1HURA

Human adp-ribosylation factor 1 complexed with gdp, full length non-myristoylated
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
180
structure length
180
Chain Sequence
GNIFANLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLSNQLRNQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the human ADP-ribosylation factor 1 complexed with GDP.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
molecule keywords HUMAN ADP-RIBOSYLATION FACTOR 1
total genus 51
structure length 180
sequence length 180
chains with identical sequence B
ec nomenclature
pdb deposition date 1995-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00025 Arf ADP-ribosylation factor family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1hurA00
1CJTC 3ADBA 1ZM9A 5CIQA 1JAHA 2GK6A 5CJPA 2CK3D 2ZYVX 4QFMA 5FTLA 1F2UA 1VCOA 3PQCA 1RJ9A 2IUSA 1OXXK 3IQWA 421PA 1D2NA 3F3YA 1ZAKA 3H0KA 3KUCA 2JAQA 4IDNA 3CBQA 2YV5A 2WOOA 3IIJA 4NDZA 5L8VA 2XAUA 4IDQA 4QHTA 3AF0A 1QBKC 1P73A 4JIMA 3U2QA 4Q4HA 1ONBA 2ZS8A 4A6XA 2D7CA 3D6TB 2O5VA 4BFTA 3K0AB 3RC8A 2EYUA 4EJSC 1AQYA 1M7BA 1F6BA 4RZUA 3HU3A 4DCSA 4X8OA 4RY2A 2R9VA 3IILA 4II7A 2ZYTX 4MKFA 1E4YA 3BRWD 4XSHA 1FOEB 2ONKA 1XTJA 2FPMA 3SU8A 2ZVPX 3UANA 3ND8A 1I2MA 2A78A 3K9LA 2R8RA 2CE2X 4AY2A 4XH9B 4JSTA 5D3MB 4M9SA 4L16A 4S35A 1RPZA 2GCPA 2XOKA 4LI0A 4C0AC 1N25A 1P6XA 4QGHA 2QBYA 2J3EA 2RGGA 3NDPA 1KI2A 4UNQA 2H8KA 3GPLA 5DO9A 1FTSA 1LS1A 2NTYC 4JLVA 2HCBA 4AG6A 2QQ0A 4DB2A 3R7WA 1SVIA 2AK3A 3IO5A 1JNYA 4JVSB 3Q8XB 2F43B 4OK3A 2PH1A 1ZIPA 2VP4A 4M1YA 4DSOA 1RKBA 1Q1ZA 2GWHA 4YDSA 4KCGA 2WMNB 4EQ6B 4O25A 1IM2A 1GL9B 4TYNA 3D7MA 4IDHA 1IN8A 3HP1A 4KAXA 5JCPA 5FR2A 1MRNA 1DELA 1OFIA 1FQJA 1DAFA 5KDOA 1TPZA 4L4UA 5FBRB 4EPWA 5BQ5A 1G5PA 2IS4A 2OCAA 4Q9HA 3OE7D 3CPHA 3IPYA 4P4UA 1IOZA 1DPFA 4PC3A 1OT3A 1P5ZB 4WOPA 4NONA 4G5RA 3SQXA 1Z0JA 4JT4A 4AC9A 2O8DA 3ZIAA 3LFUA 4A8JC 4BRUA 1N2CE 4MYTA 4JLMA 3AV0B 2NQ2C 3CM0A 4XIGS 3B1WA 4OHZA 1DAKA 5DN6A 4QGFA 2ZTSA 1KI9A 4HUQA 5E7JA 3DO6A 2QORA 5AK0A 4TYPA 2QMUA 2F1IA 1S1CA 5FUVA 1TQ2A 1E96A 2EFHB 2CNWA 3Q7QA 1E9FA 4MGIR 1ZNZA 1W4AA 4GT1A 2C2HA 2OFWA 4UQOA 4V0ME 5IF9A 3OFNA 1GZSA 3EPJA 2QM8A 3KFVA 4BPBA 2YWFA 3EXAA 1Q1EA 1B23P 4URXR 1VG0B 4LYFA 2VO1A 2XTNA 1P60A 1XEXB 4A1FA 2QEQA 4C0QC 1NLFA 2C04A 3T35A 3RS4A 4ZDKA 3T1OA 2B6HA 4BEJA 1KSFX 5KSZA 3PXGA 1ZINA 3QPWA 2WMOB 4B71A 3T12A 3CNOA 3I32A 1X8JA 3K0CA 2CVFA 1I4DD 3BB1A 1VDZA 3DM5A 4TT3D 3IBGA 3WXMA 3CF2A 3UKDA 5B58C 3QOFA 3PUZA 4BLOA 1MKYA 4GI7A 5EUQB 2G83A 2X1VA 5EXPA 1XWIA 3O8DA 5FL3A 3W8NA 3PENA 1NN5A 2ZUCA 3DMNA 3SC3A 2BBTA 1DO2A 2XSZD 1TUEA 2AWOA 3B85A 4CDGA 1VG8A 3DHWC 3VHXA 2NIPA 1ZM3A 5JJIA 1QHNA 1SGWA 3O47A 5ANRB 1CR4A 1T3HA 2Q9CA 4LYHA 4OJKA 3T34A 2ODNA 4M1TA 2FSFA 2VA8A 1KTVA 1N6HA 1KKMA 3VNUA 1IY1A 2IYSA 2FH5B 4LBWA 2Q3FA 2R6CA 5IK2A 1QVAA 4Q4AA 3DZ8A 1Z3IX 2ZROA 4TTRA 1J2JA 4XTCS 3LRPA 4C9BA 2ZYWX 1E2DA 3A1TA 4TTQA 3QF4B 4ZDIA 4G3XA 3KZ1E 1BMFA 4HDQB 1SVWA 1KI1A 3AKYA 4NYIR 2XZOA 3AVVA 3T1QA 4PO1A 5BXQC 3AKDA 4AWXA 4G5QA 2C5LA 1P72A 3R9WA 2VH5R 1JQLB 2RGCA 1E2NA 1BMFD 1L4UA 2PZFA 2WZQA 3DOEA 4PC1A 1HURA 4RZXA 3E70C 2FZLA 5AJZA 4YMSA 2W83A 2IWRA 1XXHE 2BHRA 2GDJA 3QXHA 4PX9A 3I72A 2ZI9A 3SFVA 1UAAA 4TMVA 1E2GA 3GLFB 1ZYUA 1NMZA 2NO1A 2ZPTX 2ZRJA 1K6MA 3K09A 4RVCA 4ASUD 4QC2A 1KK0A 3ECCA 3A1UA 2V1XA 3D8BA 2RH5A 4B48A 5CITA 4R2HA 3HDTA 1CU1A 2G0NA 2IS2A 3P4YA 1SQ5A 5JBQA 4F4CA 5JEEA 2GAAA 1R5BA 1KK2A 2CBZA 4YMWA 5DHAA 2O8EB 4LC0A 4D6PA 3ICQB 2WSSA 3C41J 3NBXX 5DIFA 3X1DA 1P61B 2ASEA 4LK2A 4OI4A 1E99A 521PA 1Z0KA 2WAYA 2WKRA 2ZRKA 2BBSA 3VFDA 4FN5A 1GL6A 1DVRA 1E94E 4DZZA 1Z83A 1DBSA 5TV2A 4Q4JA 3KTAA 2Z5FA 1V43A 2J0UA 2VP6A 3QKTA 4PAOA 3RVBA 5CB6A 2C9YA 4XD7A 3HR8A 5IRCD 1ZJ6A 1BO6A 3U60B 5CM8B 2ZRGA 3I4LA 3V4RA 1KJWA 1YR6A 1V5WA 4IFBA 3Q5DA 4QJ5A 2C96A 4JKYA 1EXMA 3RANA 4LHWA 2DY1A 2CJWB 1UKZA 1WRBA 2I1VB 2RHDA 3EIQA 2VP0A 1KO1A 4KSBA 1W5SA 3IHWA 2WJHA 2VBCA 1XCGB 4C0HA 2JJ2A 2OT3B 4K81B 2GVZC 4DDTA 4YONB 3K70B 1I4TD 3S1AB 5TB5A 3GLIA 2GBLA 1HV8A 3K0AA 1NNEA 5B2ZA 6Q21A 1OH6A 1NJGA 4X8MA 2OLJA 1A1VA 4Q7JB 3GLGB 1O3YA 2X2FA 2OUKA 3NHBA 3TVTA 2D7DA 5E7MA 1WBDA 4EJSA 5GADl 2QPAA 1KOFA 1UBCA 4D4LA 4R71A 3EZ2A 3FMIA 1F2UB 1QHIA 1T4GA 1TQ4A 1TQ6A 4HEJA 3KKQA 3VHLB 3SDZA 1F60A 4EIWA 2HJGA 1S4QA 2ZI5A 2ZSEA 4OHVA 2DYKA 3KFXA 2IS6A 4BZPA 1FPMA 3F0TA 1XNJA 4XJXA 3SS8A 5CYPA 3PEUA 2VHQA 2CHVA 4NYMR 4Q47A 1E1RD 1XTKA 1ZM7A 5AWFC 4WW0A 2NPIA 1GL7A 4Q48A 1G7SA 1GG2A 3CX8A 2XXAA 1L8QA 2DBYA 3GJ6A 3A4NA 4KVAA 2HF9A 3PG5A 4TYYA 1NL3A 2VF8A 1CJMA 5JHHB 3VQTA 5IT5A 3RRYA 1U8YA 5EXSA 2CE7A 1Z0IA 2IF2A 5DI9A 3GMTA 2E9SA 1NVXQ 5L3QA 3G82C 5H68A 1Q20A 4Q03A 2H57A 2ANBA 2QMHA 1KSJA 3N5CA 4PPGA 1NJFA 5EXTA 3W8RA 1K8RA 3BH0A 2IF0A 1DG1G 4Q9IA 4JLJA 2FEOA 1JEDA 3EX7C 4TZ6A 4IFEA 3GLGE 2QY9A 1EWRA 3ZH9B 1AZSC 5LB2A 1LTQA 2VHCA 4CEJB 2GJSA 4ITRC 2QENA 3EW9A 3TVDA 2ZE6A 2ZE5A 3NEJA 4URWR 4M53A 3CW2A 3IIMA 4Q1CA 1HA3A 3KJHA 4A4DA 4OQMA 1KK1A 3VR2A 3X1WA 4WXRA 3AUYA 5JSZB 1AZTA 3PUVA 3BJIC 3LAWA 4CT5A 1AS0A 1KJYA 2GEDA 3C5HA 3B9QA 2F6RA 1M8PA 1FUUA 3DL0A 2Q6TA 3MRSA 3WHLA 4JSYA 3CR8A 2G77B 3UG7A 5FL7D 4Y0VA 5GJVC 4FI3C 3WP0A 4AYWA 1R5OA 5KPDA 4V0LA 2CL0X 2H18A 1T5IA 2CDNA 1ZCBA 1NMXA 1P7CA 1QDEA 4HYYA 5G41A 1HY3A 5JMTA 1KYIA 4LJYA 5E3HA 4URYR 1ELOA 1MR3F 3QI2A 1KZ7B 4KLNA 4M1KA 4I1OA 4ILEA 5BYJA 3JVVA 2QPTA 1AM4D 4OK6A 5JCZA 1C4OA 4NH0A 2FJUA 1LF0A 2LKDA 3K1JA 3WRYC 1P9WA 3A58B 4TYQA 3AVQA 3DMDA 2WIAA 1QHHB 3PVSA 1E2FA 2F9LA 2WWGA 4OQNA 3P27A 4Q1AA 4UNNA 2DHRA 5K8TA 3EZ6A 4XVUA 1XP8A 3NBZC 1E79D 4D4MA 1JXOA 4EAQA 2VQSA 5EJEA 4DRZA 1QHYA 5EP1A 3LW8A 2JLYA 2WSMA 3GEHA 4JJKA 4A0GA 4GFDA 2FF7A 4RFSA 1E2QA 3FDIA 1YZKA 4TQ9A 4B34A 4B3BA 5KU1A 5KDDA 3L2OB 2GZAA 2QPOA 5DISB 1CRPA 1M6NA 2MSCB 2JJ2D 1R7RA 2CL7X 3QKSA 4FIDA 3NG1A 4RD2A 1VCMA 5KHOC 3TMKA 1UDXA 1CR0A 1JI0A 1QHSA 3OHMA 3WYAA 3CRW1 2JJ1A 4HB0A 1FZQA 2ZRPA 4ZIRB 3EAQA 5P21A 4Q9LA 4Q1DA 3SJAA 2SHKA 1R0XA 3BBPA 3CRVA 3KXKA 2P6NA 2WWWA 2QP3A 1G19A 1ESMA 1NG1A 2ZEJA 3K53A 2DWPA 1IN4A 4NU0A 1NIJA 3AKCA 2WWFA 2ZRMA 5LDDC 5JLJA 2BBOA 5SZIA 2CCKA 4MRVA 4Q66C 3TNFA 4KITB 5BW8A 2AD1A 4F4IA 1M34E 1SXJC 1NVUQ 1IHUA 1RIFA 3B78A 3ETLA 3R9IA 3JZMA 4PQYA 5K8LA 2JJ1D 5DE3A 3PFIA 5BWMA 2N46A 3GJXC 621PA 1K5DA 1TNDA 2P5SA 4KFRA 4PZLA 1R0WA 2ZRBA 1IY0A 4Q7MB 1RRCA 2X77A 3VTKA 2ANCA 3B7GA 3SYLA 4HB2A 1QG2A 1G9XA 4X8LA 3TIFA 2ZM5A 1WE2A 4LCBA 2QAGC 1IN6A 1S96A 4L9SA 2BCGY 2RMKA 3D31A 4AKIA 4URUR 2VLIA 1BOFA 4Z8XA 1SVMA 1XDBA 2XTZA 1HT1E 2LWIA 2CXXA 2WJGA 4U02A 2J0VA 3VAAA 2YOGA 3CB4A 2J7PA 1DAEA 3LBIA 5F98A 1NVWQ 1W2HA 3GJ0A 1OB2A 1YZNA 2ZI7A 2R6AA 1XPOA 5J4HA 2ZSFA 5BN3A 3D3QA 4GP6A 3NIBA 2JLXA 4ZKEA 1Z29A 1CBUA 4TLEA 3VR6A 5KYKA 3KL4A 2DFTA 1G3MA 2O8CB 1K5GA 3RRNA 3RC3A 1AN0A 4HAUA 2ATVA 2YHSA 3PR1A 2GAOA 1E0KA 3CWQA 5KO2A 2B21A 1VYTA 2ZIAA 4Q7LA 5LPNA 2DCUA 3THOA 4PHFA 3FFBA 3NH9A 3ZDQA 4LJ5A 3HYRA 1EFRD 4DDUA 5G3ZA 3SZRA 1E9CA 4V0MA 1FW6A 4BECA 1JB1A 1OYYA 1FL9A 1NMYA 2IYUA 1OE0A 4P3YA 4R98A 4G01B 3FMFA 1D2MA 3VR4A 2DFNA 3HR7A 1KO4A 2PBRA 4A82A 3U7GA 2HUPA 2V1UA 3FE2A 4PO8A 3IQXA 1TQDA 1ZW6A 4GP7A 2KI5A 5DI3B 4D2IA 4NP6A 2R65A 1FP7A 2BJVA 5FI0B 1G6HA 3KQKA 1P3JA 1G291 5F3WB 1SHZA 4TLBA 4CEIB 4GZMA 1X1SA 4PSAA 3TRFA 3TK1A 1PUIA 4KYIB 1SULA 2ZR7A 3W6PA 1I2DA 2PL3A 2XTMA 3DM9B 1GITA 1JXMA 2BIFA 3AF2A 5LBIA 3TQCA 4KFSA 1AA9A 1Z63A 3TSOA 1SZPA 3TKLA 3TAUA 3KJEA 1SVKA 1KO7A 1VCNA 2ZE7A 4MUAA 2XEXA 4EKDA 3QXCA 3WP1B 5JJLA 4GSYA 1J8YF 3C16C 4TSFD 3WYFA 1X6VA 2GHIA 3K0FB 3P1JA 4LZZA 4R9UC 4XWKA 2FV8A 3B1VA 3EA0A 4JBWA 4HB4A 4QNRA 2IHBA 5JS8A 3GP8A 3THWB 5CK5A 2JLWA 1O87A 1Z2CA 4TSFA 1KNXA 2AL7A 1BYUA 2DR3A 2GESA 4CF7A 4LHVA 3CH4B 4YMUA 3LA6A 2J46A 4ESHA 1X1RA 4HATA 2V8OA 4LWZA 4Q02A 4U7DA 2QI9C 1ZUNB 1QHXA 1IJEA 1RVDA 1G64A 1Z6AA 3BOSA 4G5SA 4JLDA 3WRXC 4WAUA 4AD8A 4C2UA 2O8FB 1ETUA 4HAZA 4A0RA 1E9AA 1MRSA 1XMVA 1Z28A 2A2ZA 5EUMA 3N2EA 2RGXA 2PMKA 2VRWA 1UBFA 2PEYA 3L43A 2VTKA 5HR5A 3GLHB 3SI7A 1XEWX 1LV7A 1TX4B 2WICA 3RAPR 3K0CC 2BMFA 3LLUA 4LJ6A 1N5KA 1A82A 1A5TA 3K8YA 5M04A 1NBME 1WA5A 5TMPA 2WAXA 1T0HB 4B44A 4F91B 5KNBA 2J87A 4EFMA 1OIVA 1DAIA 1SVLA 2C98A 3K9GA 1DEKA 4DLXA 2V4ZA 3HPQA 2OG2A 5HPYB 1E9BA 5HZHA 3OEHA 4A92A 4G0NA 4EJSB 3G5UA 2O8FA 3UMSA 1QVRA 4FXPA 4GNKA 3T5DA 2RGNA 3MWLA 2FX3A 2AKYA 5EP3A 3S1AA 2NZ8A 1NKSA 1E0JA 1AK2A 1E32A 2DFLA 3CR7A 3W3ZB 1KDRA 5JI3E 1II0A 3RNLA 1YHNA 3THWA 1TEVA 2ZVQX 2J59A 5IK2D 2IYLD 2YC2C 1G7CA 3SNHA 2IYZA 2IT1A 4E07A 1NLZA 1OXUA 4RD6A 4OQLA 2XGJA 4OI0A 4JLBA 2YJTD 4KFTA 4DEXA 4DIDA 1NG9A 4LHYA 5E95A 3QQ5A 4DLRA 3BXZA 1FUKA 3WMGA 4NCKA 1KO8A 3A4LA 1T0JB 1EG7A 4LOAA 1VIAA 2J7PD 3ZS9A 4C0JA 2AHOA 3CNNA 5CB8A 3NC1C 3A1SA 4LBVA 1OH7A 1GIAA 4MGKR 5JSZA 1KO5A 4PFSA 1NBMD 1NN1A 2G1KA 4NMMA 5FPYA 2ZRHA 2BJWA 2CVHA 2O8EA 4FCWA 2AFIE 2XX3A 3ND9A 1GFIA 2HLDD 2JLRA 4IVRA 5JECA 4ESVA 1TL7C 1SKYE 2EFGA 1UADA 1EGAA 2FOLA 3A37A 4G5OA 3RRZA 3FMPB 2W6JA 1KZGB 3WNCA 1M74A 4CW7A 5C1BA 3PITA 4JL5A 2C77A 2YNMA 3OEED 3R9XA 1UKEA 2ECKA 4QBHA 2ZI4A 3SFZA 3H84A 1GNPA 1YZTA 1W36C 1MO4A 2OZEA 4FMBB 3NHAA 2ONJA 2OXRA 1NVVQ 2V9PA 2FPLA 3W9YA 1FMLA 3U44B 1N6IA 4XSGA 2R62A 4LYAA 1VIYA 2WWHA 2OCPA 3BH6A 1Q1BA 3QBTA 1EWQA 3B1ZA 5FPHA 2EU8A 4C2TA 3KB2A 3ZVRA 2NZJA 3AP3A 4KBFA 1BH2A 1ZCAA 2HV8A 3EWSA 3TLXA 2XZLA 2FE4A 3JVUA 4OQFA 4N0DA 3MWJA 3G0HA 4E03A 1T91A 5TDHA 2UZ3A 4ON9A 2WBLC 2ZJ5A 3X1YA 4TMKA 2OESA 4U00A 4DCNA 4AKHA 2ZRIA 2BEJA 2AXPA 3ZZ0A 3X1XA 1YZQA 2ZSBA 1OPXA 1N6PA 4BLSA 2PLRA 3QNUA 4JLPA 3V9PA 4B47A 2PZGA 1D5CA 3TGPA 2D06A 4TL9A 2P5TB 5DNYB 2HEIA 4TN1A 4S2EA 3ZZTA 3GLIB 1SKYB 4ASUA 2R6GA 2EWVA 2VHTA 3AUXA 4AI6A 1XTIA 3RWMB 3BE4A 1Q44A 4MA4A 3E2IA 3T06B 4QXAA 3QENA 5EZ6B 1TEXA 5C4MA 1MV5A 2P3SA 5FUXA 2ZANA 1U9IA 2IEYA 4Q9JA 1FX0A 5L3RA 4NL4H 3KQHA 1HTWA 4LJ7A 2IYQA 4OBEA 4PC6A 2GJ8A 4Q18A 5EQTA 4DUGD 2OSBA 1G8HA 4TMWA 3B82A 4M9ZA 2W58A 3ZQ6A 2BV3A 1UFQA 2LKCA 3LWNA 2ZJZA 4Q4JB 4BFXA 1R4AA 1LNZA 1UBEA 1U2RA 1W49A 4R2IA 4RZ2A 2MMGA 3HU2A 2ORIA 2IXEA 5KDLA 4BFZA 4YXWD 1E98A 1H8HA 5JWRA 2WWXA 1G21E 1RE0A 1EFHA 4OHXA 4RZ3A 2ZRLA 3KTAB 2AN9A 4CZ2A 2NO7A 2ZE8A 3GLFE 4P4TA 3GJ8A 4W7SA 3CRQA 1LVGA 1G4UR 4JLNA 3AQ4A 1Q12A 1J70A 3GQBA 2RGNC 3EASA 4N1AA 1ZNWA 4A8JB 3UPUA 4LPSA 2YOHA 4ARZB 1H8HD 5H70A 2A30A 4QKQA 3OZXA 5FUWA 2VEDA 3SBEA 4CVNA 2XSZA 2VP9A 4EFNA 1NN0A 2IWHA 3ZS8A 1HT2E 1XBTA 1Z0DA 3AVYA 4JLKA 1XD2A 1S2MA 2EFDB 4KSCA 1JR3E 1YJ5A 4RCYA 4F93B 1M7GA 5FBWB 3SJCA 3TJZA 5K8IA 1OIXA 4ZI3A 2R6FA 1ZC3A 4KBGA 1F48A 3ZIAD 4EFLA 1XTSA 5EXXA 4I81A 4D81A 3LQQA 3FWYA 4DLZA 4DLYA 4FD2A 4N0EA 2UVQA 1DAHA 4ZDJA 2RGEA 2OAP1 2KWIA 2XITA 4BFWA 5KUTA 3BFXA 3X1ZA 3QKUA 1VCIA 3WYGA 5EE1A 4I4LA 4F4JA 2J5XA 1G1MA 1RC8A 2AD5A 3MUFA 1E9DA 3K70D 2OBLA 4LJ9A 3P20A 1D6JA 4DLWA 1E1RA 2ZJBA 4H1UA 3B1YA 3THXA 2FFQA 3QE0A 4B73A 2JIZD 1RYFA 5GJCA 3R7WB 4DEYA 3GJ5A 4ARZA 2IUTA 2ZREA 2ZS9A 2OFOA 2BVNA 2GF0A 2GKSA 4PAMA 4JT2A 1ZNXA 4Q4LA 4YLGA 1TU3A 1W5TA 1E9SA 3K09C 1J99A 4XWOA 4IOLA 3QVUA 1IXSB 4C7OB 4C0BA 4DWJA 4DXAA 5DN6D 5FBVB 4ZO4A 1VHLA 4ZDWA 2H5EA 4HB3A 4RKFA 2CHQA 4ZI2A 4RD3A 3E5HA 2YOFA 1LS6A 4B32A 3GLHA 4D0NA 2HT1A 4WBSA 2WWYA 3AKEA 3QXSA 4MKIA 3WBJA 1II8A 1QHHA 2GNOA 2QAJA 4JLAA 1YRAA 1CLUA 4GOXA 4WA7A 5AJVB 4WVFA 3TQFA 3V4FA 3B8HA 4IOMA 1U0HC 4B3XA 1E2EA 4Z1MD 2ZSDA 2G88A 1BYIA 2ERYA 4XTRA 1N5LA 4IHQA 1KY2A 4C4PA 3MG9A 1G5TA 1VTKA 3QXJA 1JQJC 3ASYA 4MH0R 1P62B 2V55B 1TF5A 2NPFA 1E2HA 4O2LA 2Q9BA 2FN4A 2L0XA 3UATA 1IONA 1OJLA 1YU9A 1BKDR 1CIPA 2IK8A 3MCAA 3UWOA 1E6CA 4LGMA 2IEZA 3NEYA 5EP4A 4TQAA 1CKEA 1TMKA 2IW3A 4FW9A 4HZUB 1ZRHA 2J9RA 4KXFB 1XD9A 4TTPA 2J7KA 1WP9A 4DCTA 4A15A 1R8SA 4CEIA 2IHYA 4C0LA 4JVMA 2F1RA 1VG9B 2B8TA 2WOJA 4Z51A 1ZC4A 1RRGA 5CIWA 3U3OA 1OKKA 2WVJA 2MSEB 2B92A 1ZNYA 2Q21A 1E2IA 5DSZA 3PJRA 3SJZA 4L5BA 2ZQ5A 3RRMA 2FWRA 2PCJA 2BMDA 1XJQA 1JR3D 3QBVA 3GLGA 3SN6A 1G8GA 3CLVA 3AGPA 4HLUA 3CIOA 4EPXA 1CR2A 4B33A 4X8HA 2FMXA 3IKJA 3QG5A 3I8SA 2JDIA 3EWAA 4NCJA 3U3JA 3EPLA 4AURA 1H8ED 3OAAD 4A2PA 4XVQA 4YXWA 1U81A 5D3QA 4C30A 1MO5A 2QTFA 4DCUA 1KMQA 1ZU4A 4UXIA 1NF3A 1ESNA 3SR0A 2DWQA 3GD7A 1QG4A 4HDOB 1M7HA 2AK2A 5UKDA 3FFAA 4PXAA 2C8VA 4LUCA 5CLQA 2Z43A 4ZV4A 4QBFA 4BFUA 1ZU5A 3THYB 3CWZA 1S0UA 3B5JA 4LJAA 5C18A 2GJ9A 4WZ6A 3EPKA 4WZBE 2GEVA 1QF9A 2QROA 5B30A 3A6PC 1G17A 1COWD 4PPFA 3TW8B 2Z0MA 2ZUBA 3LBNA 2FEMA 3FKSD 3RS5A 1NY5A 3U3MA 3ZZUA 2JGNA 4ZCMA 5C4GB 4KU4A 3E1SA 5G40A 3TUIC 2Z4RA 4M1SA 3SOPA 2QSZA 3ZYCA 3QSYA 1OFTA 1R5NA 3GFTA 3LNCA 4IJMA 1R8QA 3KQNA 1DADA 1OLOA 1RRFA 2AXNA 2RKOA 3LD9A 3P4XA 1GILA 1G8FA 3CZQA 1DE0A 1W7AA 4DDWA 3DDCA 2XNDA 4B6FA 1DAMA 2B7CA 2D2EA 4V02A 1ODFA 3TE6A 4UNPA 3T5GA 1E0SA 2F9MA 2W2TA 5A0FA 4US2R 1YE8A 2IL1A 1IN5A 1D9XA 3DEFA 4TLDA 5JWOA 4P31A 2WTUA 4JBXA 4FWTA 1UF9A 4CT4B 2D74A 821PA 4TMZA 3OFND 1GKYA 4CEHA 3C8UA 5EE5B 2EFEB 1GNRA 2CNWD 3ZLJA 3VR1A 3QF4A 3W6OA 1G41A 3H4MA 5KSOA 1HE1C 3Q85A 2GXSA 3BD9A 5JS7A 2FSGA 2J0UB 3KKPA 3QKSB 4L8GA 1R6BX 4RFSB 2ZRNA 3RLFA 1IQPA 1VPLA 2REBA 1G6OA 4OL0A 5HTKA 1XCMA 5CYOA 3LDAA 1Q21A 2GETA 1TADA 4POAA 4G5GA 1ZD1A 1U0LA 3GCGA 3BIFA 4MGZR 3B9PA 1C9KA 3QXXA 4IXNA 1GKIA 1PJRA 1JBKA 2CMKA 1KMHB 1OXTA 3C15C 2GZDA 3R8CA 3DVLA 3H86A 3PEVA 2W2XA 4IKEA 4TT3A 4NPHA 3UK6A 1EFRA 3QIAA 3KJGA 1XB2A 2XZPA 2GJAA 3KQUA 1WXQA 4B74A 4IVPA 2C03A 4NCIA 3PEWA 3U44A 3K0EA 1NLYA 4LC1A 3U61B 1RYHA 4PAQA 1FNMA 1N6LA 4DKXA 4M2LA 1G3IA 4JBYA 1GAJA 1ZMXA 3PUYA 3ADCA 3IGFA 2UKDA 2QT0A 4KVGA 5KNDA 1U0JA 4A0FA 1QRAA 4TWZA 4FMCB 3NDBB 4NYMQ 4QM6A 5KPJA 3LW7A 4NTZA 3VU9A 3AEZA 4C3ZA 4PZYA 3K0FA 2W00A 1G5RA 2Z6VA 5DGXA 5FOTA 5FR1A 1RFLA 4LRWA 4RD4A 4XD7D 4ACBA 2W2VA 1G20E 2ZITA 4PPNA 1KDPA 4CRWB 1GVNB 1A4RA 4OJQA 5FH9A 3REFA 1NRJB 1LF5A 3BB4A 4MRSA 4GBMA 1OXSC 3CPEA 4BFVA 3RDPA 4O2RA 2UZIR 3TH5A 4R7ZA 2WIBA 1E2KA 3GJ3A 4D0GA 2QP4A 1ANKA 4OI1A 4UXHA 3OIWA 3LXRA 2GJKA 4BZXA 2A5GA 2I4IA 3NKVA 1JALA 3UXMA 3Q9LA 3WMFA 5AUQA 5DI3A 2ZRFA 3GEIA 1P2SA 1Z0FA 1BS1A 3OE7A 3WHKA 1OSNA 4YC7A 1XRJA 2V7QA 4D26A 4JJZA 1EFTA 4CEJA 4HZUA 4PO9A 2GF9A 2QAGB 4PQFA 1ZD9A 1U94A 3T1VA 3KQLA 2GK7A 3A8TA 3AF4A 5F9HA 1A7JA 1ZIOA 4M9XA 4A6PA 1J90A 1N3BA 1G3UA 2FGKA 4JKIA 1CXZA 4EPRA 3NWJA 2Y8EA 2ZRCA 4Z54A 3JZAA 1Z07A 1XCPA 4WXPA 4CIDA 1Z47A 2H16A 3A36A 4K8OA 1P75A 1T3SA 4B43A 5BN4A 4TYWA 3MGCA 1G3RA 2O8CA 4W5WA 1COWA 2RHMA 1OH8A 1XEXA 3VKHA 2F1JA 3U4QA 4LPKA 2VIIA 4KJZA 2NO9A 3W3AA 4MRPA 4B6EA 5SZHB 2XXAB 3LVQE 3OF5A 5L3SA 4P33A 5H1YA 1UDWA 1W36B 5LD2C 3EPHA 1G8PA 3ZQJA 1W47A 4MGYR 2XJ9A 2Z4SA 1A2BA 2QMEA 5C2JB 4QOSA 5FOVA 3OEHD 1W0JA 3SHWA 4C7OA 1FTNA 2QTHA 5HKKA 3ZD7A 4NKRA 1N5IA 1VKJA 2QSYA 2XNDD 1CR1A 1Z22A 5GJWC 1E79A 2JLVA 1CF4A 2ORVA 5FTNA 2BDTA 3H1TA 3LH5A 4IOJA 3HWSA 4XWAA 2OAQ1 1OFHA 4W9MC 3U7FB 3UMRA 4HI0E 4QGGA 1WQ1R 2IYXA 1PV4A 3L0IB 4LJ8A 5FTJA 3ZD6A 2ZRAA 3EIHA 1PVOA 4W5HA 2ZSAA 3MWKA 1P2VA 3RS7A 2FFBA 4Z8YA 2QZ4A 2VHUA 5AUNB 4BGDA 1AJEA 5GVRA 1Q3HA 4OYHA 2X8AA 1YRBA 3I3SR 3BERA 3SYNA 1R2QA 3EZFA 4TLAA 1LW7A 2GVDC 1D8TA 1XMSA 4Q4HB 3SHFA 4DC9A 4PZZA 3OIYA 4QG7A 1KSHA 2F1HA 4P4SA 3A1WA 4EDHA 2JA1A 2G3YA 5GVSA 2WJJA 2HF8A 2C99A 4US0R 2EW1A 3T61A 3KXIA 3I5YA 4B3CA 5CJ2A 2PMDA 2W0SA 4Q1FA 1LY1A 1N6OA 2AX4A 2BCJQ 2QUZA 3BS4A 3TUZC 5J4YA 2X19A 4AIIA 3WMEA 4B3GA 2ZRDA 1U9IC 2VPPA 3NC0C 1RJ9B 4FMDF 4OKSA 5J4LA 3U6BA 2WJIA 3FB4A 3TUJC 2ZJ2A 4Z1MA 1L2TA 2JLUA 1XXHB 1X8KA 3KKMA 4IW3B 1HH4A 2ZI3A 1N6NA 2ZU6A 1XFAA 4ZCLA 3ZVLA 2VL7A 5B57C 3WBKA 5FPKA 5FOXA 2P6UA 1CULC 1D2EA 1NSFA 3AVTA 3T1TA 1CJVC 5HCNA 4OHYA 1HUQA 3ADDA 1PLKA 4B3DA 2RCNA 1WF3A 4UNRA 2XOKD 2HYDA 1P2TA 4HLUC 3U7HB 3MFYA 4LV8B 2O0HA 3GLFA 2NO6A 1VG1A 4OHWA 1KAOA 5CDFE 2OCBA 5JI2E 3Q3JB 2P2LA 4E5UA 5BN5A 2QGNA 2YWGA 4L9WA 5AUPB 1Y63A 2O0KA 2DWOA 2F7SA 4MITA 3B2EA 4JLOA 4G1UC 2O52A 3WY9A 3P26A 2F3TA 3AF3A 3K0SA 2QG6A 1E3MA 2V7QD 4F92B 1XPRA 3HJNA 3AP2A 1W48A 2NG1A 2XB4A 2ZR0A 2ZAOA 3BAFA 1E4VA 2DPXA 4WZAE 1ZUHA 1OH5A 1HYQA 5AR1A 1EX6A 3CF6R 2D2FA 4C0SA 2BEKA 3K70C 3ZVNA 2ODWA 2YWHA 4LV6A 4ZKDA 1GNQA 2O0JA 3MMPA 2JATA 4AKGA 1VYUA 4F38A 5J4VA 3ZGXA 4MKHA 1OW3B 3U7EB 2HXYA 1XZPA 1GTVA 4NBSA 1KI7A 2JDID 1OIWA 4RCZA 3LY5A 1MO3A 1X8LA 3UWKA 3MAAC 4M1OA 5EZ5A 4DVGA 3NBYC 5HZKA 1C1YA 1R0YA 1AKEA 1DOAA 2PJZA 1CP2A 2CLCX 5EE9A 2A5YB 3U3RA 3AVXA 3I8XA 2JIZA 1Q3TA 1KSGA 1PLJA 1T6NA 4P32A 1LB1B 2QE7A 3EA5A 2FGJA 2C78A 5J40A 2JJ8A 1Z6GA 2CL6X 1JJ7A 3AVOA 1ZM2A 2PZEA 1W4CA 4GZLA 1Q0UA 5A4JA 2ZJAA 5G53C 4DLVA 4CYMA 1VMAA 2EYQA 5KSPA 2EWWA 2IXFA 2QMOA 4HLDA 1UBGA 1Z2AA 3CNLA 4IRUB 2OM2A 2ORWA 3QKRB 1F2TB 1G7RA 2PX3A 3I1FA 1Z0AA 1GSIA 4V03A 1KMHA 1YZGA 2B7BA 1UKVY 3TSWA 4QGAA 5DYIA 2A7QA 2HYIC 1G8YA 2GRJA 2QRNA 1KI3A 3FHCB 5C46F 5JZVA 4TMTA 2BM1A 2G1JA 1CJKC 1KI6B 1W0KD 3UG6A 4A9AA 3SYKA 2QA5A 2PX0A 2IC5A 3WNDA 5AJWA 4DBLC 3CRMA 2PEZA 4HUQB 2GA8A 1G7TA 2IYWA 2J0SA 3QY0A 2W6ID 3FVQA 1IXZA 1DG3A 1GOTA 2OILA 2P65A 4EPVA 2O8DB 4M21A 3FMOB 3BC1A 5DHFA 4B3FX 4QHSA 1Z8FA 2FFAA 2OHFA 3RYTC 1S3SA 2RGAA 4CEHB 2K5UA 2IXGA 1OB5A 1MABB 5KTYA 1U8AA 5DYGA 3EARA 3CUEF 1XMIA 5JFGA 3GJ7A 3RS0A 4B2PA 5JJKA 2C9CA 1JAIA 4H1VA 3TAHA 4AYTA 3C5CA 1KKLA 1LFDB 1W4RA 1ZD8A 2OXCA 2HCJB 2IYRA 1EFUA 3AB3A 3FYHA 3B1XA 4URZR 3IIKA 1JJVA 1IAQA 1GRRA 1J8MF 4GDFA 1AS2A 3EZ7A 1SXJA 2OBMA 1MO6A 4Q21A 4KI0A 2RGBA 4PHTA 4B35A 1GP2A 3EC1A 1G16A 121PA 4Q4AB 4LYJA 4A8JA 3I62A 1OV4A 3NBFA 2GXUA 1YKSA 8OHMA 3GFOA 5FOUA 2QRZA 2IUUA 1UEJA 5AJXA 1WB9A 1E9EA 1TF2A 2JLQA 1G3QA 1F5NA 4JL8A 3VX4A 1XEFA 2IYYA 3VX3A 2P6RA 1YVDA 5CLLA 1RRPA 3X2SA 4I1VA 4RSGA 4PSKA 1ZBDA 4P0TA 4KYUA 1KY3A 2OBNA 2ZUDA 3ICEA 1F2TA 2VSOA 5FFMA 1U99A 1S9DA 1SXJB 1AIPA 1PZNA 3V00A 3W6NA 1S9HA 1D9ZA 2QGZA 1E1QA 3KJIA 3J81k 1AKYA 2CCGA 3BORA 4GRAA 5TY0A 4Q19A 4Q1EA 4Q1BA 4MYCA 4GMXA 4P4SB 3EC2A 1NY6A 2FFHA 2JLZA 5H8WA 1TU4A 1L4YA 1G4AE 2CHGA 2N42A 4KLZA 3VKWA 1U98A 2IS1A 3L82B 1KAGA 1MT0A 1B0UA 1R0ZA 5JHGB 1FX0B 2QTVB 2ZJOA 3CX7A 3TW4A 2CLSA 2KJQA 3L8ZA 3PCRB 4V0OA 4NYJR 3MWYW 4M8NE 3RSLA 4GOKA 3IBYA 5EE3A 5FTKA 4FMDB 2OV2A 1T5LA 2VF7A 3UMFA 4O3MA 5HCIA 2IYVA 3O8RA 1UPTA 1XEWY 5AUOB 2GEUA 1HQCA 4DIEA 3WNBA 4FWIB 1I4LD 3F5FA 4NCNA 4IOKA 4ZCIA 2ZAMA 3M6AA 4B75A 2ZJYA 2TMKA 2FZ4A 2J45A 2FG5A 2Q3MA 4QM7A 2KBEA 1NSTA 3L8YA 3AH8A 1NKTA 2YYZA 3Q72A 1TAGA 3C14C 1E2JA 3QKRA 1SXJD 2WHXA 3IPXA 1SHKA 4FINA 3OESA 4GOJA 4NZYA 3GEEA 2RAPA 4ABYA 2IYTA 3AM1A 3HYTA 2YKGA 2CJWA 5FTMA 5EP2A 3ADKA 5SZKB 3CZPA 5J47A 2YWEA 2C9OA 2GXAA 4LSGA 1XPUA 4BZQA 4J0QA 3KUDA 5E4FA 3U6KA 1XF9A 5FOSA 1ZUIA 2D3WA 1W4BA 2G9NA 2QN6A 2O8BB 3IUYA 1XMJA 1W0JD 3IHLA 3BH7A 4C0KA 1UM8A 3TR5A 4EQ6A 5IHPA 1CRQA 2V3CC 2BMEA 2FSHA 1P9RA 3LQRA 4BQSA 1AS3A 3DKVA 4LDJA 4ERNA 4DSNA 2F43A 3LLMA 2W6IA 4JVNA 2FU5C 4LX0A 4BLQA 1DAGA 1W2GA 4QJ3A 2QU8A 4AKEA 3SQWA 4E22A 1ZM4A 3AVWA 4TZ0A 3U3KA 2C95A 2ERXA 4GMDA 1KHTA 3RABA 2XB2A 1DTSA 2ZETA 1XXHA 4BLRA 1Q1QA 4M1MA 2QBYB 4YMVA 3BB3A 5CDFA 1S8FA 3VR3A 2ZYUX 4D4KA 1UJ2A 2A3RA 4JYCA 1H65A 5D3MA 4HLQB 1VYVA 2WWIA 2OCYC 4PR0A 4DSUA 1TUIA 1YZLA 1SXJE 5FBLB 3PEYA 4UNSA 1N6KA 2FDCA 4Q00A 1IN7A 2A5FA 4MYHA 1CTQA 1NIPA 2BKUA 2BC9A 5HE9A 4LBZA 2P0EA 4JZKA 1Y3AA 2LCFA 3VKGA 4NCHA 4BLPA 4I1UA 1AQUA 3MJRA 5DH9A 3L0PA 3IDQA 1ZP6A 4LY6A 4F7WA 4UKDA 1Z6TA 4RFVA 1EX7A 2WPDA 2ODBA 2GXQA 2VP5A 4DJTA 2J0QA 4AK9A 1KIMA 4MDEA 1NP6A 3Q5EA 3CF0A 3U5ZB 4UXJA 2VYFA 1XD2B 1HQYE 4TQUS 2JCSA 2EVWX 1XJCA 4HAXA 1N0VC 1Q22A 4MQBA 4PTLA 3QVVA 5LD2B 2JEOA 2H92A 1W44A 4LHZA 4QBGB 4A2WA 4HDCA 2Q0HA 1X3SA 1W46A 3EG5A 3HU1A 1HEIA 1Z6YA 4LHXA 4QRHA 3EZ9A 1BIFA 3FKQA 1XD8A 3AGQA 1H8EA 3OAAA 3O8BA 1GM5A 1PUJA 2X2EA 3LXXA 4FMCF 2G0TA 3ASZA 4FCVA 1MH1A 4HAVA 4N3NA 3I5XA 4GPTA 1YR9A 2R6DA 5KNCA 2BBWA 3QUSA 2VP2A 4DT1A 4IVQA 3H2YA 721PA 5L3SB 2AFHE 2FPKA 2YC4C 4M9QA 1IXRC 5J5CA 1KJZA 3LVRE 1TF7A 1OHHD 3OIVA 3CH5A 2NO0A 3UIEA 1E2MA 3F8TA 3W34A 2N1BA 2MSDB 3BGWA 5TVKA 3BFKA 3VNVA 3A4MA 2ZR9A 2A9KA 4KHZA 4BLTA 3GLHE 1OF1A 2HDNB 2I3BA 1S3GA 1ZVQA 4D80A 2BOVA 2EQBA 1T8TA 3Q7PA 5CK4A 1P9NA 5K8UA 3ZJYA 2OEPA 4B2IA 3C7KA 1W0KA 5G3YA 4D4JA 4Y0AA 5EE0A 3IO3A 4D0LB 1CJUC 4EUNA 3QF7A 1E9RA 4UJ5A 3TSZA 2OE2A 3BFVA 3KX2A 2FSIA 4Q5IA 4BASA 1E1QD 1UKYA 3CONA 2ZJ8A 4M1WA 1US8B 3LV8A 4TL7A 1NN3A 2XJ4A 1XTQA 1YQTA 3RS2A 3IEUA 2OFXA 3N70A 4MRRA 5FL7A 5J4KA 5L3VA 4US1R 3CRRA 2H7VA 1OYWA 2ZS7A 2GZHA 2J1LA 3BK7A 4OK5A 4XOIA 3DKPA 3L0OA 3P32A 4NYIQ 4QBIA 2H17A 1KDTA 3NVAA 4QL3A 5TARA 4BFYA 5FOWA 5F2EA 4A0HA 4YQFA 3SEAA 4NHOA 1WBBA 1OKKD 3TR0A 1IJFA 1QZXA 1U90A 4TMXA 1CS4C 2YINC 1EESA 2YVUA 4OQXA 4DDVA 1EK0A 3RWOA 3THYA 4V0NA 2BM0A 3RS3A 3LX8A 4BUJA 2W0MA 3FTQA 4V0KA 4DLSA 1MOZA 4HAYA 2ZXUA 2PLFA 2O8BA 3LBHA 1Z5ZA 2WKPA 3GJ4A 1FQKA 4M22A 5FI1B 3RSOA 5TXGA 5DLQC 2BKEA 5FPTA 4DLTA 3R8FA 1IBRA 1FNNA 2JLSA 3B6EA 3QG1A 4RJLA 4Q7KA 4JS0A 4PC2A 4URVR 3REGA 4D82A 2QT1A 5E7IA 4A36A 2GCOA 3ONWA 3A1VA 1OFUX 4KO8A 2V54A 4K46A 4LBYA 4H9GA 4L15A 1Q57A 3CX6A 5JWHA 2QAGA 1KDOA 2Q3HA 2W6JD 2WM9B 2FA9A 3I92A 1UEIA 3GFPA 4FCTA 3M1IA 2KE5A 3QPUA 4M0LA 3AVPA 2QQEA 3NXSA 1FP6A 2NOAA 3B13B 3NTUA 4GL2A 1NI3A 3AVUA 2DFKB 4IEEA 3PUWA 1XTRA 2B8WA 2BWJA 1XU4A 4BFSA 1SVSA 2YZ2A 3QEJA 1US8A 2RGDA 5SZJA 2R2AA 1E0AA 2AR7A 4EPTA 1T8UA 2IA5A 1GUAA 3QPVA 2CEAA 3VR5A 3I73A 4HAWA 1II9A 3MSXA 4E09A 2CK3A 2RB4A 4AG5A 3IEVA 2ZU0C 1YR7A 4BRWA 1E2LA 3CO5A 4NE2A 5ELXA 4JL6A 2ATXA 3MD0A 1R10A 4JMPA 3RHFA 4HLCA 1Z06A 1W1WA 3HPRA 3N2IA 2WJYA 5F9FA 1J7KA 3M4YA 1XX6A 5LB4A 4BWYA 1JR3A 4RD1A 1W36D 1CEEA 5JEDA 3VMFA 2H1LA 4ZIRA 1WCV1 4IDOA 3KXLA 2KB0A 1T3LA 2DB3A 4QHYA 4I99A 5JRZA 1A2KC 2HXSA 2HLDA 3PUXA 5IDVA 4M4SA 1PLLA 2J41A 4QNMA 2NMVA 2XNSA 2REXB 2QL6A 2GCNA 2A5DA 1QHGA 2V6IA 2IBMA 1II8B 1Z6XA 4MRNA 4DT1B 3LO5A 2KBFA 1GRNA 2AWNA 4Q01A 2P67A 3SE0A 1P2UA 1DS6A 1KI6A 3MLEA 3FPAA 2D62A 4DHEA 2D4HA 3DPUA 4LV5B 3CPJB 4B76A 3W90A 3T15A 1M2OB 3QEOA 2ODEA 1N0UA 1G18A 1KI4A 1EFCA 1VECA 1WMSA 1WDTA 3FGNA 5CM9C 4Q9KA 4DSTA 3OEEA 3O8CA 2EFCB 4AYXA 4BE7B 2QE7D 1JPNA 2WSSD 3GLIE 2CCJA 4NYJQ 4O0MA 4CGZA 4QJ4A 3AP1A 3THXB 2QNRA 2GILA 3SBDA 1HE8B 1U8ZA 2GCOB 4YDHB 1NVVR 3KDSE 4JYBA 2V6JA 4PC7A 3FKSA 1GDDA 3U4QB 3MJHA 2F55A 4IXMA 4DLUA 5HKKD 5GJBA 1Z08A 4A2QA 1DARA 2R44A 4KODA 4MYUA 3W5IA 4BEBA 1XJ0A 2VHJA 4MDFA 1SKQA 1N6RA 1AGRA 1SVOA 2PT7A 3NH6A 1GWNA 2PCLA 3FHOA 3LX5A 3K9HA 4RKEA 2F3RA 1GKUB 3C4JA 3CKLA 2Q9AA 4TL8A 2REOA 1JEEA 2BMJA 4B2LA 2NGRA 1MABA 4I1SA 1F3OA 1E2PA 1YR8A 4PHHA 5JRJA 1RW4A 3QJYA 4DCVA 4KV9A 3EIEA 1TTTA 4HSEA 5KOYA 2A5JA 2PJRA 4UJ3A 4PQRA 3ZVMA 4JVLA 5BYKA 4OI2A 2I1QA 5FBQB 4LJ4A 3DZDA 5AJYA 5FPSA 2HT6A 4IEIA 4MUBA 3M0EA 3KKOA 3K9NA 2PT5A 4ACAA 3PIRA 1VHTA 4YMTA 3KKNA 2JASA 2WPDD 1E69A 2AKAB 1N5JA 4IDPA 1L7VC 2VSXA 2GBLC 2G6BA 4WIAA 4ZPXA 1JPJA 5KSYA 4RD0A 1JECA 2WJVA 2IX3A 2QM7A 4U5XA 3DOFA 3B60A 4HUTA 4D25A 3I61A 2CLDX 1JR6A 4DUGA 3L0SA 4PSVA 3BWDD 2KSQA 5B64A 221PA 2OO7A 3OIUA 3R20A 5HE8A 4PANA 2MMCA 3VU9B 1KNQA 1P4SA 1YZUA 1XZQA 1NBMA 4HZIA 2WKQA 4MKGA 1DO0A 5FUYA 4DB4A 1AGPA 3FHTA 1S1MA 1KK3A 2VSFA 4W5JA 4TLCA 1IY2A 1X86B 4KFUA 3FOZA 2Z83A 1FMJA 5L3QB 2GTPA 1OHHA 4XVRA 1FFHA 4TL6A 1T9HA 1GRQA 3KB1A 2HJVA 3SJBA 2E87A 3PV0A 1N0WA 2FNAA 2WV9A 1M1YE 1KGDA 2QP9X 3W5JA 1KI8A 2E1RA 3TBKA 4PHGA 4PPQA 3AF1A 2OLKA 1OXVA 4EPYA 1RZ3A 5A5GA 2ZI6A
chains in the Genus database with same CATH superfamily
2XA1A 5CIQA 3AYXB 1I10A 4HNQA 2GK6A 3TS1A 2G1AA 3SHQA 5TT0A 1L4BA 4B82A 4ZICA 2CLOB 4UDNA 1RJ9A 2IUSA 1PD1A 3H17A 4XDZA 2A1TR 2C5BA 3FW1A 3F9RA 2KX7A 4NS1A 1ZITA 5IAKA 2CGEA 3RSSA 4BCCA 2DKFA 1ZAKA 4UE6A 2WPNA 4IS3A 2I33A 1ZD3A 1EVEA 3H0KA 1A97A 1IAVA 2JAQA 3D5TA 4QXRA 3SCZA 2BGWA 1GARA 4JQZA 1OTXA 2YV5A 4DXHA 3IIJA 4OHKA 5EWLA 3CLUC 5L8VA 5K6AC 4KMMA 1KGSA 3FI0A 3AF0A 1C9NA 1EZ1A 3UHAA 3ZZ1A 3U2QA 4DV6B 3R9KA 5I7WA 2JFFA 4BFTA 2D7CA 1ULAA 5JYEA 1K5PA 5JMOA 2IXAA 3F2VA 3N1UA 2EYUA 2ENWA 2AOUA 5E2AA 3MTEA 1AQYA 1M7BA 1KWGA 1JFRA 4DWVA 2CMGA 3HU3A 2W4IA 1J33A 2B2NA 2JGEA 1M72A 4HDNB 3RUEA 3HCPA 1ZQ9A 3EVBA 2A88A 4GGPA 4Q24A 1LTKA 4CF5A 1UP4A 2I3DA 2R9VA 1MX9A 4F85A 2X2PA 3IILA 4KK3A 3KQVA 3L7NA 2G06A 1VXOA 2WFLA 1Y5NA 1GSHA 3L1HA 4MPJA 1AO3A 3K94A 4GEGA 2FPMA 1P0CA 2V6FA 2BMWA 3FYSA 2IOQA 3HJTA 4KWTA 3ZHOA 5AH0A 4KIJA 2F67A 2ALJA 2GWRA 2WZDA 3VZDA 3K9LA 4I1IA 4W1QA 1KRWA 4OYRA 5HBRA 4WY8A 4AY2A 1X7XB 2VDRB 1STOA 2VDVE 1BX1A 5DV9A 4ZRDA 1HRKA 1F17A 2GCPA 2NT4A 3AUKA 4CM4A 1SUBA 2INGX 2MYUA 1N25A 1LFAA 1P6XA 3HGTA 3NHRA 2RGGA 1Y8CA 1PW7A 4AJLA 4UNQA 1SXHA 3E0QA 2AMFA 5BRAA 4AS2A 3WGNA 3LECA 5HBGA 4JYMA 1B2LA 1V11A 1X94A 3LUKA 5HIIA 5LC1A 2YW9A 4HMQA 5ALWA 3WFIA 5IYZF 5FJIA 3R7WA 1KYZA 2VJPA 4O4LA 1FDWA 3RF6A 2KM1A 1JNYA 4F06A 3NLLA 5LL6P 2PUBA 4OK3A 1JN0A 1ZIPA 3VMMA 1P7WA 2I22A 1RKBA 4IH1A 2GWHA 4KCGA 4RPCA 2WMNB 1DT3A 3IJPA 4C5CA 3EIWA 4J3FA 5BOVA 5BSMA 2FX2A 1YJBA 2XMCA 4YR9A 3WGMA 5FNVA 1PE0A 2YVLA 1FQJA 5FYQA 3LPNA 5LLTA 2RH4A 5FBRB 5JSFA 2OCAA 2HZ7A 3ETJA 2XXBA 3QU4A 3RADC 2QIPA 4P4UA 2OGZA 2YJZA 3VJLA 1DPFA 4XIIA 1KP3A 1EJ2A 1XWWA 2PBLA 3GFQA 3BQMB 1O54A 1O6BA 1P5ZB 4WOPA 3V8QA 2QRQA 3ISVA 1RP7A 4C22A 1Z0JA 1R6VA 4JGIA 4IGKA 4JT4A 2G4VA 2P9CA 1PR1A 4CM9D 4HQFA 4JLMA 3S8YA 1ADCA 1BEZA 2G7ZA 1AT1A 4M0DA 4XIGS 3LZCA 3IQFA 2FQXA 4CMBA 1QGUA 5JIBA 4OHZA 3PFCA 1XALA 2PRIA 2CBGA 4QGFA 5DF1A 1IZYA 5DN6A 3LP8A 4CQMA 5JU6A 3PLRA 4KXYA 5B7QA 1FFYA 1UIRA 1BXGA 1MJFA 3ELWA 1JHVA 4CMHA 1JEYA 1JKJA 5EGSA 5AXAA 4DQ0A 1RXIA 2XW6A 2X58A 4KN6A 5JAOA 4JBNA 2C2HA 4JWKA 3WGTA 3WQRA 4HNSA 2Z3ZA 3OFNA 2XYQA 4JUIA 2QS9A 3DD5A 3EPJA 3LVBA 3PNYA 1RQ7A 1E7QA 1RAEA 3HCCA 3JAWA 1EQUA 5CU7A 4YRMA 1VHQA 1VG0B 2C2MA 4LYFA 4TVOA 1M2VA 3NU1A 4R81A 1XEXB 5JSHA 2VAPA 3DFZA 2KYRA 4Z9XA 2FJPA 2RAUA 2BGGA 2CMHA 2C04A 3T35A 1EB9A 3HKBA 3OQ1A 1RDFA 4J03A 4BB9A 2AVNA 1SOWA 1BJRE 1M0WA 2G70A 1AKUA 1LC0A 3NP9A 3T1OA 4BEJA 1K0UA 3PXGA 4DL9A 4MCHA 4JB3A 3T12A 3CNOA 1Z5PA 1ZIYA 3I32A 1USKA 2CVFA 2OV6A 2R1VB 5HQTA 1JZSA 1I4DD 3BB1A 1BGVA 1W88A 4TT3D 4DM3A 3CF2A 3UKDA 1Y3HA 3U80A 1Y6GA 3J7AC 5EUQB 5E8RA 5EXPA 1JLKA 1FQWA 1E7SA 1XWIA 1U2DA 2IX9A 4MUNA 2WJZB 4WKGA 1E3SA 2ZUCA 2FKNA 5K0NA 2BBTA 5IKOA 4MW5A 4XPIB 1X1QA 3SZLA 4CDGA 4QDZA 3B85A 3ZEIA 2QR5A 4XRGA 2NIPA 2Z56A 4EZIA 3NALA 3AOEA 1FTQA 3JPWA 4OREX 3TLKA 5JCOC 5TVGA 3OBBA 4IO1A 3U4DA 1T3HA 5H0IA 2EV9A 4CV1A 5KNDH 4IF4A 4E30A 5H80A 4DZRA 2ODNA 2YHUA 4BO3A 1NFQA 1V4VA 1RWNA 4YMIA 2VA8A 4HN2A 4E1BA 3OCYA 2IYSA 5F5LA 3DWEX 2Q3FA 1EGQA 4HDAA 2CF6A 2HM7A 4HKTA 4Q4AA 5D1HA 2IHTA 1Z3IX 1HZZA 2XA9A 5C0OE 4TTRA 1J2JA 1D7OA 3LRPA 4C9BA 2ZYWX 4B9AA 4ZDIA 3OJCA 3GYBA 4G3XA 5BUSA 1MZPA 3KZ1E 4QTUB 3WADA 1FU8A 3H3JA 2IPXA 1ADYA 3WX0A 4EB0A 5BXQC 1YB2A 1OZFA 3AKDA 4IIHA 4KXXA 5JLAA 5C81A 1TJ5A 5AYVA 5JD4A 5JTUA 2BFEA 1A9RA 2AOWA 3ER6A 3WK7A 2PZFA 1L4UA 2YL2A 3KOZA 4PC1A 1HURA 4RZXA 2Y1EA 4EW2A 5AJZA 3EQ9A 3OX2A 3IBFA 3KR9A 3RM3A 1DX4A 4ZOLA 5LYJF 1XKLA 2GDJA 2DKOA 2P8JA 3MINB 2W98A 3Q0TA 3I72A 2ZI9A 4V0RA 1UAAA 3EZXA 3GLFB 2YN0A 1NV8A 3H97A 3KEQA 3BIXA 1R0RE 3R0XA 3D0KA 4ASUD 3TNLA 4QC2A 2AIRA 2XPCA 4WNAB 2R84A 3ZHZA 2X5KO 3LUPA 4MEBA 1HDXA 3SZMA 4B48A 5K3CA 1OTYA 1B0ZA 1CU1A 1WZIA 1XZFA 3CLRC 3F5DA 3A3OA 5EJ7A 1BS2A 2I9KA 2E5LB 1EMDA 1B74A 3N8DA 2XCSB 1R5BA 1VMEA 1KK2A 2C3YA 3RJ9A 3FOWA 4XJTA 4D3YA 2O8EB 2HSJA 1PJ3A 2WSSA 3T9CA 1MDBA 3RKSA 2ZCJA 2V7UA 1P61B 2ASEA 2AJBA 5EMLA 1VRCA 2H52A 2CV2A 1X7ZA 4MV4A 4JJAA 1H22A 2ZRKA 2ET6A 2BBSA 3ZWVA 2HO4A 1E94E 1GCOA 2DH6A 2JCGA 2PWPA 4S0ZA 1GQOA 2V6BA 1Z83A 2FW7A 4N0PA 2JJYA 3BA6A 4BCBA 4F96A 3V2GA 3IXQA 3LGAA 4PAOA 2QW8A 4DG9A 3CX4A 1N75A 1P33A 5EZYB 2HD4A 4XD7A 4YFVA 3HR8A 1W96A 1U11A 3AOGA 5K20A 2CV0A 4DFDA 3IA7A 2PMEA 5KNCD 2R5NA 3GFFA 4AF8A 1OGYA 1V6SA 5CM8B 3I4LA 1FVFA 1YR6A 3T4XA 3HBNA 3WWOA 2OGSA 1LQTA 3ZI0A 2B99A 2P77A 3R24A 4R68A 4S12A 5H7XA 2RHOA 3VSCA 1EXMA 2FW0A 3HJRA 3RANA 4CV3A 2DY1A 3A2NA 4LRQA 1K06A 2RHDA 3I1JA 1JIXA 1KEZA 1KO1A 1BCRA 1PFKA 4B3SB 5DNVA 2WJHA 3LF1A 3IHKA 4G8JA 2YN4A 3M5DA 2XQFA 4WESA 1TTHA 1N7GA 3QEMA 2NYVA 1YA8A 1ES9A 5FKJA 4TS3A 5EFOA 5TB5A 1HFWA 2GBLA 5LQJA 2PQ0A 3K0AA 1L7XA 3L7JA 4XUDA 1NNEA 3KZVA 3PTAA 1A8SA 2OXEA 1V0JA 3NHBA 2OUKA 1Z37A 4FSHA 5GADl 4DMFA 1SC6A 2QPAA 2VVTA 2IHVA 4HS4A 3V7NA 4N5HX 4F8JA 1F2UB 4KUHA 4C7KA 4KR3A 3L1KA 1DKOA 4HEJA 3ZU3A 2NU6B 1F60A 3AM5A 3VVLA 1ZD2P 1NYTA 1PT6A 5DSXA 4BMXA 2DPGA 3HBFA 3P2IA 5F5NA 3LRTA 2VDWA 4BZPA 3RV4A 3F0TA 1ZXBA 2DCMA 3N05A 4IDFA 4B85A 1YQXA 2DBVO 3QMWA 3KLMX 1XDWA 3NHSA 1ZLYA 3PEUA 4BO1A 6AT1A 1E1RD 1ZM7A 3IMCA 5A9SA 3NP7A 4MV3A 4YPVA 3IEPA 3NCTA 5CHYA 5AM4A 4DUZB 2O0LA 5KINB 3LT1A 1G7SA 1GG2A 3CX8A 4J0CA 4NZ9A 2ISSD 3DLTA 4LYEA 4ZVUA 3A4NA 4KVAA 4DRXB 3PG5A 2OHHA 1ICIA 3SVTA 3HKDA 2CY0A 5JHHB 1RJGA 1D0VA 1U2PA 4KP7A 3RRYA 1I3OA 4B7ZA 4MUGA 2E9SA 1DBIA 1E60A 4DE5A 1QM5A 5L3QA 1DJMA 3G82C 4XIJA 3PC7A 1GV1A 1Q20A 3CT6A 3R77A 3AFNA 4Q03A 5MDHA 2QMHA 5BOSA 3GP3A 1ZH8A 5LP6A 4WK4B 4PN7A 3BH0A 3P9XA 4Y2JA 1HFEL 1VSTA 1Q14A 3NHYA 1I3NA 1JEDA 1NTRA 4GO1A 2H29A 3GLGE 1EWRA 3NONA 3O2SB 3CJRA 1AZSC 4CEJB 1TIKA 3HKCA 5JNWA 1Y5LA 1EVLA 3BD6A 3NGMA 4FFBB 2P9GA 3F5MA 1ONOA 2ZE6A 4ZZ1A 1RYBA 5JCXA 4K9SA 3RBZA 2ZDHA 5KREA 4S3MA 2PXAA 1KAMA 3BCSA 3FH0A 1Z16A 1X9GA 5BXYA 3OHPA 4OQMA 1TYAE 1Q3KA 3X1WA 4WXRA 4UAVA 2IVFA 5JSZB 1NJ6A 2EHJA 1NW6A 2Q3CA 2WZBA 4OOFA 5K3BA 4YRBA 4TLMB 1LPOA 2P9QA 4NAUA 3M1YA 3DUFA 1GAWA 1TDJA 2XNHA 1FUUA 3W2FA 3FX2A 1ZHHA 2Q6TA 4K03A 3RVPA 5IT4A 4JI8B 3WIDA 1CETA 3KR1A 1RXYA 1KPHA 4CNBA 4EY8A 4AYWA 4ZD6A 1R5OA 4HWTA 3UKOA 2CDCA 3E58A 5CB4B 2J33A 1P9LA 5A06A 4BLWA 3ABOB 4V0LA 2HF2A 2H18A 1DEAA 4JVOA 4Q0MA 4TRMA 5G41A 4G85A 1P7CA 3N7AA 2MTBA 3U81A 1VGQA 2XVZA 3Q40A 4RX1A 4UMFA 2Q8QA 3C1TA 4LJYA 2R6R1 3RYIA 5DCUA 3ZGOA 5IN4A 1ULZA 2GM3A 3BD7A 4L9AA 4R7TA 1LX6A 4FE7A 4MOWA 4RVSA 2QKYA 2HJHA 4ILEA 3ASVA 4EDFA 1BDBA 1OLXB 5LQMA 2B61A 2QPTA 2AZDA 2CC2A 3EFEA 1LBIA 5CLJA 4AUEA 5JCZA 4YJ2A 4NH0A 3JRXA 2DR2A 4O3FA 3JQBA 3RTDA 1N57A 1C3XA 4FGSA 3A58B 4R8VA 5B37A 4TYQA 3LRXA 1HDEA 1ZGGA 4BAZA 2WIAA 3PVSA 4E31A 4OGLA 1SR8A 4U6NA 4UFPA 4ARBA 1MQ9A 3JALA 2FVXA 1JS1X 3OZUA 3DL4A 1JHMA 2C9DA 1YR1A 4V2IA 3V2UA 2I1WA 3EZ6A 4EGFA 3L84A 4YCSA 5KTNA 3KUXA 4R01A 3IR7A 1NRXA 3D3WA 3OKAA 1DOZA 3AG6A 5KNDD 4GYJA 4BNFA 4J6FA 2Q7DA 1N77A 1SURA 2I7CA 3G5AA 1GYRA 2C8LA 4OQ4A 1VJGA 5TQJA 4ZYWA 1A2QA 4RFSA 3UWPA 1E2QA 1TCAA 4BWVA 1HK7A 3SLRA 1AXRA 1ZJ5A 4PYMA 5DISB 5J1TB 3ISJA 3VYUB 4KX3A 1EDBA 1RWOA 1RZRA 5JISA 5AK3A 5EHIA 3IAUA 5C5DA 4FIDA 5K3OA 1Y34E 4DLAA 4RD2A 1ULHA 4P82A 5MGBA 5J63A 3CRNA 1D1PA 1HLFA 4RMGA 1JI0A 5EL0A 5IDYA 1TTPB 4EJ0A 2VRBA 1MJHA 4C43A 3B3JA 1J2EA 4YT8A 3OT5A 1FZQA 2ZRPA 4YAOA 4Q9LA 3SLKA 2SHKA 1GZDA 4M9UA 2P6NA 4BO0A 3T7DA 3BWEA 2DPLA 2GM5A 1ESMA 3OSUA 1USVA 4O0LA 1GLVA 1JIQA 2BBOA 1RVV1 4F5ZA 2Q3LA 1ECJA 4YJFB 1V8FA 1ZH2A 2AD1A 3SLGA 4N6OA 1RIFA 1IHUA 4I0WB 4EUEA 3C70A 1QNFA 5BWMA 3A05A 3GJXC 4AXBA 621PA 3BK1A 2XMSA 3GUYA 1C5KA 2P5SA 4KFRA 4R1PA 3T52A 1SCBA 2OXIA 4UM9B 3PXBA 1WVIA 3PC8A 1SG6A 4EVRA 4Z4GA 1M83A 1RRCA 4N9WA 3VDRA 2W6MA 3VTKA 1BC5A 1KR5A 3R6WA 4ZV9A 4HB2A 3VZSA 3HM9A 1NVGA 3TIFA 4O1MA 2O8NA 2QAGC 4JNCA 4E46A 4RQBA 5ECYA 3LC0A 4UW9A 2HB6A 2RMKA 4AKIA 4URUR 3GT7A 2WFAA 4ENSA 1Y5MA 2EKPA 3P2EA 5AHRA 4PZAA 3L8FA 1C7ZA 5AT1A 5ER6A 4A0QA 3GJ0A 1Q84A 4BO2A 1X2EA 5J2TA 1JIIA 4M99A 2J07A 2HHJA 4MUEA 5T57A 4N48A 3EODA 3NIBA 5HYVA 4EMBA 1GVHA 3ITNA 2XMGA 4WADA 2OV4A 1BDHA 4WZAA 1M8JA 3MGGA 4BKMA 2ISCA 1TLFA 1W8DA 2WT8A 3AL3A 1DQYA 1K5GA 3E4DA 1GFZA 2FXIA 4HAUA 2YHSA 4KDFA 1MC5A 2SICE 1YNSA 3CWQA 3GGOA 4Q7LA 5KMGA 3A1EA 4UU7A 3THOA 5LPNA 4L1KA 1BWPA 3FFBA 3UUGA 1Z15A 2DBZA 4YDQA 2TMGA 1UZUA 3HYRA 1E92A 5ENVA 5EQFA 3GFSA 3SZRA 1E9CA 2XUFA 4P53A 2Q2NA 4BECA 1JB1A 1OYYA 4UM9D 3SIXA 1YMUA 2LDBA 2XD4A 1FL9A 3KSUA 4S1OA 5CD1A 5K2MA 5C8DA 1UODA 4YIHA 2VPXA 4YUVA 3VAZA 5I7UA 2QUIA 3U09A 4HNRA 1NUHA 4LK3A 4QYIB 2HUPA 3QVTA 3UW1A 1EK2A 5HCUA 1TQDA 4BKRA 1ZW6A 2KI5A 3W5BA 1J25A 5HKLA 3U0VA 3UM9A 2ZB4A 3LFHA 4BGUA 5F3WB 1JEOA 2VWQA 3OURA 5K0ZA 5EPEA 2ZYHA 1MNQA 3ZU6A 4MP6A 4QVGA 1G38A 1PUIA 4TYMA 1HKHA 1B26A 3LWBA 3SMQA 1I2DA 1L7EA 3LYUA 1JSZA 1GITA 3GVIA 2R00A 3AF2A 3TQCA 3EVNA 4J1SA 1NR1A 1X7YB 3ICPA 3KSBC 3PGMA 2PQ2A 3DNPA 2FWJA 1JL3A 2YV4A 4B40A 5TMDA 3RO7A 3COVA 4OHRA 4MUAA 4X54A 5JJLA 5DCWA 1EFPA 1G55A 5DK6A 1LDMA 1JDPA 2GN0A 3GCDA 3L46A 2UDPA 1CY4A 3UXYA 5T6MA 1OR8A 1TI7A 1Z4IA 3R3XA 4GIBA 3K0FB 3M83A 3P1JA 2I4NA 2RI6A 3C45A 2FV8A 3B1VA 5KYUB 2X8JA 2QJTA 4X1IB 2WYVA 4HVLA 3CWCA 5AKZA 3FIUA 3B3GA 3BPSA 4MP3A 1KNXA 3BIOA 1BYUA 3C97A 1QDUA 5JAHA 5T4HA 1WZNA 5AMXA 1XP5A 1EA5A 2C2ZA 4AP6A 4NU5A 3LA6A 1ZOIA 2J3KA 1TA9A 3R3VA 4UUQA 4LWZA 3WWEA 2HIHA 3GT4A 1OU0A 1ZHFA 4TGLA 5CW1A 1QU2A 4MDYA 4YH1A 1IJEA 1OFGA 1NT2A 1IVNA 1YS1X 4JLDA 3WRXC 1R4NB 4KRXA 3BDIA 3MMNA 3IVAA 2GZ3A 4PZ0A 4ZU6X 4WXYB 1E9AA 4DZTA 3IUPA 1UXHA 1I7LA 1MRSA 1XMVA 2SKCA 1I2AA 3COYA 3FPLA 3WK6A 1NGSA 5ITZA 1PG2A 3X43A 3A6GA 1N1DA 1ST3A 1KMCA 3EGIA 1PT7A 3SI7A 1QQ5A 1LV7A 1TX4B 4K6KA 5CMLA 4ICIA 3RAPR 1ADFA 2CHUA 3C1OA 1A82A 4W5OA 5AVWA 1A5TA 3K8YA 1DX9A 1NBME 1WA5A 1TVMA 3M5PA 3PC3A 5TNXA 3RRBA 4F91B 5TMPA 1EUCA 4XXHA 4CG0A 2JGMA 1L4NA 3T3EA 1DAIA 3FYDA 4C6TB 2E4UA 2OG2A 1R8XA 2G5PA 5HZHA 2YMPA 4G0NA 4NNOA 4UUAA 1E6EA 2H85A 4KN8A 2ZT5A 2XKJE 3WJ2A 4Q3CA 3WXBA 4H15A 4Z7JA 2VOJA 3R3ZA 4ZVKA 3GZJA 3MWLA 1PQYA 1WU7A 1GKKA 2Z1DA 4Z4CA 2YW2A 3MCZA 2R97A 4C7JA 2DPYA 4YJ2B 3VO9A 4QSHA 3AEYA 4OKNA 2DFLA 1ZJZA 3AO0B 4II2A 1I2BA 4U8GA 2JIPA 2P78A 3THWA 3W2IA 4A03A 2ZVQX 1XZHA 2J59A 5IK2D 5EJ2A 1N5DA 3SNHA 1BGWA 2J6HA 3KK0A 4C4SA 3RAFC 1FLAA 3HSYA 1OXUA 4K9PA 4W1SA 4RD6A 3DXYA 4LWOA 2ZOSA 3A6ZA 4RYLA 2WM2A 4JLBA 1LBHA 4WK6A 4WXHA 4DEXA 4DIDA 4ER7A 3A2KA 3AFHA 5E95A 4FEEA 4O8ZA 4ZT6A 4RGQA 1HGXA 3WMGA 1Z4KA 2QN8A 1J9GA 3A4LA 1T0JB 3L01A 3U40A 2DLDA 4BNGA 1LPBB 3AIMA 4FOTA 4C0JA 2J5QA 6ADHA 1L8OA 3A1SA 2HMVA 2XBUA 3COWA 3ROTA 4MGKR 1U1CA 4FDLA 5K3SA 4D43A 5JSZA 3LBAA 1J5XA 4KRGA 2VUUA 3FLAA 2OP1A 3UYLA 5JQGA 3OC0A 2BJWA 4I8IA 4DJAA 1R12A 1UANA 2XMQA 3BMQB 2AFIE 3FJ1A 1PV1A 1W52X 3EGDA 3ITKA 4Y1EA 1GFIA 5CNIA 4BLVA 5AFSA 4ESVA 1IBMB 4G86A 2Z08A 2YFQA 5JDCA 3WNQA 3A37A 3RRZA 3V8RA 3IVRA 3ZDAA 3FMPB 2W6JA 4HN9A 4L74A 1KZGB 1V8DA 1PVDA 1UOEA 1Z5GA 2C58A 3RAGA 4CW7A 3PITA 4F2WA 4YT2A 5CA0F 4XDYA 4JL5A 4QLAA 1TK3A 4IRMA 2YNMA 2ZPUA 3R9XA 1A7AA 1UKEA 4IILA 4UUMA 1SD2A 4ZO6A 3SFZA 1I1NA 1H94A 1T2AA 1GNPA 3KJXA 4N39A 5BOSB 5FO1A 1Z7YA 3NZEA 2ONJA 1U8XX 1YJXA 3HKDB 1FUIA 4R0VA 3H4VA 4YRLA 1FMLA 1IDN1 4B6RA 4W5RA 3D1LA 1X7HA 4R4JA 1RKXA 2WD9A 3S8MA 1VIYA 2WWHA 4KRYA 5JXGA 3GJRA 2P90A 2Q27A 3C48A 5CG1A 5F64A 3KTOA 4QQKA 3NWOA 2YXDA 2H0QA 5B4TA 3EVDA 3KP1A 2CVZA 4C2TA 1W73A 3PQFA 3AP3A 4B2LA 4GYWA 4F1KA 1ZCAA 4LY0A 1INLA 3EWSA 3JVUA 3G0HA 2PFKA 1EJ6A 1P74A 4ROSA 2NO4A 1ZY2A 3G49A 2ZJ5A 5DDIP 3TWOA 2RG1A 2DULA 4PS1A 1QS0A 1FFAA 2M6KA 4AKHA 4LZJA 2BEJA 4CCYB 3NHJA 2OL4A 2HA7A 3HCNA 3NHMA 4INJA 2QD4A 3X1XA 4OXRA 3WLHA 3MSCA 1MA3A 4E2XA 1RQ2A 4YRTA 1JIKA 2R7NA 2PLRA 2YVAA 4JLPA 4B47A 4EHJA 5CDUA 4ZEMA 1O03A 1ZEJA 1PR5A 3IUBA 3VPDA 5DNYB 2AG8A 1O6GA 3ZZTA 1GT91 1VXRA 3PC2A 3HO1A 2XY4A 4Z49A 5HRAA 4H1TA 4CXMA 3ZY5A 2EWVA 3AUXA 2DFVA 3RFFA 2ZWMA 1Q2UA 4MA4A 3NS7A 3RGGA 2R00C 5EZ6B 1TEXA 5C4MA 2PKEA 3TQSA 4R9SA 1MV5A 2HCFA 2W4QA 1W5AA 1O94C 2ZANA 4Q9JA 4CN9A 2I6QA 5C51B 4OX9B 1UPCA 1V3UA 1Q0LA 2WYIA 1FJ2A 1K3TA 2BD0A 2GJ8A 1HOXA 1UMDB 3QUBA 4FLEA 4GH5A 4DUGD 4BZZA 2O3JA 3AUSA 1Q77A 2AW3A 3HL4A 4H27A 5T3UA 4B3TB 2BV3A 4C2BA 3DVQX 1WHSA 1R4AA 2QJWA 3DE6X 1L7RA 1ORWA 2I4LA 3H65A 4UEQA 4Y2HA 5GZ6A 2ZB3A 2WYHA 4BFZA 3FNEA 4MVWA 2CJPA 1CUWA 5JWRA 2QV0A 1DWPA 1EFHA 4OHXA 3CY6A 5I7HA 1HE3A 1B6SA 4CIAA 4CZ2A 1WP4A 2NO7A 4C14A 1AHNA 3F9IA 3LPMA 1Z5WA 4FIZA 1O8CA 3LQ2A 4W7SA 3CRQA 4C76A 1G4UR 3OF2A 3AQ4A 3UK1A 1BVRA 4HDSA 3DL2A 1GL3A 3K31A 3HVRA 1TRHA 2VDJA 5H70A 1FMFA 1DAPA 1PJSA 2CNLA 4W8HA 1L5RA 4QKQA 4PEVA 5KX5A 2VEDA 2GAFA 3EZYA 2OY0A 2XSZA 2VP9A 3CB2A 3F7TA 4EFNA 3N8IA 3Q5GA 1VJCA 2X7HA 5CYGA 1Z0DA 3AVYA 5BV7A 2Q0XA 1TD1A 1JAYA 3P52A 1UT8A 1C9DB 1GGKA 4X6XA 2C2WA 2H2FA 4YRZA 5FBWB 4BUCA 1XAIA 5LIRA 2AFVA 1FEZA 3ZHQA 4KBGA 5LMNB 1JQAA 4EFLA 3HGMA 5EIXA 1NXPA 3O8OB 3UHFA 3FWYA 4A7PA 4C6SA 5CCBA 1R4ZA 1PJ2A 2UVQA 1DAHA 3NBAA 5DNEA 3WGIA 2O9JA 3RQIA 1I51A 2V4MA 1D2AA 3PJEA 4H7JA 4IMPA 3VR6H 5HXAA 3GFRA 3NIFB 4CU2A 4BFWA 3FCOA 1ULTA 2QPLA 4XWYA 1R1DA 3WYGA 1ULBA 1E6KA 2DUMA 4F4JA 5ALPA 1JIVA 2WJPA 1RC8A 3PL5A 2M6SA 4O4JA 1QH8A 2GO7A 3P20A 4HMOA 4R3NA 4ZYTA 2ZJBA 4H1UA 2YZNA 2FFQA 2YXBA 3G9ZA 3GJ5A 2IUTA 3FMVA 3LPCA 2ZS9A 1A9XB 4IY1A 3IJ5A 2GF0A 1KE1A 4JT2A 3DFFA 4R1NA 1OWPA 3K09C 4C20A 3O82A 4QJIA 1Z2OX 1ZK0A 1RLIA 2P6PA 5EIOA 1VSQA 1HLGA 4DXAA 5FBVB 5DN6D 1A9TA 1RM4A 3W2TA 4MTCA 3O8LA 1BMQA 4G4SO 1BDMA 1RRVA 1PDVA 3E5HA 3IDOA 1LS6A 2XIQA 1NF9A 1EH5A 4KQEA 5DGTA 2DERA 2HT1A 2O2ZA 3L1JA 1SB9A 3QXSA 4WBSA 3USCS 5JMPA 1QHHA 3L8MA 5DBGA 3NIWA 5TX7A 3DDHA 1YRAA 3F3SA 4KACA 5CLHA 1CLUA 4E13A 4OM8A 3R74A 1AKQA 1ML4A 1X3LA 3MMXA 3A6EA 1U0HC 1T2DA 3MQ4A 1T2CA 1RWXA 2EL9A 1ZXXA 4GD3Q 1L1FA 3RRXA 1T6BY 2XADA 3H13A 3ZE8A 4YCMA 2CLIB 4N65A 3QA9A 5IN5A 4F5WA 1TO2E 3ZCTA 4CLRA 2POCA 1SRQA 1G5TA 3CUYA 4ZAZA 4ZQHA 1JPUA 1N2JA 2VJKA 4DIBA 2HA3A 5BSRA 3VC2A 2I6GA 3AK4A 3FR8A 4OLFA 4V39A 3UAGA 2YIMA 2FN4A 3S7ZA 2Q5LA 3FPCA 1B4DA 3JSAA 3PD1A 4EHAA 3KV1A 2BTQA 1YU9A 2ZSKA 1CUBA 1XIVA 3DAYA 1GZHB 3FG9A 3MF4A 2UZAA 1BKDR 2IK8A 3UOGA 3PR2B 4LGMA 4L5IA 2WSLA 4OY3A 3NEYA 5A9SB 3AQIA 5JYBA 3MJ4A 1TMKA 2G9RA 1BGXT 4KAJA 4KLAA 4FONA 3M3DA 3V2HA 6REQB 1ZRHA 4L5YA 3DT8A 3NC4A 3WRXA 3E5NA 3SIRA 3DPSA 4TTPA 2YXNA 1WP9A 3KKKA 4I46A 4RTLA 4A15A 1TQ8A 4LTDA 2IEIA 2YHBA 4C0LA 4JVMA 4ZEVA 1VG9B 4RENA 5EJ4A 1LDGA 2CKDA 3TDKA 1O58A 3VDXA 4Z51A 3ENWA 3IESA 1CUJA 1NQAO 1RRGA 2ODTX 5CIWA 5DTEA 2B92A 1ZNYA 3ZGYA 5C35A 4E5YA 4X7BA 3A06A 2AV6A 1WEKA 1WG8A 4DA4A 3O9MA 3LIIA 1CS0B 4JROA 2YQ5A 4PYQA 3OX4A 2YASA 2ZUVA 4RXTA 3GDFA 3R40A 4HLUA 4A16A 4R16A 1XQ1A 4BFLA 3DTVA 1KU6A 2B9VA 3IQZA 4EPXA 1KF0A 4FBMA 3MEQA 1JXQA 4X8HA 2GPWA 2FMXA 1MRZA 1NBOA 4BMPB 4PVCA 4DIOA 1DKPA 4HWRA 3AETB 3J80A 4RSHA 2Y1OA 3IYLW 3ZLVA 4A2PA 5HUQA 2ZIZA 3AJRA 3CEPB 5D3QA 1UK7A 3LHKA 4YJKA 1BFDA 4JUAA 1CFZA 3CH7A 3W5DA 1U7PA 3O94A 1QCYA 1Y7IA 4WECA 2C7RA 2A58A 2IQIA 2O07A 1T5HX 3ET5A 3LA8A 1MAVA 4WZBB 4ZWNA 1RJDA 5UKDA 5BN3B 1KHHA 4LUCA 5B1IA 1YE5A 3QVGB 2Z43A 4J3JA 4MKXA 3MJVA 4QBFA 4RH1A 1HDCA 5ALOA 4ZV4A 3THYB 2XAAA 2N47A 2WEKA 2WILA 3H7AA 3C98A 4IIXA 5C18A 3MMSA 4FZVA 4M49A 4R6XA 4WLEA 3EQ7A 1NNLA 3NCHA 2VFAA 3NASA 2ZUBA 4OJTA 1X80A 3F7MA 1NY5A 2R1UA 3SX4A 4YJ3F 1DIRA 2QE6A 1HQDA 4ZCMA 1NUPA 1Q50A 3QLTA 4PWZA 1PFGA 3E1SA 4Y9SA 5FB3A 2XA2A 4M1SA 1PYGA 3SOPA 3WZ2A 3ZYCA 4OFWA 4DJDC 2PBZA 4MS1B 2WD7A 3KQNA 2G82A 4RVUA 4UE2A 3SEQA 2PUCA 4KG7A 1KP9A 3W4IA 3CZQA 4AX4A 3BKWA 1DE0A 2JFHA 4X6UA 2GPNA 1KXZA 4WNAA 4DDWA 5AI9A 2EIHA 4B6FA 3OQMA 2JFGA 4B8ZA 2Q7OE 2Q1YA 4BHTA 4M87A 2P2CA 2I2AA 2OC4A 4PVDA 4L27A 3OIFA 1ODFA 3WIOA 1I24A 2O5EA 3UT0A 1KRHA 4OP1A 1TKAA 2D00A 4YJ2F 3CHYA 2EJCA 3JD4A 1E7RA 1IG3A 3DEFA 4YFYA 2ZVJA 3IE1A 4YCAA 2BI8A 1TE2A 7ABPA 4IIUA 1HDGO 3F2IA 2YV1A 3E9DA 1JXAA 1JZQA 1T0BA 2DR0A 1TYDE 2NV6A 2VNJA 3L7IA 4TM8A 1ODIA 1GKYA 3HUFA 3C8UA 5EE5B 3SM3A 3HBAA 1WCIB 3K9QO 4AY5A 3M9LA 2CNWD 4WBNB 4AKSA 3QF4A 5PNTA 3GPIA 4MA0A 4K0KB 2B5WA 4EW3A 4RANA 2G4LA 1OU4A 2IYNA 3IAM1 1MC4A 1WWKA 4MX8A 1P3DA 3Q85A 5KSOA 3PIIA 1VL8A 3KKPA 5JS7A 2GR9A 2PU5A 2JFZA 1H0KA 4FP9A 1RWBA 1UK8A 2ZRNA 3GWGA 4KPUA 3RLFA 4QU5A 4MPPA 4D8UA 1OXKB 1G6OA 3AL0C 4TKUA 3B3QA 1DKQA 2GUWA 5DNWA 1Q21A 5E6RA 2XDAA 5DLDA 3FCAA 2XT0A 5A6VA 4DR4B 5BWCA 5IUJC 4TVBA 4IX1A 2QL5A 1ESEA 3W9SA 1NAIA 1ZD1A 1U0LA 1VLMA 3BIFA 3B9PA 1C9KA 4MLZA 2IP1A 4IXNA 3ZKAA 4BAGA 3E7WA 4JFAA 4DMUB 4JI7B 3EG9A 3JX9A 4G5XA 1ODJA 2FPWA 2GZDA 3E9CA 4J8PA 2GCGA 4IKEA 1N2IA 2W2XA 4U0KA 1X7GA 4NPHA 3UK6A 5CB0A 2JFUA 2B1IA 1CSEE 3DF7A 2BLLA 3UF0A 2GJAA 3D64A 3F7NA 3MRXA 1DTWB 2IUEA 4B74A 3EAGA 3PRJA 5EIBD 3K0EA 7AT1A 1M54A 3BCHA 5LP6F 4JA2A 2VXCA 3V33A 1GA4A 1U0JA 1V25A 2GERA 1QRAA 1OBHA 2XUQA 4TWZA 3RFVA 3QWFA 2GM9A 2CLEB 4LXYA 4WH0A 5E0KB 1Y9ZA 1P45A 1O6FA 5DVZA 1NRIA 1BZYA 3MBKA 2QX4A 3VV3A 4L5CA 3M6FA 1IQRA 1ORVA 1QRDA 1G5RA 2W00A 2Z6VA 1FX1A 3AHIA 3MYRA 3HSSA 5DGXA 4W5TA 4RD4A 4XD7D 4FGUA 4OX9Y 5BT9A 5JZOA 1KJ8A 1G20E 2W2VA 1EE9A 3HC7A 3KV3O 4N7MA 5C7OO 1SQFA 4L7QA 1QYRA 4RO0A 2AA3A 1WDKA 4R3UC 4BV3A 3ZY2A 1KEWA 2BSXA 3EAFA 3NV9A 1OXSC 3CPEA 3IS3A 5ISMA 1NVDA 4O2RA 4IWYA 3TH5A 3K9FC 1F5SA 4R7ZA 1NR7A 3KR0A 1N3LA 2P6MA 4XIFA 4ZXPA 5KWSA 1XWFA 4YY3B 4IDDA 1ANKA 2HZBA 4WUTA 1IBSA 2RKBA 2OLEA 4AZTA 2NYRA 3G8CA 3Q6MA 4L72A 4KMOA 4URHA 3Q9LA 5DOVA 2AMJA 1DU4A 2OBXA 4I3HA 3QFTA 3F6SA 3I6MA 3ONFA 4UQLA 5ALHA 1FS5A 2UZ0A 3OE7A 1W85A 3WFJA 1F0YA 1XRJA 5CAEB 4PZPA 2V7QA 3O3OB 3OX1A 4D26A 2O2JA 4HZUA 1UKAA 2P1DA 1A1SA 3WIVA 3DBVO 1QH1A 3KQLA 1FU4A 3WFZA 3PK0A 4A8PA 1CVLA 2GK7A 4HFMA 3KEMA 3KKLA 4M9XA 4GZ5A 3FUWA 3LUBA 1N3BA 1WMEA 2QG4A 1VSUA 2WIJA 3SM9A 3TLCA 3ZDRA 1C3LA 5EHZA 5JH7F 5JZSA 4JELA 4BDSA 1LPAB 3KZMA 1I7DA 3RSQA 1Q0HA 3KO8A 3NWJA 4MIKA 3SY8A 5FNVB 5AVSA 2ZRCA 5JJCA 2CUTA 5DZSA 1Y1LA 1UWCA 4F97A 1U9ZA 2JI6A 4B43A 5KHLB 1X13A 5BN4A 3VC3A 2R751 1YS6A 3EXEB 3MGCA 5EQDA 3UA3A 4AUNA 2O8CA 1OI4A 3HXTA 4I8DA 1VOTA 4RK7A