1HURA

Human adp-ribosylation factor 1 complexed with gdp, full length non-myristoylated
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
180
structure length
180
Chain Sequence
GNIFANLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLSNQLRNQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the human ADP-ribosylation factor 1 complexed with GDP.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
molecule keywords HUMAN ADP-RIBOSYLATION FACTOR 1
total genus 51
structure length 180
sequence length 180
chains with identical sequence B
ec nomenclature
pdb deposition date 1995-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00025 Arf ADP-ribosylation factor family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1hurA00
3QXJA 2OXRA 2EFEB 4AI6A 4Q9LA 4CDGA 4B2LA 4QJ3A 1Z0AA 4HUQB 3IPYA 4ABYA 2Q9AA 4TZ0A 1E2GA 1JJVA 1N6IA 1XEXB 3IQWA 2ZITA 3LLUA 3OEHA 2W2TA 3GJ4A 5M04A 1U8ZA 3CNOA 2FFHA 4UQOA 1R7RA 3ZS8A 4IOKA 3RS4A 3CH5A 4M1KA 4G5SA 2XZPA 5FTJA 1YR7A 2LCFA 1YE8A 2WMNB 1DPFA 4U5XA 4DDVA 3B5JA 3ADKA 1MO3A 1CRPA 3EPHA 1CR4A 4Q19A 2CBZA 4GZLA 1FX0B 4KV9A 4DKXA 2J7PD 4M21A 1WF3A 3CO5A 1TQ6A 4L9SA 4EFMA 4URVR 1P61B 1W48A 1F2UA 2XNSA 1GOTA 3ND9A 4PSAA 1VHTA 2A5FA 1SKQA 2WJIA 3W34A 3GPLA 4AG6A 2ASEA 2V4ZA 4DSTA 1XZPA 4R9UC 1U0HC 3FGNA 2GESA 2QP4A 4DUGA 4GBMA 2F3RA 3H4MA 4DDUA 1M7BA 3RWOA 3RYTC 1ZUHA 4WA7A 5DHFA 2OT3B 3R9WA 5JEDA 3KKOA 2O8BA 3KTAB 1G5PA 1Y3AA 1KMHA 2WV9A 1SVMA 2Z5FA 3L8ZA 1Q21A 3NEYA 1RZ3A 1XMSA 5LPNA 1XTQA 1AM4D 4K8OA 3AGPA 3T1QA 1XTSA 4Q21A 1UF9A 3IHWA 1XTKA 2EYUA 3UPUA 5EQTA 2GZHA 4BLRA 4CEIA 2OCPA 2QMEA 1P2UA 1FNMA 4U02A 1B0UA 2BMJA 3RWMB 1EFHA 4BZQA 1S9DA 3WXMA 2O0HA 4F91B 2GJKA 1TPZA 1JB1A 1XD9A 1NVVR 3PJRA 2QQEA 3PVSA 3W3AA 1RJ9B 3PEUA 2IYQA 2V7QD 4A0FA 2D7DA 5BN3A 2D62A 5DIFA 2FZLA 1SGWA 2X1VA 1MR3F 3LX8A 3O8RA 4LC0A 1PVOA 3REGA 1CS4C 4B71A 1R5NA 2W0SA 3FB4A 221PA 2IC5A 2GCPA 5IRCD 3W6OA 1XB2A 2WPDA 4TWZA 5D3QA 1G7CA 2JGNA 4W9MC 4YC7A 2CDNA 4OQMA 1WRBA 2VYFA 3BB4A 4Q9JA 2ZAMA 1BKDR 4Z1MA 2J59A 2CL7X 4EQ6A 4GOKA 1H8HA 721PA 1MABB 3CRW1 1KI9A 2CK3D 4RVCA 3REFA 4JLNA 4YDHB 3CRMA 1VG0B 1M1YE 2BKUA 4A4DA 2F1RA 5DN6A 4MQBA 4MRVA 2QRNA 3M6AA 3F3YA 3LVRE 5SZKB 2PX0A 3EZ2A 2OBNA 1LF5A 2J0UB 4AC9A 1U98A 2H8KA 2H92A 1TQ2A 2RHDA 2Q21A 1KI7A 3MWJA 4FCWA 5EXXA 3THXB 5IK2A 4PPFA 2GHIA 1GRNA 1SVSA 4AKEA 4DLWA 4YXWD 1C9KA 3GJ3A 3W6PA 1QVAA 1S4QA 1X8LA 3AUXA 2I3BA 3ETLA 4I81A 521PA 3RVBA 3TVTA 3VR1A 1UBCA 2QAGB 1EFCA 5EXPA 4PZLA 4D2IA 3W90A 3TSWA 4YMWA 4HATA 5DYGA 4DDTA 1ELOA 3HWSA 1KJWA 4B44A 1W5TA 3U7EB 1TAGA 1N5KA 5KO2A 2JCSA 2QRZA 1WBDA 1JR6A 4PAMA 2J0SA 2ECKA 1MO4A 1XD2A 1UADA 2IYVA 1QHGA 1Z29A 2C96A 5EZ6B 5KYKA 1E79A 1NF3A 1II8B 2P0EA 5FPHA 1ZM2A 1D2MA 1U0LA 3U6BA 1JR3A 1AZTA 1OSNA 4LHVA 2VIIA 1SZPA 2FMXA 2FU5C 4JLBA 3RRNA 5TY0A 1N25A 3TKLA 4DLRA 2CXXA 1XCPA 3B7GA 2WJYA 4XTCS 4QGAA 2O8CA 1FUKA 1NIJA 2ZM5A 4LI0A 4BZPA 1SVOA 3MSXA 4C0HA 2W6IA 2X2EA 5KNCA 4BFZA 2V9PA 1EWRA 3KXLA 3EA0A 2ANBA 3P32A 3BAFA 4Q4LA 4DXAA 1IY0A 3ZQJA 1YVDA 2ZRIA 3DVLA 1XRJA 2QI9C 3SQXA 2ERYA 3CPJB 2N42A 2BDTA 3QENA 4D0NA 2R8RA 1T3HA 1U94A 3N5CA 4Q03A 5LDDC 1UDWA 5TXGA 5J4KA 4KO8A 2NZJA 3U7HB 1BIFA 1E4VA 1NN0A 1DTSA 5JI2E 2VSFA 3SNHA 3RSOA 2XB2A 1TQDA 2GCNA 3NDPA 4NPHA 5JHHB 4G5OA 3BE4A 1OHHD 1MV5A 4B3XA 2NMVA 4RKFA 1JR3D 5FI0B 4BFUA 2EFDB 1UBGA 2WM9B 4QRHA 1KIMA 1KZGB 5EP4A 4WXRA 1AQUA 1MO6A 2EVWX 2ZSFA 4YONB 3CX8A 1SVIA 2J41A 2OV2A 3IILA 1N5IA 1II0A 1RE0A 1X86B 1IONA 2I4IA 4KLZA 4M1MA 4P3YA 3VAAA 3ZIAD 3BFXA 3LFUA 2CCJA 2Q3FA 3MJRA 3AKYA 2ZSBA 1KSGA 1ZC3A 2WHXA 5L3QB 2DR3A 2OZEA 1G3UA 1V43A 1YR9A 1W36C 2JLXA 2VP6A 3KFVA 3QKTA 3SZRA 2BMEA 2ZRAA 5FR1A 3U4QA 1KO1A 4ZCIA 1Z6AA 4TLBA 1KO4A 4EPRA 3R8FA 1F6BA 4NYMR 1KNXA 2BJWA 2YNMA 3LNCA 2P5TB 2PL3A 4RD4A 3U3OA 4GL2A 4TT3A 3SHWA 4QFMA 2WVJA 3RC3A 4P4TA 3U6KA 1CTQA 5L3VA 3K0SA 3ECCA 1P73A 4KSBA 2J87A 3ADCA 2QSYA 1TMKA 1V5WA 3WBJA 4KCGA 2F1JA 4Q47A 1WE2A 3U3KA 1CKEA 5JZVA 2JJ2A 3PV0A 4DLVA 1E9SA 2ZI7A 1ZM7A 2KI5A 3K0EA 3QVVA 2BCJQ 3DM5A 3A58B 5GJCA 1H8HD 5SZIA 1TEXA 4XD7D 3GCGA 1Q3HA 4FMCB 4F4CA 4JT2A 3FHOA 1NNEA 2QAJA 1G4AE 1Z83A 5EP3A 1IN5A 1GKUB 4HLUA 1NMYA 1NVVQ 2XOKD 5EZ5A 4PC7A 1G8PA 3FMIA 4ILEA 2BV3A 4ZIRA 2XJ4A 2VRWA 3N70A 2VEDA 2WZQA 4JL6A 4PANA 4RSGA 4IDHA 3TE6A 1JR3E 1BS1A 2VP2A 4H9GA 3VR4A 3I3SR 4JVLA 1J8YF 4TLAA 4NMMA 4IKEA 2O8BB 4D81A 4B2PA 5KNBA 2C9CA 3CZQA 4JIMA 4GT1A 5B30A 1XJCA 4HLCA 1I4TD 2YINC 5EE0A 3AM1A 3HJNA 4NTZA 3UKDA 4AG5A 1P2VA 3I1FA 3WHKA 3EARA 2G9NA 4R98A 1LTQA 2ZVQX 3O8DA 4TMKA 5JJKA 3GLIA 4ASUD 2VHJA 4FI3C 1EX7A 1XMJA 2O0JA 1VG1A 3MFYA 1X1SA 4C0JA 2ODNA 1LW7A 1XWIA 1Q3TA 1D6JA 2Z4SA 1KSHA 3GLHE 4FXPA 1S9HA 2C78A 4UNRA 3MAAC 1QHSA 1SHZA 4RFSB 5AUOB 2R6DA 4M22A 1COWD 1NKTA 4Q7KA 4LUCA 3C15C 2FZ4A 5AJWA 3GFOA 3L0IB 2XXAA 2F7SA 4TL9A 2BOVA 3SJZA 2P2LA 3B78A 3RNLA 2FSFA 2LWIA 3FKQA 2XOKA 4LC1A 3NVAA 4C0KA 3DOFA 2R6GA 5D3MB 2ZI4A 1ZNYA 3KKMA 1ETUA 4Z1MD 2QMUA 3V9PA 5P21A 1G8FA 3W5JA 3VU9A 1OF1A 2J7PA 4JLPA 3EPJA 1EG7A 3VNVA 1KI2A 1TF7A 5FUYA 2W58A 1UBEA 2A9KA 2PZEA 1KI6B 1KSFX 1N5JA 5K8IA 5CK5A 4J0QA 4G5GA 3NHAA 4B3BA 2CVFA 2ZJBA 3TW8B 4CEHA 4AKGA 2CNWA 2WWYA 4IVQA 1FZQA 2HCBA 4HZUB 3VX3A 4ASUA 2RGXA 2ZRLA 1O87A 1U99A 1U9IC 3BXZA 4G01B 1KI8A 4KYIB 4FMCF 1G7RA 1KHTA 3MJHA 5JI3E 4JKYA 1SQ5A 3LQQA 3VR2A 3QEOA 4LK2A 4A2QA 3GEHA 4FMBB 3QXXA 4XWKA 3OAAA 4QL3A 2IEZA 5IF9A 1FMLA 4TTRA 1SHKA 1R2QA 2FGJA 2ZJZA 5F98A 3ZVNA 1YR6A 3W6NA 4HSEA 4F7WA 4D0LB 5FH9A 3CWQA 1ZU5A 3HYRA 2ZI6A 4IOLA 3OIVA 4AYXA 2KWIA 4EQ6B 3LXXA 2WWWA 3LX5A 1AKYA 1RYHA 5IT5A 2YYZA 1CR1A 3UK6A 4HDCA 1CEEA 4P31A 4ZV4A 1CIPA 1ZRHA 2DFLA 4HLUC 3KZ1E 3L82B 2ZJYA 3D8BA 1DAFA 2IWRA 1NLZA 4ACBA 3K9HA 4YMUA 2VP0A 3AVYA 4LGMA 5BN5A 1JNYA 4JT4A 2VBCA 4M1SA 4N0DA 1L2TA 4V02A 1E6CA 1P9WA 1QHHA 2J45A 3VKHA 2IUTA 4Q1AA 4B34A 4BLSA 1AKEA 3A36A 2A30A 1HT1E 4LV5B 1A2BA 1CU1A 2GF9A 4LDJA 1X1RA 3GMTA 2G0NA 1KAGA 4I1UA 2ZS7A 4H1UA 4DCUA 3AGQA 5TMPA 4HB2A 2OFOA 4EPYA 3GLIB 4XWAA 1G3RA 3LDAA 3RSLA 4KFRA 3AP1A 4L4UA 2AL7A 2OUKA 3UMSA 3A37A 1DOAA 1DG1G 3M0EA 3NBXX 5TDHA 4R2IA 1E3MA 3PUZA 1E1QA 2FPLA 4UXIA 3UG6A 2R6AA 2GK6A 3I8SA 1DVRA 3QI2A 2SHKA 4RFSA 1RJ9A 1IQPA 4NYMQ 2IWHA 4OHYA 1HQCA 2VF7A 4OI1A 4OBEA 1XMVA 3NWJA 4IVPA 1TU3A 1PUJA 4IEIA 1J7KA 1ZNZA 1VIYA 1K6MA 1JEDA 3WRYC 1UEJA 1E2MA 3UWKA 1VCOA 4NH0A 2QBYB 4LCBA 3TLXA 3JZAA 3NEJA 2A7QA 1AN0A 4AK9A 4FCTA 3L2OB 3TSOA 1JQJC 2ZRKA 2W6JA 3PUVA 4XH9B 2J7KA 4DIDA 4Z54A 4R2HA 1NSFA 5KSOA 4DEXA 4OHZA 5JSZA 4KFSA 3FOZA 4KFTA 4FW9A 3IQXA 3MD0A 4ARZA 1FFHA 2PLFA 2OCYC 1Q0UA 4LHYA 4TT3D 4HUTA 3CRRA 4M8NE 2AKYA 2P6UA 1VMAA 2ZE5A 3U7GA 1W7AA 4JLKA 1KKMA 4CT5A 5FR2A 4B75A 2NIPA 3NIBA 4WAUA 4B3DA 4PHTA 3I5XA 2KB0A 3O8CA 4LJ8A 2JIZD 2CCKA 2IEYA 2IHBA 2RGNA 4QJ4A 4IHQA 4UNSA 4C3ZA 4AYWA 1LF0A 1M7HA 2ZJOA 3SJCA 1DAIA 2FWRA 3TH5A 2B8WA 2PEZA 4TL6A 1ZUNB 4G1UC 3DPUA 2ONJA 3VHLB 5HKKA 2A2ZA 3AF3A 1S3GA 4HEJA 2ZUCA 3MGCA 4Q5IA 4US1R 4TTQA 2JJ8A 1FQJA 4Q1EA 4L9WA 1XPRA 4B32A 5JEEA 1XEFA 1HE8B 1OB5A 1XXHB 4OQLA 2ZJAA 4HAWA 3C7KA 3K53A 4HAUA 3ZGXA 2VSXA 3K0CA 5EXSA 4QM6A 1C4OA 2PZGA 1GDDA 5JRJA 1HEIA 4BLOA 4BRUA 3AB3A 1HY3A 5BXQC 4E07A 3H84A 3TW4A 2HF8A 1KMHB 2FFQA 1PLJA 4PO8A 5E95A 4HAXA 2ODWA 4Q4AA 2VP9A 3BERA 1DEKA 5KPDA 3CF0A 4NKRA 1KDTA 4DUGD 4DLUA 3BORA 2GILA 3EZ9A 4UJ3A 5DN6D 1X6VA 2QA5A 3IIMA 4KYUA 3EXAA 2AFIE 5FOXA 4BWYA 2X2FA 3C41J 3GLHB 1ANKA 2O52A 3TAHA 2JIZA 2ZAOA 4G5QA 3AF2A 4D4KA 4D4JA 3QG5A 4LJAA 1R0XA 2RGGA 1OIXA 1YKSA 1KY2A 5LB2A 5F3WB 5AJZA 1AS0A 2CHGA 2J46A 5L3SB 2WJJA 1OT3A 4RY2A 2ZROA 3Q3JB 4A2WA 4O25A 2RGNC 2P5SA 4RD2A 3C16C 5FBRB 4XSGA 1ZP6A 3FFAA 2REBA 1QHIA 2GXSA 1W36D 2OFXA 2Z83A 4L5BA 4A0RA 2BKEA 2X19A 3T12A 4EIWA 2I1VB 1T3SA 4NYIR 2Z0MA 2DB3A 2KBFA 3LY5A 3FE2A 3QE0A 5FUVA 3U5ZB 2IXEA 3QJYA 3DKPA 1II8A 4WW0A 3HP1A 4C7OB 5L3QA 4NCNA 1FL9A 4PAQA 2BM1A 5J5CA 2PCJA 3MWKA 3T34A 2PZFA 4S35A 1DS6A 3JVUA 1G3MA 3KUCA 1NP6A 5AR1A 2BHRA 1NY6A 2RKOA 3TQFA 2JDIA 5FPTA 1IOZA 3KTAA 2CE7A 2ZI5A 2B7BA 1Q1BA 1ZM3A 2XX3A 4Q4HB 3TUIC 3ZQ6A 3AP2A 5JCZA 1D9XA 3FTQA 1E2IA 5JHGB 2DPXA 4JVMA 3GEEA 4A36A 4EDHA 4N1AA 3SQWA 2DHRA 3K0FA 2TMKA 1G41A 2JAQA 1Z08A 3K09A 5E7IA 1R5BA 2J0QA 3ZDQA 2PJZA 1HURA 4R71A 2QNRA 4E03A 2EW1A 3WNCA 2R6CA 5JMTA 1OPXA 4BUJA 3IPXA 4PPNA 3VU9B 4F38A 2UKDA 3VMFA 2IYRA 3R9IA 4GI7A 5AJXA 2FNAA 5L3SA 5B64A 5DLQC 1P2SA 1KO7A 3K70B 3WMGA 4Q66C 2F1HA 1YZNA 5CLQA 3I4LA 1NG9A 1X3SA 5JLJA 1JJ7A 4WZAE 2V1UA 1I2DA 2A78A 4ERNA 2OAQ1 2G83A 2MSDB 1OH6A 1Z0KA 4FMDB 1XEXA 5F9HA 2HF9A 4LZZA 3THYA 2D74A 1NMXA 2QN6A 3IIJA 2BEKA 1YR8A 3P1JA 2OEPA 1O3YA 1A1VA 4TSFA 3PR1A 1G7SA 1KMQA 1W0JA 4DDWA 5BYKA 3ND8A 5LD2C 2HYDA 3AEZA 1GVNB 4WBSA 2WWFA 5CB6A 4URWR 2XNDD 4B6FA 4V0LA 3PFIA 2V1XA 3K09C 4YMVA 1YHNA 1H8EA 1NBME 2WWIA 3ONWA 1VDZA 2GVDC 1WCV1 2GXAA 4JVSB 3BWDD 3KB2A 5AUPB 5FUXA 3PUWA 2ERXA 3AVTA 1SKYE 3C14C 2ZRBA 2IXGA 3PEYA 5KUTA 4LJ4A 1RC8A 1W0JD 1E1QD 3FWYA 2VQSA 1AQYA 3H0KA 1Z0FA 5EE1A 5A0FA 2OHFA 1P9RA 3THXA 3MLEA 1CR2A 2PMKA 3KJHA 4MGYR 2WOOA 2KBEA 5TB5A 3QKRB 1ZD8A 3AKEA 3TAUA 2V55B 2ZTSA 4QGFA 5DISB 5JS7A 1BMFA 2FSIA 1OXVA 1ZU4A 1XBTA 3BH6A 3OHMA 2FH5B 3DM9B 3UANA 2CJWB 3X1ZA 2IS6A 1KK0A 1NVXQ 3DDCA 3TBKA 5HCNA 4AKHA 3WP1B 1PV4A 2O8EA 4OYHA 5BN4A 4PC3A 3TUZC 1T5IA 2P67A 2ZYWX 3L0OA 2ZYUX 1NVUQ 2LKDA 2RGBA 3MRSA 3NBZC 4IXNA 1KJYA 3Q8XB 2HEIA 3ZZUA 1RIFA 3A1WA 4DSUA 2QSZA 1M2OB 3I5YA 3A1SA 4QJ5A 3MMPA 3CWZA 4DLZA 1G6HA 4FD2A 3LWNA 3IIKA 4LPSA 2GRJA 3LBIA 3TVDA 3WY9A 3THWB 1CP2A 4JMPA 3CIOA 1XTJA 2B92A 3K9NA 4PZYA 2FPMA 1NJFA 5FTLA 5HZKA 1OH7A 2YC4C 4TYPA 4AKIA 2WIAA 4M2LA 3SYLA 5CDFA 4X8OA 4B76A 1A2KC 1Z28A 3DHWC 1E2QA 2J1LA 4M9ZA 4NONA 1G5RA 2GZDA 1Z6TA 4E5UA 3KQUA 1NLFA 1S1MA 4OI0A 4QGGA 1ZC4A 2H57A 1OJLA 2NG1A 1XXHE 2Q0HA 3HYTA 3ZS9A 2E9SA 1KDPA 1KK2A 1P4SA 2WJGA 2CHVA 3TNFA 3UMRA 5FBWB 1R10A 5BWMA 3CKLA 4HB0A 3CW2A 2BBTA 4R7ZA 4B48A 5JJLA 1OYWA 4Q18A 1ZINA 3FDIA 3R9XA 2HUPA 3A1UA 4DVGA 3J81k 3ZIAA 2FE4A 2A3RA 3U3RA 1ZCBA 2ODBA 4CW7A 2EWVA 3AKCA 1N6HA 3CPHA 1VCMA 1GIAA 1OXUA 2FX3A 1CULC 3KJGA 4N0EA 1KSJA 2H18A 5B57C 2Q6TA 1QG2A 1KKLA 1XCMA 2Q3HA 2XB4A 1VYVA 4M1WA 4BFYA 4KODA 1R8SA 1OFIA 4WZBE 1EWQA 1BYIA 4HZIA 3T61A 4W7SA 3CBQA 1M8PA 1I2MA 4RZ3A 4JKIA 1KI6A 5CLLA 5G3YA 1XD8A 1KGDA 3AKDA 5DNYB 5GADl 3PENA 2ZRJA 4CEJA 4FWTA 5JJIA 1E2FA 1U9IA 1G20E 4K81B 2AD5A 1FMJA 3A1TA 4I1VA 4KI0A 3NH6A 4YMSA 3I61A 4PAOA 2RH5A 2XJ9A 1Z0IA 4B33A 4DT1B 3V4FA 4DT1A 3GJ6A 1IXSB 1RW4A 1XXHA 2OBLA 4PTLA 1S1CA 4DCNA 2J9RA 2QM7A 4JL8A 4AURA 3CLVA 4ZO4A 1VTKA 1IJEA 2OO7A 2AR7A 2NO0A 3SBDA 3EIEA 2O8DA 1PLLA 2F1IA 2ZE6A 3EW9A 1E0JA 3X1YA 1OH8A 4TZ6A 3KXKA 4Q4AB 4WZ6A 3QKSA 3UATA 1H8ED 2ANCA 3MWYW 3ZVRA 1MRSA 5J47A 2IK8A 3L0SA 3IDQA 5KDLA 3GLGA 1DAGA 2ZYTX 1W4AA 1SVKA 4PO9A 1Z6GA 5EUQB 1G9XA 2QAGC 3BK7A 4JS0A 3Q85A 4A2PA 4K46A 4ZIRB 3BGWA 5KNDA 1OXTA 4WVFA 1OH5A 3A6PC 1YRBA 2GKSA 4UXHA 4QBHA 2FPKA 1JPNA 2YKGA 3IUYA 1SXJD 4BZXA 5EP2A 1Z63A 1AJEA 3GQBA 3KXIA 1US8B 4I4LA 2JDID 4Q4HA 1GL6A 5DHAA 2GTPA 2KJQA 4MRSA 4PFSA 5EE3A 1GL9B 2IT1A 3U3JA 2ATVA 1OFHA 2JEOA 3D6TB 4Q7JB 3LO5A 4JLOA 4ACAA 5A4JA 4O2RA 5CYOA 1LS6A 2NOAA 1II9A 4LHXA 1EFRA 4LPKA 4MDEA 1FNNA 4PXAA 1E2NA 2F43B 1R8QA 4B3GA 5AJVB 2D2EA 2R65A 3FKSA 3V00A 4TQAA 3LLMA 3VQTA 1GRQA 4MRNA 4MKIA 2CCGA 1E79D 3K70D 3I73A 5GVSA 4ZKDA 4DHEA 4JZKA 1TU4A 3KJIA 4C7OA 3AF4A 5EXTA 1R0WA 5CB8A 1P62B 1XMIA 2YOFA 2YOHA 3FFBA 3MCAA 5FBQB 3Q5EA 1GM5A 2EQBA 2OE2A 1QHXA 3ZYCA 4WOPA 4A8JA 3K70C 3B1VA 5H68A 1UBFA 3RRZA 5KHOC 5LD2B 2H7VA 1GL7A 2QTHA 4MGZR 2O8CB 1EGAA 2XNDA 4US2R 4IXMA 2ZS8A 2HV8A 3QNUA 2HCJB 1SKYB 2H1LA 3LBNA 3WNBA 2CE2X 3WYAA 2F9MA 5FTNA 1G6OA 5G53C 1N0WA 3Q5DA 3P4XA 6Q21A 5J4VA 1GWNA 4IVRA 2IYLD 3QPWA 4GP7A 4Q01A 3T5DA 3UXMA 4DC9A 1WBBA 4XTRA 1JXMA 1IY1A 4JYCA 5KSZA 2C8VA 5C1BA 1XF9A 2DFNA 3V4RA 1E2EA 4PPQA 2C99A 1IN7A 2EWWA 4CYMA 3IO3A 1OW3B 4Q9IA 2J3EA 2ZRMA 3QBTA 4HZUA 1ONBA 4TYQA 1QVRA 4LJYA 4EPTA 4TMXA 3OZXA 4OK5A 5TARA 5HPYB 3C5HA 4W5WA 2BM0A 2REXB 1WMSA 2RGDA 4QNMA 3GJ0A 2AXNA 2C2HA 4YMTA 1A4RA 1W0KD 1YU9A 1DO0A 4IOJA 3U44A 2PT5A 3IGFA 2QQ0A 2ZRPA 2O8DB 3E1SA 4NBSA 1N6KA 1XZQA 2VHTA 4N3NA 5K8UA 4CZ2A 4C30A 3NDBB 2R6FA 1GFIA 3ASYA 1QHYA 4TYWA 4EJSB 4ON9A 4JSTA 5E3HA 2ORIA 4JBYA 4YLGA 2FOLA 1JI0A 5FI1B 1T0JB 1X8KA 2IUSA 3O47A 4TQ9A 4FWIB 3GLFB 1N6OA 5F9FA 1DAMA 3SFVA 1AGRA 2RCNA 4TMTA 1VECA 1E32A 4MYUA 1A5TA 4MYCA 3Q9LA 2NPIA 3L8YA 4MH0R 4B74A 2OAP1 4PSKA 1YQTA 4NCJA 4POAA 1E69A 1IN6A 2D7CA 4QXAA 1GZSA 5LB4A 4D4MA 2BCGY 2BMDA 5AJYA 1E0AA 2WAYA 2GK7A 1QHHB 3UMFA 2GBLA 2X8AA 1E1RD 1XX6A 3Q7QA 2Y8EA 4Q9HA 3ZJYA 3B2EA 1TNDA 1GTVA 3AV0B 1ZD1A 2DWPA 3EZ6A 5GVRA 3RANA 5G40A 5JWRA 1XP8A 2C98A 3P27A 2XGJA 1R6BX 2D3WA 3SFZA 2QY9A 3TIFA 4OJKA 4FMDF 821PA 3OIWA 1ZNWA 3EA5A 1MRNA 1Z0DA 4HDQB 3FPAA 2GJ9A 4OHVA 5C46F 4A9AA 2ZI9A 2FEOA 4RD3A 2Z4RA 1QHNA 2DYKA 4FN5A 4OK6A 4BFWA 4Q1CA 3JVVA 4Q1FA 1XEWY 1E99A 3EIQA 2LKCA 4NP6A 1G3QA 2W0MA 4C4PA 1IAQA 2CLSA 1CXZA 3QEJA 3W5IA 2H5EA 4LY6A 2RGAA 1ZW6A 2J0VA 4KVAA 1KDRA 4B43A 4LJ9A 3NHBA 5EE9A 5JWHA 2ZE8A 3H86A 2GNOA 2OILA 2W2VA 3HPQA 5UKDA 4BFXA 1N6RA 1W4BA 2C95A 2ZRFA 4QBIA 4KVGA 3P26A 4TQUS 2OLJA 1Z0JA 1OXXK 1G291 2REOA 4C0SA 2JJ1D 2HLDA 4P32A 1OB2A 1M7GA 1UKZA 5EJEA 4P0TA 2A5YB 3BS4A 3CNLA 3SE0A 3M4YA 1HT2E 1LV7A 2WSSD 4LJ5A 1VYTA 4IFEA 5CJPA 5DO9A 4CT4B 1ZBDA 1K5GA 1QBKC 5HR5A 4IOMA 5CDFE 1OYYA 4NCHA 4JBXA 3CF2A 2GXQA 4OK3A 2QPTA 1J90A 1KNQA 1Y63A 3DMDA 4OQFA 2HLDD 3QKRA 2QU8A 4QM7A 3HR8A 2WSSA 2ZRDA 4KLNA 5LBIA 1CR0A 4TMVA 4DLXA 4E22A 4PZZA 5AUNB 1LS1A 1ZD9A 3W9YA 2WTUA 3B60A 1YZLA 4Q7LA 4KSCA 2CJWA 4W5JA 4CF7A 5D3MA 3AUYA 1ZNXA 1E96A 3QOFA 4BASA 4YQFA 4DCSA 4WIAA 3U7FB 4XVQA 3T1TA 1FTNA 1RRPA 4PHHA 3CPEA 5FL7A 1TQ4A 3BH0A 3GLFA 1GITA 3AP3A 2BMFA 2HXYA 1L4UA 1N6LA 5FBLB 1EFTA 4DEYA 2P65A 4BFSA 4C0QC 3HDTA 2Q3MA 1NY5A 3K9GA 4PC2A 1Z47A 2E87A 2FF7A 2YV5A 5CIQA 4GFDA 4YDSA 1LVGA 2YOGA 1WDTA 2GEUA 4OI2A 3K0AA 3OEED 1RRGA 1CRQA 2ZR7A 4US0R 1YZTA 2CL6X 3JZMA 3VR6A 4HDOB 3QPUA 2W83A 3GJ8A 1E9AA 1CJUC 1P5ZB 1XEWX 2BBWA 2YJTD 4EFNA 2QTVB 5AK0A 2XZOA 2I1QA 1WP9A 1Q12A 2RHMA 4LJ6A 4F93B 2FG5A 5KOYA 3FYHA 4DRZA 4Z51A 2GAOA 1N3BA 3OEHD 3ZZ0A 5B58C 2J0UA 2FJUA 4NCKA 4QG7A 4V0OA 4F4IA 3HU1A 4KJZA 2CEAA 3QVUA 2EU8A 2ZVPX 2ZQ5A 2XTNA 2IF0A 5CITA 1L4YA 2GETA 4Q4JB 2C5LA 4EPXA 3ADDA 4GMXA 5K8LA 2JATA 1GAJA 1WQ1R 2PJRA 4M9QA 1RFLA 2BVNA 3QXCA 5JRZA 4MYTA 2XTZA 3CF6R 1UKYA 4LBZA 5IDVA 1GP2A 4B47A 3EZFA 4BRWA 2F43A 3RRMA 3QF4B 3GP8A 3EX7C 4ESVA 5DI3A 3KX2A 4X8LA 4BFVA 2PX3A 3OFNA 3QBVA 4URUR 1XDBA 4LV6A 2AX4A 4ZDKA 1R5OA 1HUQA 3SOPA 3AH8A 1KO8A 1NVWQ 1GKYA 1HYQA 4Q7MB 5FOTA 3AVUA 1CF4A 3SEAA 2YWEA 1IN4A 4RZUA 1W36B 3D31A 1YJ5A 1M6NA 4II7A 1HE1C 4JL5A 3BOSA 2P6RA 2GEVA 2VL7A 3MWLA 3P20A 3OE7A 4KFUA 1E2HA 1K8RA 1NIPA 1FOEB 4RCYA 2PMDA 1F48A 1KAOA 2G6BA 4EPVA 3SYKA 5FPSA 2CLDX 1FUUA 3GLGB 4RKEA 2O5VA 2VHCA 4NYJQ 5C4MA 2QEQA 4I1SA 3TRFA 1QDEA 2QG6A 3ZZTA 5H1YA 2QT0A 1ESMA 3DO6A 4M1OA 4NE2A 5CJ2A 2GZAA 1JPJA 2QMHA 4TMWA 1D2EA 3ZVLA 5JSZB 2CVHA 2F55A 2R62A 3RRYA 1F5NA 2VA8A 2JJ2D 4A1FA 4GOJA 3KKNA 1QRAA 1J70A 3C4JA 3FMFA 5GJWC 4MRPA 3FMOB 1JAHA 2ZJ2A 4C0LA 4A15A 1IHUA 4UJ5A 3CR7A 2IF2A 4XD7A 4BLPA 3CRQA 2CLCX 4Q1DA 3QSYA 2A5DA 3X1XA 3B13B 3A4MA 4BEBA 3RABA 1KZ7B 2WJHA 5HZHA 2IS1A 3PCRB 4PC1A 1G5TA 4TL8A 1FX0A 3LH5A 2GXUA 1Q44A 1VPLA 2W00A 1N6NA 4CEJB 1FPMA 1W1WA 1KJZA 1KI1A 3OESA 1FQKA 1E9DA 2OSBA 1YZUA 2GJSA 3EASA 4KBFA 4LYJA 1IXZA 1KYIA 3CH4B 4XIGS 3GLGE 4PO1A 1T8TA 2ZUBA 3LA6A 4HLQB 2O8FB 4MRRA 2R2AA 1P6XA 5FBVB 2V3CC 3GLIE 4HYYA 4QHYA 2XTMA 4L8GA 2FN4A 5HTKA 4DB2A 1S96A 4NZYA 4A6XA 3SYNA 1S8FA 2V54A 3CRVA 1Z07A 3IO5A 2N1BA 4JYBA 3KKQA 4BGDA 4BLQA 5EP1A 2OM2A 4PC6A 3SS8A 3W8NA 3X2SA 3BBPA 3AVPA 3UG7A 1E2JA 1UDXA 2IA5A 4LHZA 2AN9A 2FGKA 4C2UA 3EWSA 4KBGA 1Z6YA 3KQHA 4L16A 5C4GB 5KDOA 3KQLA 2G1KA 3KQKA 2JLSA 1T8UA 1EX6A 5AUQA 5SZJA 2GCOA 3I72A 4DSNA 1E2PA 2A5GA 4A92A 1OIWA 1R0ZA 3PG5A 1GUAA 2ORWA 5HCIA 2BBOA 2IBMA 1TF5A 3PEWA 1AIPA 2ZSDA 2YWHA 1KY3A 4ZPXA 2NQ2C 4LSGA 4KHZA 3LAWA 5F2EA 2AK2A 1A7JA 4V0ME 1G16A 1UAAA 3P4YA 2C9OA 3KQNA 1YRAA 4O2LA 3R7WA 1T0HB 4Q00A 3U60B 2H16A 2WBLC 1S2MA 2YZ2A 1F3OA 2ZE7A 1COWA 1E2KA 2JLVA 5FL7D 3NXSA 1PJRA 1EFUA 1SVLA 1E0KA 3QXHA 3B8HA 5CIWA 3RS5A 4IDNA 1E2DA 1KK3A 1NMZA 1WA5A 2BWJA 1T9HA 5ELXA 2ODEA 5JECA 3B1ZA 2VPPA 4JLJA 3AVQA 1N5LA 3PUYA 4MUBA 4ZI2A 4LBYA 4IW3B 1ZYUA 3U4QB 1AA9A 4TTPA 2PCLA 3EC1A 3KUDA 621PA 4DBLC 5FL3A 4YXWA 1L7VC 2FV8A 4PX9A 3PEVA 1NLYA 1U81A 1G18A 2V6IA 2ZU0C 3DKVA 4M1TA 2IX3A 3SDZA 3S1AA 4Q9KA 3TQCA 1YZKA 5FUWA 1SXJC 1XNJA 4M9SA 1H65A 3LD9A 5HE8A 3OEEA 3QG1A 3LRPA 1UJ2A 1XTRA 4MUAA 2AFHE 4LX0A 2FFBA 5B2ZA 3TGPA 1DBSA 3W3ZB 2G0TA 3PITA 3PIRA 4GPTA 2PBRA 1OLOA 4QC2A 4ZKEA 4KXFB 4TMZA 2AD1A 4B35A 4U7DA 5KSPA 3H2YA 3UWOA 1W47A 5IHPA 2E1RA 2QL6A 2XSZD 3SC3A 2UVQA 1NI3A 1Q1QA 1ZJ6A 3A4NA 3LBHA 2IL1A 1D8TA 1FTSA 1ODFA 3BB3A 4ITRC 4B6EA 4S2EA 4QOSA 1N2CE 4V0KA 3NTUA 3FKSD 4PQYA 2WSMA 4ZDJA 3AVWA 2QORA 4GNKA 1P60A 2AK3A 2QBYA 1P75A 4O3MA 3NKVA 4FCVA 1KK1A 3GD7A 1OKKD 2WICA 2WIBA 1VIAA 1CJTC 1DADA 5JBQA 1J99A 4DWJA 1ZVQA 4NL4H 1RVDA 5DSZA 3RS0A 3GFTA 3B1WA 3WYFA 1E9FA 1L8QA 2OXCA 1XJQA 3B9PA 2DWQA 3DZ8A 5G3ZA 2JLQA 3BRWD 2WWGA 2HXSA 3UIEA 4UNQA 3AQ4A 1SULA 1NBMD 1T91A 1P3JA 3THOA 5JFGA 3H1TA 2B6HA 4Z8XA 4TYYA 3QPVA 4PPGA 3E2IA 3FMPB 3LXRA 4GZMA 3EIHA 4IFBA 4HAYA 1F60A 3QIAA 1S0UA 1D2NA 1DG3A 2ZSEA 3DL0A 3B82A 4XOIA 1BO6A 3QF7A 4G5RA 2IHYA 1OV4A 4O0MA 2P6NA 2GA8A 4CIDA 5DI9A 3OFND 1SVWA 4D82A 1YZGA 1OE0A 1G8YA 4JVNA 1B23P 4P4SB 3SBEA 2YC2C 3B1YA 4PSVA 1G64A 3NBYC 2ZS9A 1OFTA 1RKBA 4CVNA 3OE7D 1HA3A 2NGRA 2O0KA 5E4FA 2A5JA 2C9YA 3AVOA 2OESA 4PR0A 4RZXA 4A0HA 1RRCA 5FTMA 1NL3A 3VTKA 3BFVA 4M4SA 1VG9B 2VP4A 121PA 2OCBA 1ZMXA 4LWZA 1OKKA 1Z2AA 2ZU6A 4JSYA 2IW3A 2KSQA 1E9BA 4GDFA 2YHSA 1CBUA 1W4RA 2QMOA 2ZPTX 1ZIOA 3TUJC 2DCUA 3N2EA 1W4CA 4M1YA 5FOVA 1OIVA 2O8FA 3WHLA 2GJ8A 4PHFA 4HAVA 1GG2A 2ORVA 1F2TA 3EPLA 1R4AA 1F2TB 4L15A 3RLFA 1HQYE 2NO7A 2GBLC 2VLIA 4A82A 2QPOA 5J4YA 3DZDA 5KPJA 3D3QA 5H70A 1FP6A 3QY0A 3VKGA 1T6NA 3IEVA 2VTKA 3EG5A 1AS3A 5JWOA 1DO2A 1G8HA 4OHWA 2PLRA 1XTIA 4AY2A 3NG1A 2B8TA 3WP0A 1W49A 4B3FX 3TJZA 1E9RA 3BH7A 2ONKA 2YVUA 1UM8A 2IS4A 3T15A 1P7CA 4DSOA 2V7QA 4LYFA 4XSHA 3I62A 2BJVA 1TUEA 5EUMA 4OI4A 1JALA 4EKDA 1C1YA 2F6RA 3CR8A 1Q1ZA 2JA1A 2DWOA 3B6EA 1XPUA 2GF0A 1E9EA 1ZIPA 3MG9A 4IEEA 1S3SA 3DMNA 4MKGA 2WPDD 4MGKR 1XU4A 1JXOA 5CM9C 4LYHA 4P4SA 4JBWA 4JJKA 4LHWA 2F3TA 1JBKA 3T06B 2HT6A 2JJ1A 4ARZB 3R7WB 1E9CA 1OHHA 1J2JA 4LV8B 2RGEA 5SZHB 1Q1EA 4QGHA 1GNQA 2OLKA 2G77B 4A8JC 2QROA 1E4YA 3QUSA 1JQLB 2QZ4A 3HPRA 1DAHA 3PQCA 3D7MA 2MMGA 3QQ5A 4QNRA 1TTTA 1EFRD 1IJFA 2W2XA 4QKQA 2XAUA 4JLMA 3SJAA 1IY2A 3BB1A 1UKEA 1HTWA 1D9ZA 4ESHA 3L0PA 3RS7A 3QF4A 5FOWA 1Q22A 3HR7A 4X8HA 1F2UB 4D0GA 4MITA 1VHLA 3IHLA 2D06A 4EPWA 5FPKA 2IXFA 1KTVA 4V0MA 1J8MF 4PHGA 2ZIAA 3ZD7A 2NO6A 4IDOA 2CMKA 2XITA 1HH4A 5J4LA 5DE3A 4OHXA 1U8YA 3C5CA 4TYNA 5FOSA 3Q72A 4A8JB 4H1VA 4WXPA 1GILA 3QKUA 2IYZA 4DLSA 1ZM4A 3K0AB 2NPFA 5FOUA 1ZUIA 3CZPA 3AVXA 2GJAA 1LY1A 3LW7A 2DFTA 2JLRA 3CONA 4TLCA 2GDJA 4EFLA 4ZI3A 3ZD6A 5BW8A 2AHOA 1OXSC 4C2TA 2J5XA 1TUIA 1TF2A 4TLDA 3T5GA 3X1WA 4HLDA 2D4HA 2QP3A 3C8UA 4HUQA 1CLUA 4HB3A 1N6PA 2XZLA 2AKAB 4CEHB 1AZSC 1U0JA 4Z8YA 1QF9A 5L8VA 3DOEA 3WRXC 2Q9BA 1M74A 5KDDA 5TV2A 3WYGA 3WMFA 3KB1A 4KAXA 3NBFA 1US8A 4Q4JA 1BOFA 2UZ3A 4BPBA 2GAAA 1NN5A 4Q48A 4P33A 4LJ7A 4URZR 2GEDA 4P4UA 3G0HA 1RPZA 1BH2A 5KU1A 5CK4A 1ZM9A 4LBWA 3KL4A 2F9LA 2IYWA 3F0TA 1E98A 2WAXA 2BC9A 4F92B 2VO1A 2R9VA 2EFHB 1VCNA 1IXRC 3OIUA 3K1JA 4Q02A 5DI3B 2L0XA 4RD1A 3GLFE 3ADBA 2IYXA 4MDFA 1BMFD 1MH1A 1XD2B 1CJVC 4URXR 3GJ5A 4TL7A 4B73A 1PUIA 1N0VC 4GRAA 5J40A 1NG1A 3AF1A 2PT7A 3OF5A 3TSZA 1E0SA 2W6ID 2XXAB 2OG2A 3LV8A 4OJQA 4DLTA 4IDPA 2IYYA 3G82C 2Z6VA 3SN6A 3SU8A 1E1RA 1M34E 4HI0E 4DZZA 2ZJ5A 4ZCLA 2RMKA 2ZRCA 1U8AA 1GNPA 1DAKA 4UKDA 5KTYA 2CL0X 4RZ2A 1IN8A 2ZSAA 1TADA 2X77A 1AK2A 4JJZA 2ZI3A 4D80A 3K0FB 5IK2D 1T5LA 4ZDIA 2JLUA 3HU3A 1TX4B 4HAZA 4BE7B 1CJKC 1E94E 4TSFD 3F8TA 3T1OA 1DARA 3ZVMA 4BFTA 1PZNA 2GCOB 3SHFA 4AIIA 1QZXA 1ZCAA 1HV8A 2VSOA 4DCTA 2PEYA 5BYJA 4F4JA 3GEIA 2JLYA 3EPKA 3GFPA 4XWOA 3LVQE 1A82A 4D6PA 5A5GA 1XPOA 2ZXUA 2IS2A 2Q9CA 4ZDWA 3BD9A 3IKJA 4BECA 2OBMA 1N0UA 2ZETA 2R44A 1G4UR 1RYFA 5E7MA 3NC1C 3M1IA 1Z3IX 4Y0AA 3IBYA 4AYTA 3SJBA 4JLAA 1P72A 5CYPA 5K8TA 4V03A 2VP5A 1PLKA 1W46A 4LYAA 4W5HA 2FA9A 3I32A 3EC2A 2FDCA 1JEEA 2C03A 1MABA 2WWHA 3K0CC 1KO5A 3E70C 4X8MA 4AD8A 2BIFA 3B9QA 3KDSE 4B3CA 4OQNA 1VKJA 2FEMA 2V6JA 3K9LA 3IEUA 1GSIA 3L43A 4UNNA 2B7CA 4ZCMA 4HB4A 4AWXA 1KI3A 3BJIC 4OKSA 2IUUA 4Q1BA 8OHMA 1T4GA 1KDOA 3T35A 3VR5A 1UPTA 3RHFA 1T3LA 3S1AB 2OCAA 2QM8A 4NDZA 3B85A 2QAGA 2QE7A 1XCGB 1NJGA 2WKQA 4M53A 4CEIB 4G0NA 2MMCA 2ZEJA 2QGZA 2IYUA 4KU4A 2FSGA 4DJTA 5JS8A 2IYSA 2ZANA 1FP7A 5HKKD 1NBMA 2NO1A 4TLEA 2UZIR 5AWFC 3R20A 3CM0A 4M0LA 1Z06A 3F5FA 1R0YA 5KSYA 4PQRA 2D2FA 5DYIA 3VR3A 4B2IA 4KITB 3SR0A 2QPAA 2O8EB 4EAQA 4NYIQ 1LB1B 3WBKA 2QE7D 5G41A 4G3XA 2RAPA 1WB9A 1XFAA 5C18A 4MKHA 3CX7A 2EYQA 1G3IA 1VYUA 3VX4A 3U61B 3WNDA 5GJVC 3U44B 2K5UA 1BYUA 3K8YA 3THYB 3R8CA 1W0KA 5TVKA 2NO9A 2QGNA 4RJLA 5H8WA 2ZRHA 4PQFA 3NH9A 3RDPA 1DELA 4DIEA 4EUNA 3AVVA 4RD6A 2N46A 1I4DD 2VHQA 4A0GA 5DGXA 1Z2CA 1G8GA 3B1XA 3GJXC 2AWNA 2JASA 5EE5B 3SI7A 2WKPA 2XEXA 2W6JD 4BQSA 2IYTA 1G7TA 1GRRA 3KKPA 3EAQA 1SXJB 2PH1A 3GLHA 3TR5A 3AF0A 4MKFA 2H17A 3HU2A 4TN1A 3I92A 1MKYA 3T1VA 2DY1A 4GOXA 1WXQA 4QHTA 2ZJ8A 2V8OA 3MUFA 1UFQA 3NC0C 3A4LA 3RS2A 1X8JA 1U90A 3OAAD 3KFXA 2BEJA 4CRWB 2DBYA 3CB4A 4UXJA 5DH9A 4D25A 2G88A 1AS2A 2QUZA 4V0NA 1NN1A 2EFGA 1GKIA 1Q57A 2AWOA 2ZREA 1EESA 3TR0A 1D5CA 3LQRA 4LRWA 1JAIA 2ZUDA 1AGPA 3O8BA 2ZRGA 4EJSC 1ZAKA 2C77A 3DEFA 2BBSA 4I1OA 3A1VA 5L3RA 4RFVA 1CJMA 1RRFA 2CNWD 3N2IA 4URYR 1JECA 4EJSA 4GMDA 5CM8B 1GNRA 2HYIC 2FFAA 1IBRA 1XJ0A 2JLWA 2GWHA 2HJGA 2Z43A 4QBGB 3I8XA 1KOFA 1YZQA 2WKRA 3VFDA 4C0AC 4D26A 2RB4A 4IJMA 4FIDA 4DLYA 3FVQA 1NKSA 1SXJE 4CGZA 3A8TA 2GVZC 4MA4A 3ICQB 4M9XA 3BC1A 3U3MA 1UEIA 2QT1A 2MSEB 4Y0VA 3RS3A 3W8RA 3IBGA 1Z22A 1IM2A 2WOJA 4BLTA 3ASZA 4UNPA 1W2GA 5HE9A 2VH5R 4MYHA 5JCPA 2P3SA 1VG8A 4C9BA 2ZYVX 2MSCB 2QTFA 1NSTA 1TL7C 2YWFA 1G21E 3PUXA 4JLDA 1NN3A 1G1MA 2WMOB 2ZRNA 1SXJA 4QHSA 3QXSA 4LOAA 1MT0A 1EXMA 4RD0A 3ICEA 4C0BA 1DE0A 2WWXA 2JLZA 3FHCB 2QENA 1LFDB 1P2TA 1FW6A 4NYJR 3CUEF 4A6PA 3CX6A 3BFKA 2NTYC 4E09A 1W2HA 3GJ7A 1Z8FA 5FFMA 4JLVA 1Z5ZA 5E7JA 2VF8A 1W5SA 3BIFA 4FINA 1G19A 1ESNA 4NCIA 1EK0A 3THWA 2RGCA 1W44A 3VKWA 1K5DA 3VHXA 4XVRA 4IDQA 2YWGA 2ZR9A 1MO5A 2ATXA 5J4HA 2OFWA 3TK1A 2C04A 5FTKA 4XVUA 1U2RA 3G5UA 4QBFA 4LBVA 2HDNB 5FPYA 4I99A 2EFCB 4NU0A 1TEVA 3TMKA 3WMEA 2CK3A 3E5HA 2HT1A 3RC8A 1KI4A 4GSYA 1I4LD 1LNZA 3EWAA 4MGIR 3Q7PA 1G17A 1QG4A 3ZH9B 2KE5A 4OL0A 1E2LA 421PA 1P9NA 1VCIA 2DFKB 4XJXA 2HJVA 4GP6A 2QP9X 4IRUB 3RAPR 4DCVA 5C2JB 3ZLJA 1NRJB 2G3YA 3KJEA 3PXGA 2ZR0A 4DB4A 2NZ8A 3LW8A 2XSZA 2AXPA 3FHTA 2FSHA 1DAEA 1OFUX 1Q20A 2G1JA 1MOZA 1UKVY 2WJVA 3EZ7A 1Z6XA 2CHQA 4OQXA 3VNUA 2B21A 5GJBA 3CNNA 4D4LA 3X1DA 3OIYA 4U00A 3QKSB 2VHUA 4RCZA 5ANRB 3U2QA 4BEJA 5BQ5A 4NHOA
chains in the Genus database with same CATH superfamily
1S2OA 4PLYA 4YALA 3RT1A 3GPBA 2EFEB 2NZYA 3PRHA 3PGLA 5SY4A 4B0PA 5K3BA 4LNHA 4M0KA 5EWLB 3U0VA 1PGOA 2YQ4A 2DE0X 4IG9A 1YB1A 3FPCA 3IPYA 5DXAA 4IIGA 2JZOA 1JFRA 3U80A 1RWVA 2ZW9A 1E4OA 1JJBA 1LPMA 1NUPA 1FBTA 1E1DA 1ICIA 2ECQA 3E4CA 4MEBA 3LLUA 3OEHA 1NQVA 2W2TA 1DEOA 4DQ0A 3GJ4A 2B83A 5EYPA 1WZNA 3CNOA 2WE7A 4HQKA 1UK6A 2AZTA 2I7VA 4IRMA 4UQOA 5THXA 2B4YA 1QGED 3VJMA 3ET5A 4BPRA 4ENRA 3ZS8A 4LDAA 3ULKA 4K9QA 4RSMA 3I12A 2RBGA 1C3LA 3KT3A 2XZPA 3GEMA 5LZ7A 4X1OA 4BNMA 2ZXFA 3NU1A 3OFSA 4C1NA 1YWGO 2C8JA 1SVUA 1XRPA 1YE8A 1Z4KA 1DPFA 3P0IA 4HX5A 3B5JA 3EBLA 4DDVA 5CH5A 2YH2A 5GWXA 1JQDA 1F9AA 5EL0A 4QARA 1UFRA 3EPHA 1CRPA 2ZULA 4MS4B 1NBEA 4Q19A 1OA0A 4GZLA 3OX1A 1L5FA 4EHKA 4M21A 2C7PA 4L9SA 4EFMA 1QFYA 1RWPA 3E3AA 4F06A 4IZ6A 5C52B 1J97A 2WJ3A 3DE7X 2AYXA 4B46A 4F12A 5K20A 1GOTA 2Y67A 3ISTA 3KKZA 4PSAA 1CC1S 1VHTA 2DKOA 4OHBA 4RESA 1XVTA 4L7QA 4JXJA 4DSTA 5IHXA 1XZPA 2BI7A 4A16A 2W6QA 2FR0A 2F3UA 3F5SA 2Z3ZA 3HCPA 2GESA 3OE1A 1ORWA 3R40A 3H4MA 2GFHA 4MIYA 4DUGA 4E5NA 4WY2A 3RWOA 4XM2A 3J80A 2QRMA 4WA7A 2YWJA 2UZ4A 3CF4G 3GUUA 3BULA 3D0KA 5FO1A 3VVMA 1PBTA 1PV1A 3KTAB 5BN1A 4ND7A 1RR6A 1EFAA 1NAHA 2Z5FA 5BMVF 4OQDA 1IZZA 2HSZA 3PLNA 2ZR8A 3AJEA 3I1JA 3R7NA 2B5WA 3USES 3VVCA 1WPQA 4PRLA 4K8OA 2GTHA 4V0QA 3TSAA 3NHKA 4RHXA 1XLVA 3VXKA 2Q8PA 4IINA 4WA8A 2A9FA 1XTKA 2EYUA 3KL2A 3Q12A 1N1GA 4KR3A 4CEIA 2OCPA 1N9KA 3GARA 3TRJA 3BWXA 3U9TA 3AQIA 4F9FA 3F5DA 2H1SA 3SHQA 1KBOA 3ELYA 1EFHA 3JRXA 4BVBA 3ED5A 2XUGA 3D3EA 4Y6SA 4Z86A 1VP9A 1F0NA 2JAPA 3OLXA 2VAXA 4NIMA 4NNPA 2I66A 3PVSA 4L6IA 3MJEA 4D56A 5C8YF 4R1OA 1Y7LA 2F4NA 2IYQA 3CH7A 3WOHA 5BN3A 1Q1AA 3K0HA 2D62A 3SZUA 2O54A 2PT6A 5DDIP 3I4CA 7REQA 3WDLA 2V7BA 3AUUA 1NZFA 3E7FA 4RS4A 2H1IA 3EOBI 5E6RA 5HDQA 1DIHA 2PANA 3UAGA 3O1JC 3V97A 4P34A 1R5NA 2W0SA 5IRCD 1WG8A 3FCSB 2FWNA 4QULA 3OKPA 1XB2A 4OUDA 4P3OA 2E0IA 2H85A 2ZYAA 4TWZA 3WL6A 4RS3A 5L40A 4CTJA 1V1JA 2JGNA 1QMGA 1HMYA 5HIMA 3S3TA 2D5IA 1WRBA 3EF1A 3JD4A 1U3WA 3KLMX 2G67A 3H5LA 3U40A 4IJVA 1M6VB 2EL9A 1H8HA 2B2XA 3AHFA 4YJKA 5I5EA 3CRW1 1KI9A 2AOVA 3REFA 3FZEA 3ZWWA 1K8XB 2Y2VA 1F8UA 1R9GA 3LYHA 3QA9A 4YDHB 4EL0A 1A0OA 4X90A 4IJUA 5I4IA 1V7QA 5HFJA 4DJ5X 1Y8ZA 3VSEA 5DNCA 3KD2A 3K70C 2YIMA 3LVRE 2PX0A 3EZ2A 4ARCA 1YOVA 2VAWA 2JLAA 2BKAA 3DS8A 1U98A 5KVAA 1XZ8A 2H8KA 2XQKA 5K8CA 1F51E 3P0RA 1RYEA 5KYXB 1TQ2A 4FCWA 2Q21A 2BLNA 4G4JA 3OZFA 5IK2A 3Q1LA 4PPFA 1NPYA 4DLWA 3HADA 1H93A 4E2XA 4XQEA 2Y1LA 1A76A 2I3BA 1JHDA 2HWKA 2NACA 4GPBA 3WYEA 1YDHA 2XLBA 5EWJA 4PZLA 1V5GA 5KNBH 5M29A 4GKVA 4HATA 1ELOA 3EZLA 2CFRA 3DJFA 1ABBA 1P0IA 1QOZA 1R9JA 4H17A 3D7RA 4EF4A 1G0OA 1W5TA 1TAGA 3PKJA 4O1IA 1VL5A 1N5KA 3ETCA 5KO2A 3T9DA 2NUTB 4PAMA 4N01A 1YVPA 3OC0A 2JIPA 3L3BA 1ORIA 1MO4A 3ONEA 2CWWA 3AG5A 1O0CA 4AS1A 4HN9A 4BV8A 1O9HA 2X0IA 1F8GA 3GP3A 1QV7A 4G0XA 4JC5A 4CKXA 4D8WA 5J58A 2JK0A 1E79A 1II8B 1PF7E 1SBTA 4INJA 5EI5A 1AZTA 5DBFA 1WUKS 3A2NA 4YY3B 2VIIA 1V45E 1ZI6A 4JLBA 4LQDA 5AVXA 2PZKA 1M1YB 1UBOS 2IX9A 2OBFA 4WK0B 3HI6A 4RF3A 3P2OA 4L50A 3ZE1B 3GUYA 4H0NA 3HDQA 2OTCA 4FSDA 1LU9A 1QE0A 3U7IA 1QFMA 4DMFA 4TM8A 5KWJA 2HWXA 1XCOA 1AKVA 1T9KA 3WGJA 1A5ZA 1NIJA 2BEUB 3E23A 5MFPA 2HQBA 3R8XA 1XDDA 5EGSA 4LI0A 4BZPA 4EHAA 3MSXA 4WINA 3TZQA 2O8VA 3E3NA 2WV7A 4Q3AA 2W6IA 3VZDA 3AF6A 2IU4A 5BR1A 5I51A 3H11A 3I3OA 3DDHA 1WCWA 3KXLA 3EA0A 2ANBA 3BAFA 3VR5H 5T4HA 1IY0A 1JHRA 3WISA 3ZDEA 3ZHOA 3ZQJA 2ZRIA 1WAMA 3DVLA 4JN6B 2QI9C 3SQXA 2P2DA 1Z6QA 4ETWA 1U7WA 2VKQA 2X40A 2OYRA 1UJCA 2B7LA 1Y34E 3FETA 3H5TA 3LQYA 4EO4A 1XRQA 1PS9A 1RU3A 2RAVA 5LZ9A 3HUEA 1J8VA 2WSLA 3P5SA 4Q03A 3RKRA 3KQSA 4I0WB 3IOEA 1VRVA 5JVDF 1U9ZA 2W48A 4NJMA 1P45A 2NZJA 4KI7A 1DTSA 1GAQA 1IEQA 3QFFA 4WNIA 4YI3A 5JI2E 3T0FA 1CUSA 4F2PA 3R9XB 1KMMA 2XB2A 2FPIB 1TQDA 1MC4A 3ORHA 3RQIA 4BMSA 4OQPA 1Z12A 3QTBA 3RVQA 4N12A 1NNLA 5TNXA 3TIGA 1JE0A 4B3XA 4Y2GA 2NMVA 3OM9A 4RKFA 4BHTA 1MJNA 1E9VA 4DY6A 1PIWA 3TLEA 4X20A 3MLBA 4HX9A 4CV3A 3DEHA 4ME6A 4X24A 5JQWA 2OV2A 2J41A 4QM6A 1QB8A 2I4IA 1K7CA 1RE0A 4O0LA 3QLJA 4M1MA 1DOHA 1EXNA 3H8WA 4ARAA 3BRSA 5EVJA 3BXEA 3BFXA 4F60A 2CCJA 3MJRA 5DSTA 3JATA 3IMGA 4TV8F 1T13A 1FJGB 2WHXA 1LPOA 3WGIA 1P4HA 4NE9A 3PC7A 1T9BA 3JY6A 1PJBA 2DH6A 2OQIA 1O95D 2SKEA 3LL7A 3BM5A 4UAGA 2QX9A 1JLLB 4OXNA 1WHSB 2JAHA 4NNJA 1DSSG 4ZCIA 1SCIA 2D5LA 2J4CA 2JVJA 2ZK7A 4P54A 4EATA 5I7VA 4RETA 5ALPA 3U3OA 4HEA1 1H22A 2PXHA 3H9CA 4TT3A 4FYMA 4O4HB 2WD9A 4HTFB 4DPMA 1FVXA 1CTQA 1VLZA 1LDBA 1JSCA 1LLCA 3Q9SA 4CFYA 3EDMA 3LY7A 1U1GA 4I55B 1U2SA 4Q47A 1VJRA 1WE2A 1L7PA 3G5AA 2V5AA 4D99A 4DLVA 4EY7A 4YASA 2OZVA 1ZUNA 3IKMB 1GCAA 3IVRA 4GG1A 4HWGA 4HXFB 4LXHA 1R0SA 3WIDA 3FCXA 1RQ7A 4MGEA 3A58B 3S1SA 2XWQA 3I0NA 3KBBA 3NCHA 2OD2A 1H8HD 4I8DA 5E2IA 2PX2A 3JWGA 4UVEA 4CBVA 4XD7D 4CE6A 1N7JA 3GAAA 5AW2A 1HG0A 1PQ4A 2WM8A 1DGQA 2VH2A 1Z83A 1V2HE 1GKUB 1N2HA 2W2PA 1TYDE 4OFWA 1NRIA 2HSWA 3RYFB 3U19A 3CKMA 3D5QA 4ILEA 1CUDA 2A1TS 2BV3A 4AAYA 2WEKA 4QD3A 1BU5A 2QLJA 2XMQA 3DDOA 5T4BA 4ZIRA 1D1TA 3WIOA 2HHCA 3LLCA 3N70A 3BPSA 1M8JA 4RSGA 4Y30A 1TYZA 4BC1A 2VFAA 4DMMA 3HCWA 1K98A 4JVLA 5D5QA 2ZZMA 1U04A 2ZBDA 3PFGA 3KZCA 4IKEA 5LDHA 5IEJA 1R64A 5KNBA 4D3DA 1HFEL 1TYBE 5DCYA 1STOA 2AJTA 5HS6A 2IUEA 3VH2A 2R5FA 1S8AA 3NM5A 3DXFA 2XWBF 4QDXA 1HTBA 2AJDA 1U1IA 1LDNA 2YINC 4MDYA 4MW7A 3EE6A 5EE0A 3TYXA 4NTZA 2P4QA 4AG5A 4TWBA 4DMCA 2GN2A 3WHKA 3EARA 4C22A 5K6AC 5JJKA 1DX9A 3C7TA 5GZ1A 4YECA 3C6YA 1IIRA 2FWBA 2R25B 2M98A 1EX7A 3AEUB 4Q93A 1VG1A 4ZVTA 4BVFA 3EYWA 2VUTA 3MFYA 3IESA 4RK4A 1SXGA 2P6OA 2ZIWB 1NJ2A 2Z4SA 1Z4IA 1HMPA 2X58A 2IRWA 3OUUA 4YRFA 2Y1OA 1PUXA 2I9KA 1QHSA 4RFSB 1Y7TA 3E82A 1COWD 4CV1A 1NKTA 3BXFA 3UQZA 1WVGA 2NVBA 2JK1A 2RHOA 5J59A 2YBEA 1Z16A 2BOVA 4II3A 1YJQA 1G2PA 1OLXA 3MAGA 3DPIA 4BQQA 5I45A 5EY5B 4C0KA 3VYWA 2BGWA 4FGWA 3VGJA 1BMTA 4YJ2F 5JXHA 1U2PA 5D3MB 2ZI4A 3N6RA 4FFSA 3VTFA 4Z2AA 3KKMA 1YR1A 1H1LA 2V59A 4F7DA 1IEVA 1NQAO 3UA4A 3NIGB 5LMUB 3FOAA 4O33A 3EPJA 1L6IA 2J7PA 5DYYA 1KI2A 1L7EA 1TF7A 2W58A 2DR0A 2R5NA 2D1FA 1U2DA 3FGZA 1N5JA 5L6MB 5LLTA 2O5CA 4HGQA 2J9GA 3FG9A 4HS4A 2PXXA 3OCXA 4G5GA 4P7BA 3NHAA 1OI3A 1X13A 4GUDA 4AKGA 2CNWA 2FPUA 3AOEA 3WMRA 1FZQA 5DULA 1UAYA 2C97A 2HCBA 1G55A 2ZBPA 4HZUB 3A11A 1Q0RA 2IHNA 2RGXA 1MC8A 1SRQA 1U9IC 1LLDA 1QK3A 2DMRA 2QDKA 3BXZA 4LGCA 5ITZA 1G7RA 1U63A 2XNKA 2B98A 5HMMA 5A5FA 4J2OA 1WIWA 1VLVA 4MUHA 1WTAA 4KOEC 4E30A 3ZHZA 2OO5A 4WBNB 3F3MA 3AW9A 2HR1A 3EXHA 4FMBB 1FMLA 1DUVG 4L9RA 4EGQA 4CIBA 4S04A 4D5GA 1R2QA 4MNTA 2ZJZA 3MFQA 5A1JA 1IRIA 1FMTA 3HY3A 3L9WA 2X7XA 4Z9BA 1PNTA 3RUEA 3W6NA 4ZYLA 4LS3A 4K3UA 4RMGA 2XQJA 1OY1A 1ZU5A 2QR2A 1YBVA 3HYRA 4E3WA 4IOLA 1ZHHA 4TVBA 1FDOA 1YOBA 2CDBA 2WWWA 4EW6A 2E37A 3L40A 2XDQA 1EGQA 1N2JA 3UK6A 4UHEA 4EHDA 2PFGA 1ZEMA 1ZRHA 2ZWVA 2W6PA 3KZ1E 3L82B 4HRYA 2AS0A 1D0SA 3D8BA 3HWWA 4MUIA 3IJPA 3MWDB 3CNQS 4WFIA 2IIBA 1I80A 5TT0A 3L6DA 5F4BA 4CI0B 1U1DA 1FJ2A 1GU0A 2VBCA 3DBLB 3QH4A 4RW0A 4BCDA 3NNDA 1QJCA 4V02A 2Z30A 4EZIA 4PS1A 1P9WA 3G2QA 4IFTA 5HDBB 1SAYA 1H4SA 4B17A 2CSXA 2IUTA 2YYAA 4BLSA 1FSSA 1Z4QA 1HT1E 3KT8A 3CE6A 1E5DA 4AJ9A 5A04A 4IJKA 2G0NA 5TJHA 3C1TA 4NQRA 4HTAA 5KJFA 3CT4A 1Q0PA 3N2GB 1KEVA 3NV7A 4E6EA 1F06A 1ENPA 1PWYE 1T8PA 3LDAA 1I0IA 3OMXA 4L4UA 3CKKA 3FCCA 3LF2A 1ZA2A 3M0EA 3RVPA 3AG6A 2OWDA 4YRLA 5TDHA 1Z4MA 1E1QA 2PA0A 4QBTA 4UXIA 5A9TA 5IWAB 4QU0A 4F5WA 3I8SA 2BR3A 1A98A 3QI2A 1O8BA 4YAEA 3GAFA 1G8JA 3KJFA 1R37A 1IQPA 4DNPA 1J42A 4ZYXA 3CLHA 3IXMA 1AMNA 2VF7A 4MEAA 4Q3KA 3T7RA 4CM1A 4OBEA 4N9WA 2OZPA 3QUBA 1P1CA 2XUHA 4N54A 1KXJA 3NWJA 4BZWA 3B12A 1VI5A 3SKYA 4CKWB 1ZNZA 5C5DA 1BDMA 5BYBA 5D85A 2NYAA 5DP1A 3HDYA 3OM1A 2PS1A 4J4HA 5ICMA 4O1HA 1KOGA 1IHYA 1QK4A 4LCBA 1ESEA 2OP0A 4LCEA 1E77A 3D3KA 4JASB 1I6KA 4J8PA 1D7AA 3SFTA 2IEBA 1HDRA 3SPXA 4G09A 3SIPA 3ROZA 3L2OB 3SC4A 2ZIGA 5B3LA 1JQJC 3HXMA 3DOHA 2MU1A 4R40A 1SM4A 1U1CA 2Y1DA 4YLYA 2YRXA 3M9WA 2PSEA 3P4UA 5FIUA 4DEXA 1C30B 1GQSA 1ZGHA 2I03A 3EGEA 3EDOA 5JSZA 3MNFA 1Q95A 3F97A 1WOYA 3MD0A 1FFHA 2PLFA 4OF4A 5T5QA 5HQ3A 1LQUA 5E0OA 2GN6A 5DTJA 1S8NA 4M8NE 4BFLA 2EX4A 2P6UA 4P35A 5M7EA 1VMAA 3FFTA 5JARA 5HCUA 4NFYA 3U7GA 1KKMA 3L1IA 3IA2A 3PD1A 1V25A 3MWEB 4WAUA 3EMDA 3I2HA 3V7UA 3ZWMA 4H7FA 3L7MA 3I5XA 4ZRNA 4CQMB 4X92A 3EMVA 2CCKA 2IHBA 4ZD6A 1ZVVA 2EKPA 2QRVB 4QJ4A 3W77A 4AYWA 3CISA 4YP1A 2FWRA 3VH3A 1JR2A 2B8WA 2AZMA 1U3FA 3B6MA 1I13A 4EHLA 5KYWA 2CLFB 4G1UC 1R3DA 1QVVA 5LZ4A 2ENUA 4HEJA 4Q5IA 1IBCA 1A9YA 2V7EA 3DFMA 2G9QA 3JQ6A 3F46A 2E3JA 1K5HA 4Q1EA 1PHPA 3RVDA 4B32A 2XYGA 6ADHA 1OB5A 2ZJAA 1M2OA 2ACEA 1MFZA 3COYA 3GRKA 3VI3B 3C7KA 3ZGXA 4AY5A 3ECAA 4PZDA 3DQPA 2PZGA 3TKYA 1MIOB 3TW0A 4BMYA 1INLA 1EXVA 1M5UA 3AUJB 1SOMA 3EVGA 3FZGA 3PXUA 4WCFA 4AW9A 1E3WB 4E07A 1RKXA 3UXYA 2F00A 4QATA 4HFRA 3UCFA 1DWPA 1KMHB 2BGNA 1PLJA 3F6RA 4I50F 5E95A 3VR4D 4HAXA 4Q4AA 2J5BA 2OXFA 1BKSB 4E5KA 1ONSA 2ONCA 3ZU5A 4YAGA 4FEAA 4L5IA 4OH7A 3SHTA 2FLVA 4ENQA 1RWXA 2C88A 2GZ1A 1X6VA 2ZATA 3NTLA 2DRIA 2ORYA 4XYEA 3VAZA 5FOXA 2X2FA 3G8BA 1ANKA 2GAFA 2P4HX 2ZAOA 5KWVA 4FKMA 2QNIA 2YHIA 4G5QA 4KTVE 4D4JA 3QG5A 3FRIA 4E4TA 5JAIA 2OBYA 2FSVA 5CLIA 5DASA 1YKSA 1LSJA 1XLTC 1NVMB 1UZLA 2JFPA 1VE9A 1KQ3A 3P8ZA 3TLMA 3CE9A 2CHEA 1V5FA 2BPOA 2WJJA 4OLFA 4Y6GB 4K6KA 3Q3JB 5LBTA 2XTAA 1ECCA 1QHEA 3ANTA 3DH0A 3KE8A 4XB2A 1O6ZA 5AI5A 1RQ2A 1HLDA 3C16C 2OHJA 3Q7IA 1WOMA 4G8BA 4OSPA 4O4JA 4KO2S 1M1ZA 1XVUA 2JJMA 2WG2A 3UKJA 1L7MA 3DPSA 3FFAA 4OYRA 2XVYA 5C1PA 3HNPA 5D1HA 2ST1A 9LDBA 2JCXA 2VDNB 1G60A 3CZRA 3OCZA 2AN4A 2JNWA 2Z83A 4CCYB 4L5BA 3BGDA 4QSHA 2H59A 2BKEA 3T12A 1ZQ1A 2NVUA 4TMFA 2XXJA 2DB3A 1UIMA 2KBFA 3NKFA 3EIXA 3QE0A 3OMWA 1HOXA 4WXYB 5KYUB 2ZJ4A 5HGJA 2CLIB 3I39X 3HP1A 3UAZA 3OE4A 5AVJA 3ZK9A 1NJ8A 3BT7A 3KUXA 1SWVA 4A6DA 3HXTA 1FW8A 1ZSYA 2H3HA 3K5HA 1DS6A 4XWYA 3CEAA 1YCDA 3NHUA 4P0PB 1NP6A 1RI1A 3K2EA 3LOPA 5IAJA 2OPBA 1DC6A 4NFLA 5IKOA 1OILA 4K05A 3TQFA 3UNXA 2GASA 2OCXA 4OMUA 5FBHA 2FZEA 4IQFA 1QH1A 2VSQA 3AW8A 2D0IA 5DNDA 1UR5A 1D9XA 4EJ6A 1J1IA 3FTQA 3TDNA 3A0RB 3OQBA 4FU0A 4JVMA 3ZE8A 3GEEA 5JHGB 1X80A 3TZEA 4EDHA 3SQWA 2DHRA 2TMKA 3SD7A 3P9IA 1AKUA 3UEOA 2BGGA 1PR6A 3LWZA 4G07A 2HJHA 3CXUA 3V1UA 1I3OA 5E1OA 3ZDQA 5KQMA 1T4CB 2A8YA 4R71A 1Q14A 4CUJA 4BVKA 1QH8A 2R6CA 5K45A 2EKZA 1UMCB 4FDTA 4PPNA 4QOFA 4LOHA 3RSFA 2EBUA 3VU1A 2B1GA 2UKDA 3D81A 1C9MA 4LECA 2LDXA 1BX3A 2FNAA 2QIOA 2Z57A 5AJXA 5ADWA 4GL4A 3ANYB 1KO7A 2HCTA 3WL7A 3G1TA 5KI6A 3TO5A 2BTEA 5CA0F 3I4LA 1S2DA 1JJ7A 1X14A 2OKCA 3L7IA 2A78A 2VHVA 1IBLB 2MSDB 1HDXA 5E6RB 2XGSA 2IIVA 1FMCA 2HF9A 1GA4A 3A9WA 3IVMA 4LZZA 5F9HA 1A04A 2MOKA 4U2DA 3P1JA 2B8EA 2OEPA 4TSFA 4DMRA 2PMWB 4YRZA 3PR1A 1G7SA 1L5LA 5CEEA 5JCOA 1AKQA 1QONA 3JRNA 2D5AA 4EYEA 4BP1A 3ROXA 5IC5A 4Q16A 2COKA 5CB6A 4B6FA 2OD9A 1W5FA 1M67A 2G9RA 4B4WA 3K09C 1GKLA 1B41A 3BGIA 1C4KA 2CLOB 3ONWA 3SBOA 5CBKA 2GVDC 1DC5A 3BAZA 4ZAFA 1IHXA 3BWDD 3CJQA 2R87A 3UUGA 4KVZA 1SKYE 1JDZA 1QS0B 2NU7B 3PEYA 2ZRBA 3EHDA 4CDRA 2D1QA 4AN0A 4N3GA 5KUTA 1ENOA 4NICA 4NV0A 5B53A 1B1CA 3ND5A 4LE0A 5ALFA 1J07A 4BQOA 5AI0A 2IHZA 3AHCA 1AQYA 4RK7A 4JI3B 4E4YA 4BLUA 4HNAA 2G07A 2GEJA 1JJIA 1WUHS 4KGZA 4U7TB 1JG2A 1Y8RA 3JWEA 4Q34A 3AWDA 3ANMA 3KJHA 1HDIA 5TB5A 3ZD8A 3W4IA 4CT0A 1ZD8A 3RYCA 2V55B 2ZTSA 5AM1A 3TD9A 1CIVA 3HHEA 4EENA 2G1AA 1AGYA 3QLVA 5AM4A 1NURA 1ZU4A 1XBTA 3TTYA 1HSOA 3PF8A 1CUCA 2YVKA 3DCIA 5C8VA 2AF4C 3BH6A 1V4BA 2PH3A 1RAFA 2QRVA 4UTXA 5JC1A 4O08A 4KNVA 1ZMRA 4K6MA 3MOSA 1CZUA 3UT6A 4YRIA 3V2GA 3EXFB 2CJWB 1A50B 2C2OA 3V7WA 1NVXQ 1B7GO 4AZ3B 4DPKA 2IS6A 2HY7A 2IQ5A 4WY5A 4DR3B 3I5UA 3OE5A 2WMYA 5GONB 4KMSA 5JBNA 4UBKA 3RB8A 3TUZC 1T5IA 2ZYWX 5LN1A 1NR1A 5AI4A 1NVUQ 5T7BA 1S4MA 3JYLA 3LUJA 3Q8XB 3K0BA 2V4MA 3PPWA 4L27A 1BOOA 1OI2A 3A1SA 3NTOA 4HXGA 4EGSA 1DXOA 1EAYA 4B83A 3ZCQA 2ZB4A 4C3VA 3EQZA 3TVDA 2A5LA 1UT5A 4R2JA 2R1TA 1WZCA 3DBRA 4L5CA 2Z1DA 2YJNA 4RMNA 2A9RA 4I8IA 1Y81A 3GL9A 4JD5A 1XT6A 3WTBA 1EEXB 5FTLA 4YP9A 4WTOA 3W2HA 1OH7A 3N75A 3Q10A 1PJZA 3NWEA 1JEOA 3Q1KA 3MYYA 2X0KA 5CDFA 3STWA 3GYBA 3STXA 1QDLB 3FZQA 1N0IA 1Z28A 1JKMA 3ZGYA 1YZ3A 4NONA 2WHRA 4BTLA 1MA3A 1G5RA 2GFIA 1FZTA 2PYIA 3FTCA 4WN3A 4R05A 4MV1A 4HEHA 3I04A 4F04A 4B3MB 1MX9A 1NLFA 1S1MA 1JEJA 4MP3A 3L0DA 4WI1A 1OREA 2H57A 5BWCA 2BISA 1V9LA 2MYUA 2ODAA 3KPWA 4XR4A 2Q0HA 3ZS9A 3ZIUA 1P4SA 2WJGA 3EUAA 1T9GR 2O7NA 4QYWA 5KYVA 5A7FA 3KLPX 4KFCA 1YS9A 2BBTA 3H17A 1OYWA 2Z8YM 4ZRMA 3R9XA 3SC6A 4JP2A 2HUPA 3IEIA 3WGTA 3ZIAA 4A03A 5HUHA 3CZ4A 1WNTA 1TK2A 1VCMA 1OXUA 1W8DA 1CF4A 3FRJA 3PHHA 1XAHA 3KJGA 4R3NA 2ECPA 4N0EA 5KCMA 4N03A 5JSKA 3DQZA 3T0IA 4HF7A 5B57C 1QG2A 3GIDA 3CCFA 1MB3A 2WQZA 1FY2A 4MMXB 3KD3A 3IL2A 1VYHA 3T61A 4AROA 4ZO7A 5E8RA 2NYVA 3WGOA 4NENA 2QF7A 1KI6A 3K4QA 4JKIA 5CLLA 2XOXA 4IIJB 2A35A 1MC5A 1IIBA 1PYGA 5GADl 1R9NA 3COJA 1TU0A 2A9VA 2ZRJA 3TCXB 1C7IA 4C5CA 4YIHA 1CUZA 2VLBA 1SHTX 4NK5A 3N2ZB 1WB5A 2Q1TA 1U9IA 3M6UA 1U2GA 4B0OA 1Y6ZA 1HE4A 4MJLA 4J0HA 4PR3A 3A1TA 3KYJB 4HP8A 4I1VA 4MOWA 3NH6A 3RIYA 1ORTA 3G0OA 3IMEA 1A95A 2XJ9A 1YDGA 1M3SA 4HBZA 4N65A 4B33A 3GJ6A 1IXSB 2Z08A 4PTLA 4YAOA 1BE0A 1WMDA 1T0PA 3RFTA 7REQB 1BQ3A 2QM7A 1ZMTA 4JL8A 3CPSA 5LA6B 2ZBGA 4DQKA 4Y1EA 2OO7A 1GFSA 1EM8B 2QVGA 3EIEA 3QFHA 1XLWA 4XWTA 3RLIA 3U81A 2O8DA 2J3JA 5K99A 1I8TA 4QUBA 3EW9A 3VO9A 5LR6A 1CUWA 3OQ6A 4KBYA 3EGDB 1DLJA 3OQVA 2HBRA 3EVBA 3REQA 3ABQB 3TZLA 2CBXA 1K88A 2F8LA 2PL1A 1R3UA 3BHMA 3F9CA 2D0DA 1EFLA 2ANCA 4KPUA 3WRYA 1I5EA 1T2EA 3OPVA 1E3DA 1Q0LA 1R1DA 4KIWA 1DTEA 1WNFA 2ZWOA 3FUVA 3P2YA 1DAGA 2I80A 1W4AA 3DEKA 1SVKA 4JC8A 4BMOB 1Z6GA 3I8OA 5EUQB 1V71A 2ZJ6A 2V4UA 2XF2A 3KQYA 4JS0A 5NLLA 2I6QA 4MHTA 4ZIRB 5TT1A 1NE2A 2O07A 1ZA1A 4WVFA 5ALYA 5EMMA 3HI4A 1UBMS 4ONEA 4PYRA 4RYLA 4WLFA 3RIMA 2NP6A 1J2UA 1GCUA 2ADFA 3FPEA 3NS7A 4B6PA 1W9HA 3GVPA 1SXJD 3ZD9A 1Z63A 5B1DA 2XBMA 3GQBA 4CM7A 3OZAA 4DDHA 3ANSA 4UHJA 1M5RA 1US8B 7GPBA 1GG8A 2PGLA 4YJGB 4Z0PA 4BV3A 3SVTA 2GTPA 2PG3A 2KJQA 4FR2A 3C5EA 4QQKA 4RVUA 5EE3A 3C97A 4KHPB 2JEOA 1OFHA 4RK5A 3BDIA 4ICIA 4Q7JB 3RYHA 4HD8A 3TPZA 1XROA 4NDNE 4P58A 4ZOLF 3UJPA 1Q0TA 3NOVA 4DZTA 4LPKA 3JQCA 3SF8B 4DIMA 1MOQA 3ML1A 4PXAA 4J9VA 3AEUA 4CM9A 1QKJA 2D2EA 5AJVB 4ZVNA 4B3HA 4H6WA 3VQTA 1PR1A 1I9CA 1QGUA 1QVWA 1S89A 1GRQA 4MRNA 2ZTLA 1B8OA 2Y1EA 1E79D 3DCNA 3HO1A 2B37A 3D5EA 2ZCVA 1PZHA 5ALDA 1FU7A 5JPDA 4YRPA 2BFAA 4ZOLA 4DQVA 2E85A 4C7OA 2FEXA 4K9NA 4PLHA 5CB8A 2AN3A 2YOFA 1BAPA 1MAUA 2NZVG 2EQBA 4HWOA 3GGOA 1DJQA 1M6YA 1AHIA 1FDWA 2FZ5A 3ZYCA 4EWLA 2DT8A 1M1XB 4JODA 1UBFA 2H51A 1J5PA 4TWRA 4KXNA 1XLUA 5SV2A 5ALVA 2QTHA 3FPFA 4V3BA 1I0LA 3LHKA 5AOVA 1YIAA 4FS8A 2I67A 2HV8A 2ZS8A 1QO0D 2PXAA 1FJHA 1RWWA 2PZ8A 2HCJB 3AR6A 3ITNA 4ZANA 1SKYB 1CUIA 3LBNA 2CMDA 1B2LA 3SJ7A 1UWCA 3WNBA 1G6OA 2OR3A 4WESA 1YK0A 2HRCA 4IVRA 4Q01A 3T5DA 3Q4GA 4HQ6A 3UXMA 3S5JA 4XGNA 1EM6A 1WBBA 3KG2A 1IY1A 2C8VA 3ZU2A 2VK8A 1JBQA 4YJ2A 1E2EA 5JAZA 1HNXB 1IJKA 4MCAA 2IOQA 4RPKA 1QU3A 1G5IA 3ISVA 2PE5A 4M87A 3VU8A 2J3EA 1VPDA 4HZUA 4S2UA 4RH3A 4UEQA 1QVRA 3DAYA 3O0TA 4LJYA 4RNDB 5MDHA 1ACJA 1GZ6A 3KB6A 4Q37A 5TARA 5JXIA 3I2JA 3DYIA 4ZO6A 2H8GA 4IIJF 1RQGA 5KTPA 1L8XA 1Y4DE 2O3JA 3HQ4O 4OXXA 4KMOA 4MLPA 3PJDA 2FMIA 3SSOA 2DBRA 1W0KD 2ZJ1A 3U44A 3KALA 4XM0A 3IGFA 2QQ0A 2ZRPA 3BWYA 2H2FA 4O2BB 1YJXA 3BMOB 4N3NA 1XZQA 3VI4B 5TF4A 1AUXA 1RXEA 2R6FA 1GFIA 4F8EA 3ONNA 1X7YA 2F64A 1WXIA 3MQFA 5LP1A 4DG9A 4TYWA 2QD5A 1RQRA 2IOYA 3DZBA 4R2LA 4I1PA 1EVQA 1YS6A 3S44A 2FOLA 5JU6A 1BHO1 1Y1SA 3ZU4A 2EHDA 2YASA 3O47A 4FWIB 3V8QA 3GLFB 5ESDA 2WA2A 4OBBA 3S2SA 1KYVA 1AGRA 4IV5A 4EI8A 2GNAA 3Q9LA 3G0IA 4MHOA 1Q0SA 1VJ5A 4NCJA 4RE5A 4POAA 4CM5A 3DVAB 1TD1A 5DXJA 1W73A 2HSJA 3Q40A 2DTDA 4MW5A 2XUZA 2PKRA 1FFSA 4MMYB 1BXZA 5HIKA 1E0AA 2B20A 1E1RD 1VGQA 1XX6A 2ICAA 2DQSA 1CV2A 3H75A 3LOQA 3QNWA 3UYKA 2A0UA 2Q6IA 4N8EA 1ISPA 1NOIA 3B2EA 4PV7A 3G7SA 3DYVA 1ZD1A 3WK6A 3ABZA 4HPWA 3RAJA 5DLDA 1HE3A 5G40A 2Z6AA 5IJAA 1QP8A 3RU3A 4BU0A 1IK6A 1BGXT 1GN8A 5BNFA 3P27A 4AJPA 1V39A 2QVZX 4DLPA 2D3WA 4MWBA 1CQZA 3VZCA 3HCDA 2FW9A 3TIFA 4X6UA 4X60A 3HFGA 4FMDF 4AP6A 1ZNWA 3LZDA 2C5FA 4HDQB 2OK8A 2CYBA 2QPLA 4KG7A 4P80A 3WYDA 4FFLA 2NUAB 4L6AA 2Z2XA 5CTAA 3OZGA 5ELMA 1QPZA 1D4OA 2Y1GA 4Z99A 2ZT6A 1F0PA 4H7HA 1VKZA 1ONPA 4LQCA 5I48A 1M0EA 4Q1FA 3F7OA 1E99A 3EIQA 1K6JA 3UMYA 3HGMA 4C4PA 2ZIXA 2CLSA 2VJBA 2VNKA 1CXZA 4ZGBA 4KGDA 2H5EA 1C7EA 4ECEA 2X5OA 2Q0XA 3DBIA 4MQEB 1K86A 4KVAA 1KDRA 4BEVA 2RGWA 1PW5A 4LJ9A 2ZE8A 1FNSA 1UZUA 2C2XA 3INGA 3REOA 1O96A 4RWZA 4BFXA 4DMHA 1JYFA 2ZRFA 4QBIA 3T8YA 1ZN8A 2O2DA 3KFLA 3ESXA 3P26A 1U0NA 4J3JA 5K2MA 2V5VA 1NVEA 4GPD1 3S8MA 3BSSA 3K30A 1I33A 4MQ5A 2C82A 2JJ1D 1OB2A 4UDXX 1M7GA 4K1LA 1PJ2A 2FY8A 3QU7A 4P0TA 3CNLA 4G36A 3JQGB 4JLWA 1DJMA 4RK1A 2E55A 1LI4A 1VYTA 3E61A 3N39C 3MAJA 4IFEA 1AY0A 5F1YA 3ZXUB 3P19A 1I3NA 5EJ7A 5K8VA 4G2NA 3S2YA 3A6HA 1QBKC 3LDUA 3C48A 4IOMA 1ZI8A 4EB3A 1TA4A 4NCHA 5LQMA 2QSJA 2M2IA 4EUEA 2HMYB 3CF2A 5GZ3A 2LE0A 3BWVA 3DLTA 3P2KA 5ER9A 3SKVA 4BO0A 3DMDA 3G2IA 4W4TA 3TL3A 3JZIA 1QKIA 2WIKA 3CVXA 4TKUB 2HAEA 4C6TB 2XB8A 3EFEA 4FNOA 4XYBA 4QM7A 4KLNA 1ZL2A 2ZRDA 3DD1A 1BMDA 3MLAA 1ZJJA 4TMVA 5F2OA 1TMOA 3QQPA 1ZD9A 2A92A 3M3DA 4R7TA 1CT9A 4GPZA 1ZESA 3RSQA 3K8ZA 2AMFA 1YZLA 1OFVA 2CJWA 3DUWA 2WD8A 3O82A 4EY8A 2I9PA 1I5RA 3BUSA 4CF7A 5CXUA 1LLQA 1E7QA 2INGX 3EZYA 2BF4A 4AX8A 5I7HA 3EDRA 3U7FB 3H2KA 3D2LA 1WD7A 3WE7A 5HG0A 3I34X 4GOND 1QGUB 1QNLA 3B1JA 3CINA 4KUHA 3BICA 4Y2PA 4QVKA 1C3EA 4U7GA 4C3OB 1V7PC 4OKNA 3CPEA 4HXEB 5C8DA 4PYMA 3WNQA 1TQ4A 1TKRA 2IELA 3BA6A 4R68A 2C5AA 1EUCA 4UTVA 3GELA 1GITA 3HV0A 3UC9A 3ORFA 4M83A 5IBPA 3ZE9A 2OV8A 1J5EB 3FNRA 3WLIA 5FBLB 1N5MA 2FPSA 1EFTA 4BUCA 1C1DB 1RCFA 3NVKI 3G9QA 4UZSA 2VNJA 1NGSA 3NUGA 3SBXA 1GZUA 1U8XX 4L7VA 3TJMA 1OYVA 1VSTA 4A8TA 4BGEA 3E9QA 2GERA 2GKGA 2YV5A 1U0SY 2D5CA 4GFDA 4UCQA 2YOGA 4R2MA 4UUBA 1EXDA 1A8UA 2F4VB 3X43A 3IH5A 1PYOA 4G25A 4JYAB