUG 2WWGA 3ROFA 5IAKA 3X44A 4JCOA 2CV1A 2D4HA 5HIKA 1AKEA 3EF0A 4JI0B 4L28A 1UBSB 1BOOA 3VPDA 1ZRMA 3E9RA 3VQTA 4QC2A 4ESVA 1UJMA 3CUYA 1LJUA 4AS2A 4D46A 3D6VA 3GHHA 1SG9A 5CXUA 2FR8C 2QN6A 3W7AA 2D2VA 1E8NA 5TDHA 3T35A 1GLNA 1ZXLA 2FB9A 4UVGA 2VQ3A 4ER3A 1PJZA 1JHOA 4R1QA 3TGLA 1KR5A 2Z3ZA 1JHMA 2WJHA 2Y1DA 4R7TA 3ZS9A 2X5KO 1AF4A 5JCOA 2WAMA 1A50B 2W4IA 1E0SA 2XTNA 4LWQA 4MLZA 3CJRA 4TXJA 4YY3B 2PGOA 4RKFA 3NHKA 1YNSA 2G5PA 1SKYB 3EXEB 4XYLA 4WFKA 4HDNA 1K3UB 3O03A 1M1NA 1OLSB 4FBMA 5FLKA 1KK2A 2H65A 3ND9A 1SBZA 2DHCA 3D4OA 1ORTA 1T6ZA 5GIOE 5TRTA 1IN4A 3ND8A 4RK5A 2AMYA 1X7HA 4BWFB 2B3TA 1B6RA 4RV9A 1PNVA 3LDGA 5HKLA 1G6OA 2WAXA 1G59A 3TO5A 3KZMA 1FJ2A 1EDZA 1TI7A 4US1R 2VO1A 1OX4A 1MABB 2GERA 2QY6A 2HH9A 3I8XA 4MGKR 4H59A 4TV9A 4AY6A 1KF0A 3L6EA 2Z5GA 1N9KA 5JZOA 1TL7C 1QSGA 2AOTB 3G0CA 1GTZA 3H17A 4X20A 5TJ9A 1NLYA 2WIGA 4F3CA 1EM8B 1WCWA 1I3MA 2O3TA 3LDUA 1D1QA 1V2GA 2R60A 4L4UA 4X97A 2C9ZA 2M6RA 3BILA 3P0JA 1EQ2A 3O47A 1PTJA 4LG1A 4RS3A 5E7QA 5HF8A 3T9FA 1MX1A 2NXEA 3VPHA 2H4HA 1LK0A 1S8OA 1Z4PX 5FQNA 2P3QA 1FFXB 3SZMA 1L9XA 1DKLA 3V8MA 4FIDA 3ZNQA 1KVTA 2O3RA 1ONNA 1OB5A 1FBNA 2ALJA 1C9DB 2HX1A 3L8EA 2A6PA 3O75A 4CN8A 5HSGA 3V4SA 1TJYA 1Q1QA 1U7HA 3IV6A 3OKPA 4D99A 2JD0A 1HDXA 4Z4FA 1U7DA 1P19A 2AIRA 5A0VA 1NVDA 1OBFO 3GPDG 5D85A 1RXYA 1D5CA 3HR7A 1B15A 3HXQA 5A02A 3WBKA 4BFUA 1PQWA 5FPQA 5J3JA 1JYSA 5ILGA 3THSA 5HDQA 3UC5A 2PLWA 3N58A 4GZMA 4U2BA 2R8PA 2FMHA 2TMKA 2D1RA 5JCZA 5BO5A 1IE3A 4AC9A 1J20A 1SFRA 3I1JA 4F6CA 1B42A 2VJDA 3GF4A 1MDFA 2YICA 3TW8B 3NBQA 3QPCA 2A30A 3E23A 3MA0A 5EWJB 4K40A 4TQAA 3WADA 3GBVA 2BR3A 4XTRA 1XVIA 1DHRA 3PFFA 4O3FA 3L1JA 2AWNA 1XNRB 3EHDA 3WBFA 4GKAA 2F8TA 4P08A 4P98A 2BKVA 2C3OA 3ZQJA 4FFLA 4UDOA 4BB9A 4YASA 3RGWS 2GAFA 1DT3A 2CSUA 4N3AA 2IF0A 3C4QA 2XMRA 3KQVA 3L06A 1Q2XA 1TXGA 1KY2A 4O2BB 4WRRA 4KGDA 5HKAA 1C8LA 4QUAA 1Z2EA 3U4QB 4Q12A 4B8YA 5U9CA 1MN6A 3JAKB 4HFNA 2XODA 2V3WA 1FRQA 4LFBB 5BQ5A 1H94A 2QZPA 3BH6A 4GICA 3O91A 2WD7A 4XJTA 1K5PA 1JE0A 3D8TA 1NV9A 4X7PA 3V80A 3B2QA 5B58T 1J1IA 1G7SA 1W49A 1XTTA 2O2JA 3OECA 3ROPA 2JGJA 3VYTB 7YASA 2YZNA 3L93A 3K70C 5ES3A 1R4MA 4FHDA 1NPDA 2IIBA 1N7JA 4QU5A 4XA8A 3E1KA 1K3FA 2W6NA 4A4DA 1H6AA 2H1SA 1U2QA 2IYQA 2MDTA 3MRVA 3R7NA 2BCGY 1DAKA 2Q1UA 2R65A 2A3NA 3S2ZA 1PN3A 1GPLA 3M9XA 3VNAA 1CEXA 1U31A 4B09A 1Q14A 3NGLA 4UEKA 5EIEA 4PM4A 3TUZC 1Y3CE 2A0WA 1Z0IA 2V96A 3HJUA 3AG6A 4ALNA 4DPLA 5JAMA 4Q18A 5M04A 2J6IA 2VQSA 1NAHA 5B58C 3W06A 1CP3A 1R4ZA 3C7CB 4ZEVA 2O8EB 1GNPA 1J8VA 2WD7B 3HJAA 3P71T 3V7YA 4ARUA 4DQDA 2BEUA 2PZMA 3FHCB 3A2MA 4FHGA 4MV7A 2VSXA 3OJOA 3ZWVA 4YRAA 5AQ1A 1VI5A 2A9PA 4I4NA 1AQJA 3HO8A 3HWRA 3NT4A 1DAMA 2IEBA 3G2LA 1ONSA 3OPMA 4QREA 5TQJA 3NNNA 4B85A 2FSVA 2C42A 2VPIA 4EHLA 5BPHA 4KREA 2EIHA 2VWHA 3B5EA 3ZGVA 2H4ZA 3G5UA 4G63A 4HQOA 3TLBA 1WRBA 1BMFA 2QS9A 3H2HA 1QDLB 1R10A 1K4YA 2PXXA 4OYLA 4IWNA 1FFXA 2A9OA 4OAQA 3NTUA 1UIMA 2OYCA 5C53B 1CSEE 1E3SA 3C3KA 1PGJA 2JHFA 2X7HA 1FTSA 1T15A 4DANA 1PL7A 3T1QA 3C3CA 1QG6A 3DCIA 2O2SA 1A27A 3DCJA 3FA2A 4BZWA 2GK7A 3O8NA 2GZ2A 5DKFA 3SC4A 2W6JD 4F6RA 1KIAA 2HADA 4IDCA 2BTOA 1JZTA 3O3CA 4EZIA 3NYQA 4FN5A 5IDVA 3MINB 3BTSA 4JGIA 5F7JA 5M34A 3EK2A 2I2WA 4J76A 4Z3KA 3KD3A 1VHDA 5EIBC 4LYDA 3RHZA 1FTQA 1HNNA 1T4MA 1F38A 5EMKA 4P93A 4EW6A 5BWLA 3RQIA 3TTUA 2I62A 2DHEA 5HX7A 1F51E 1WS6A 1TW2A 5AKGA 5E7MA 4CL8A 2CLFB 1L7RA 3ZLVA 3K0FA 4HMQA 2D54A 4BX2A 4DNQA 1JMYA 5ADVA 5HJ7A 1P2GA 3OPYA 4R8VA 4OQNA 2O7SA 1I1QB 2D0IA 1QHHA 4O1HA 4YR9A 3PQ3A 3L6CA 4II3A 1YBAA 4P4GA 2O6HA 1A9YA 2XYRA 3C5EA 4TMKA 4TLLB 1ZU5A 4AF7A 4JJ7A 4TUYB 2JW5A 3RYFA 1GPYA 5GOTA 1E3DA 1Z4LA 2FLKA 1KNXA 4R3WA 4HNUA 4C4PA 3DMPA 3M7IA 5L9AA 1YQUA 6YASA 1E1MA 2H4YA 1TCBA 1DPFA 4ZO6A 3PIIA 1NV8A 3OJ0A 3OZEA 1NSFA 5CDTA 4FM9A 1P4HA 2P1ZA 4YBRA 2FSFA 4BUJA 5EUQB 4CMGA 3DM5A 1PG0A 3LSTA 3CN7A 3W9SA 1BHSA 1GVNB 3B3AA 3O1HB 1ENZA 4HEQA 4QUBA 1ECFA 2Y76A 3OIFA 2ACVA 4JLNA 5IWAB 2RHWA 4FFMA 1X74A 5AJUA 5F35A 1BE1A 2J3DA 2KLBA 1W34A 2CGEA 4OXXA 4JU9A 1DXYA 3ZWKA 4OUDB 4BU1A 4TTPA 5T4HA 1E3IA 2B1IA 2YL2A 4DM3A 5FDFA 5JT1A 3H1EA 2C4HA 1D7AA 1PU2A 1QIFA 2ENWA 2ZLBA 3L7IA 4TUYA 4ZMRA 1T3LA 3WWYA 3V8BA 4G36A 2OKCA 2ZUDA 2ZDHA 1RACA 1NW4A 1OPXA 2YTZA 4PG5A 3U31A 1U0NA 3HXLA 4JH0A 1P7CA 3CG4A 3ESBA 3HMKA 2H06A 4QNRA 4OQMA 2D62A 4WZBB 1TO1E 1IHXA 4KBGA 3AWDA 4M6WB 2ZXUA 3IKVA 3KP1A 5G0TA 2RAPA 3KYCB 2R48A 5F98A 1ULHA 2PX4A 1JG1A 2OHXA 3JRNA 3N2ZB 4ZTZB 4AMYA 1WZ2A 2CBXA 5K01A 1TF2A 5IXJA 1NXPA 5FL3A 1U0RA 2YY7A 2BHTA 3QENA 3VAAA 1N0IA 1H2RS 4PSKA 3AFGA 2QMHA 3W7VA 4Z1OA 1V47A 4FD2A 3N6XA 4XYEA 4KMOA 2XT9A 2ICAA 5M3BA 4Q66C 4QODA 3VSCA 2QN7A 3C8HA 4RJ2A 1FYVA 2WIFA 5DEOA 4K7JA 4GC5A 1Q17A 4LY0A 4DLLA 5KVAA 2YVAA 2AZTA 2ISSD 3FPHA 3NGMA 3WBBA 1WDMA 1JILA 3FDZB 4G07A 1VHJA 3D2CA 1E5LA 1YHYA 3GLFA 4B8WA 4IFBA 5G0SA 1OUMA 3KLNA 1WCYA 2VUUA 5BYAA 1JVSA 1U0SY 2OILA 1T43A 2BAGA 4V3BA 4RMGA 4H0NA 4JLVA 1RRMA 2P6NA 1X7XB 3BIOA 3I32A 2ZCJA 3UMMA 1H3NA 2VTKA 3A3NA 3I53A 1E9CA 2J3JA 3LUGA 3DJFA 3O7WA 2AW3A 1YC2A 2APJA 4KJXA 1QVZA 5LUBA 1XL0A 4EVRA 1Z34A 1JAIA 3D5TA 4P36A 2AZMA 4E5VA 1QHEA 2G8LA 4WGFA 5B3JC 2ODPA 1CUYA 4FEAA 1SOAA 4JQSA 3R9KA 2BE9A 1LBQA 2O6LA 2A94A 1SBYA 3NHUA 4RF4A 3IR7A 5I51A 4F1JA 3P4XA 1W4RA 2CV2A 4URVR 1H6BA 4OD0A 1FMCA 2MMCA 4LJ5A 2FR0A 3JQCA 4NF2A 1KS2A 2HSWA 4FGJA 5HF5A 3QX9A 3A37A 3VXKA 3GFFA 3HWSA 1BKDR 3CNNA 2MU1A 5DM70 2P78A 4R9SA 4TVOA 4MDHA 3JY6A 3W2TA 4RYDA 1JJ7A 4DVJA 4TL6A 4FSXA 2PUJA 2H1VA 3JTEA 3SXUB 1KWGA 4KN5A 5K3DA 4DIKA 1Z36A 1Z6ZA 2OV4A 4M7OA 1BN7A 4NYJR 2JLYA 1P77A 3Q5GA 1UC8A 4J1QA 2JAUA 2OT3B 4QGAA 3PDCA 1ZGBA 1N6NA 3Q7RA 4JJ8A 4EFDA 1XU4A 3WV4A 5AUPB 5A03A 3N59A 1SJ9A 2DKOA 5A5DA 5EJEA 4BGDA 4D5EA 1RWMA 3I09A 4M0UA 3TQTA 1Q1NA 2AV6A 1GGVA 4R7GA 1Z4QA 4FMPA 2GKOA 2BRUA 4NFSA 4Q3KA 3W5VA 1D4FA 2Y2UA 1ACLA 3A4IA 3DKPA 4FDVA 1EINA 3I2YX 4EDFA 2ZIXA 3MS4A 1I7DA 3UJ6A 5LU8A 1Q15A 2RC6A 4D9GA 3G1WA 4R8LA 2XSZA 3KHSA 1XJWA 5EUMA 1U0TA 2B4AA 4E4TA 2JK0A 5F52A 3C0KA 4NVRA 3GN1A 4HN9A 4YS6A 4Z4QA 4RGVA 3DW3X 4OHKA 1X87A 5KYNA 2QUKA 4HUQB 1B2RA 2FPKA 2IIPA 4QUGA 1GU1A 3IH5A 3EZNA 1XRJA 5AHKA 4CU2A 4MA0A 2EEZA 3ANMA 2P1RA 1EH5A 4I4TA 1N2CA 1TM5E 1VYVA 2CNWD 2ZYRA 3DTTA 5ENVA 4B3CA 3O38A 5FA6A 3UNXA 2PUFA 1YFZA 2K2QB 3IIKA 2D2EA 4LX0A 3PL5A 5T8KC 4U02A 4M8IA 4ARSA 1AU9A 3W8RA 1SXJA 1E9BA 3EXIB 4EJSB 4YJFB 4E51A 2ZVPX 3PI7A 5KYTA 5DNDA 1G0OA 1RHQA 2W11A 3AHFA 3IAM6 3KK0A 3ROTA 3CVXA 2IODA 4H60A 2WJVA 5K8CA 2C7OA 1QFZA 2W7TA 2PT6A 2TECE 3D8HA 4RHUA 1HNZB 5AVYA 1ZC3A 3LAWA 1IRXA 4IJMA 5EUCA 1VE6A 2JEYA 3ORYA 5F21A 4ZODA 2VHZA 2FZ4A 2P4UA 2Y6VA 3D6JA 3MGBA 4QBHA 4U6QA 4DLTA 3OHMA 3OX2A 4NU5A 2ID4A 5BSGA 3OJXA 3UXEA 1ZQ9A 1VRWA 1G20E 1C29B 2ABWA 3LOQA 2D5IA 2BFBA 1H65A 1W48A 3B9QA 5B1IA 5H82A 1NY5A 2IE0A 4ESOA 5LOVF 4Z7JA 3KOXA 3PICA 2BBWA 1VLMA 2ZWOA 1U2ZA 4TVKA 4UATA 5C81A 4K05A 3BG5A 4HGPA 2CXUA 3GVXA 1QWSA 4RKQA 1E5QA 1N5RA 1M2OA 1U28A 3ECAA 4JA2A 4R1MA 1XNQB 1OWPA 4KMMA 3EXHA 3CCFA 3BC1A 1MT3A 3GH3A 1V95A 4HNGA 3TBFA 4DLBA 4QX6A 1NW3A 1GLGA 2K2WA 4HN2A 4MHOA 3K2EA 3KAKA 4C7XA 4J1NA 3JARB 1BDHA 5FTJA 2OUKA 4DYDA 1EFTA 3OJFA 1OVGA 2RGAA 4ZVLA 1K08A 5BT9A 4TXLA 2JF0A 3CNLA 1OXMA 1EFVB 2KW5A 3JALB 1GGFA 1XQ9A 3NONA 3V00A 3KFVA 3EIEA 3FWKA 4G0QA 1LV8A 4LRUA 2EXXA 1TQ2A 4RFSA 4WEQA 3PKZA 1EK2A 1XZHA 4OG2A 4ZVVA 5REQB 5KTTA 2FUEA 2QRVB 5EHXA 3QF4B 1I7SB 1FX0B 3P2KA 3AUTA 4RXUA 3W3AH 2B6HA 2G4VA 4XGKA 1F5SA 2VSOA 2N42A 1K6JA 1BE0A 2Q0SA 3CLTC 1YJ5A 3LTNC 3CF6R 4E15A 1TZBA 1G2PA 5E0KB 4DC9A 4BKMA 1RMTA 3SYMA 3EQ7A 5FOXA 1VCNA 1PNOA 1XKQA 3BIFA 3E7WA 2IHKA 3UZUA 1Z0SA 3GQVA 4ZANA 3LP8A 3MGCA 2JKYA 3HRIA 2RFLA 2XUGA 4X8MA 5FI0B 2CKMA 3U7JA 1EK5A 5EWMB 1Q44A 1QQ6A 1NVXQ 1Z18A 2Y1WA 2ZRBA 4M87A 1N3IA 4KR3A 3Q7IA 3HV0A 3H9BA 5DNAA 2OUIA 1W2HA 3H9EO 1PD0A 2EIXA 5FJJA 3T3OA 1NONA 4QARA 4C7BA 3CO0S 3IRUA 3IUBA 4WECA 5SZKB 1U7PA 2FLVA 2BHNA 1EVJA 2OCAA 4PGFA 2ZAGA 3DE0X 3EN0A 1A82A 1OLXB 4IXDA 4C9BA 2Y67A 1EZ4A 4OHPA 4ER0A 4FX5A 1ML3A 4XUCA 1W4LA 4NU8X 4C6TA 1EVEA 2ST1A 2ZUUA 5KVSA 2R8ZA 2VPTA 2EFCB 2ZJ0A 1ULTA 4OP1A 4XWWA 3RAEC 3DZFA 3HB5X 4MUYA 3RT9A 4F4DA 1Q91A 2XJ9A 3KC2A 3L77A 1HFKA 3H6GA 1L4FA 2AN3A 3ZV6A 4NECA 5L7YA 1TEHA 1VHWA 4REMA 3BH0A 3HXKA 2X41A 1U3FA 1MRZA 2Y77A 4MWBA 3MIIA 3OI7A 2JHGA 4H16A 3BZBA 4BUCA 3BGWA 6AT1A 3C3AA 3L46A 2C7PA 3BXFA 2MSLA 1DEAA 3AJAA 3CX8A 3DO6A 1S9DA 1T9BA 3PYMA 4JLDA 4COOA 1HE2A 3F8TA 1JMVA 3OPQA 3SFZA 4M4SA 5DN6A 3I9V6 2O8FA 1NVTA 1D7OA 4JC4A 3FVVA 5CMLA 4QQRA 5EZYB 1E1QA 4MVJP 4IS2A 2X0FA 3PGA1 1GKKA 1ZH6A 4XZ3A 1Q1BA 1SB8A 1NC3A 1G20B 2I2XB 1EQUA 1A8QA 1N5DA 2YMPA 3KSUA 4PGGA 2LRHA 4YALA 1E7SA 4IW3B 5JCJD 5FOQA 3SEQA 5KSZA 2ZJ7A 3TRKA 4EKYA 4L07A 1L7QA 1JJIA 2JIRA 1NBMD 3QHAA 4QHTA 1YU9A 1U63A 2PGDA 3HCBA 4TWZA 4ZMSA 1EP2B 4JR2A 4N3GA 1GARA 5E9QA 3QF7A 1JI0A 4H6XA 4HMOA 1V26A 3ZE8A 4W9NA 1G7TA 1XU7A 4EPWA 5LFAA 1JKXA 1TLLA 1QIIA 3RYFB 1JXMA 2HFJA 1TFUA 4HTAA 3AXTA 1CJBA 3NS7A 4N8DA 4ZEOA 4JSRA 4Y7CA 2PJDA 1AKNA 2SKEA 2PIDA 4E14A 3FKQA 4YDSA 3WY9A 4G1UC 5IJ9B