1HURA

Human adp-ribosylation factor 1 complexed with gdp, full length non-myristoylated
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
180
structure length
180
Chain Sequence
b'GNIFANLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLSNQLRNQK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN ADP-RIBOSYLATION FACTOR 1
publication title Structure of the human ADP-ribosylation factor 1 complexed with GDP.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 51
structure length 180
sequence length 180
chains with identical sequence B
ec nomenclature
pdb deposition date 1995-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00025 Arf ADP-ribosylation factor family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1hurA00
4FXPA 2NIPA 3E70C 5UKDA 3UATA 5K8IA 2H1LA 1PLKA 2QTHA 4Q9HA 2WOOA 121PA 4C0AC 4DLTA 4U5XA 5FTMA 1M34E 2DFKB 1DG3A 3ETLA 3UANA 3I73A 3IEUA 1QHXA 2JLQA 3PUXA 5J47A 1KKLA 2ZRNA 1SKYB 4I1SA 4LBWA 4CGZA 1ZM3A 2QORA 1U94A 1VG8A 1KO8A 1XD8A 3AKDA 1G5PA 2OAP1 3VFDA 3SYLA 5ELXA 4TYNA 2FA9A 3FMOB 1DO0A 5C2JB 1W2GA 3MG9A 3SZRA 3LO5A 2CNWA 1IJEA 4X8LA 3MWLA 2QBYB 3ASYA 3PEUA 2KBEA 3IBYA 5EE5B 5JHGB 3OHMA 1OB2A 3VR1A 2CHVA 1Z2CA 2WJIA 1N6NA 1W0JD 3BD9A 3KZ1E 3LA6A 1G7SA 4HSEA 1E6CA 5AK0A 4GRAA 4DDVA 4D82A 5J4LA 1TU3A 5KDDA 1KMQA 3TIFA 1U90A 1IM2A 1OKKD 2ZYVX 5BYJA 1XJQA 4U00A 2RGBA 4CZ2A 4DLXA 1W4BA 1R8QA 4KITB 2ZAOA 3QENA 4NDZA 1DAGA 1JR6A 1KI1A 1KK0A 3VU9A 2B92A 1PV4A 2ERYA 4O3MA 3SQWA 4FMDF 4MYHA 1OH7A 3KXLA 4PR0A 3SC3A 2GTPA 2RCNA 1FPMA 1N6HA 4D0NA 4BUJA 1SVLA 3L0PA 1XWIA 3SJZA 1QHHB 5EXXA 1EK0A 1GTVA 1RE0A 1TL7C 3KXIA 5A0FA 4B71A 4BEJA 1QBKC 1UFQA 2IYSA 1VCNA 2DFNA 1E32A 1G3QA 3GEEA 5KTYA 4A82A 1E2FA 2C04A 4X8HA 2BWJA 4POAA 5HE9A 1YJ5A 3PJRA 3N2EA 2QGNA 4XVUA 2GCOA 1W0JA 1JECA 1YQTA 2KE5A 4RJLA 3NHAA 2ZJOA 3W34A 2Q6TA 4DJTA 1F48A 4NONA 5K8LA 1Z63A 4RKFA 1SVKA 4NZYA 5GVSA 4BZPA 2ZANA 2XXAB 4Q02A 4BFTA 4I99A 4H1VA 2AKYA 1KI7A 3BWDD 1J8MF 4OI0A 1E2KA 2F43A 4MRPA 4D6PA 721PA 3GLGE 2AK3A 1HY3A 1QF9A 2OCPA 3PITA 1TEVA 1G6HA 5HZKA 1GL7A 2WKPA 3N2IA 3NIBA 4NCNA 1S3GA 4Q5IA 1GRQA 3R7WB 1SVOA 2XTMA 3KFVA 3VX3A 3FKSD 1WE2A 1AGPA 2F43B 5CB8A 5JFGA 2N1BA 3A36A 2UZIR 1E79D 1KIMA 1KY3A 3DKVA 2AKAB 4TLBA 3NC1C 4O0MA 3L82B 1OFIA 2E1RA 3GLHB 4OK3A 4A4DA 4QKQA 1JR3E 5B58C 2PX3A 1GWNA 4OK5A 2VHTA 2F9MA 4MGIR 3TQCA 2FG5A 1U0HC 2HXSA 2VSFA 1ZNXA 5HZHA 1Q0UA 2IF0A 1YZNA 1Z22A 2AFIE 5FPHA 3UK6A 4G3XA 4EJSA 5E3HA 1T5LA 2QTVB 1QG2A 3B82A 4QJ5A 5L3VA 1S2MA 2YWHA 4EAQA 1W49A 2WWYA 2NO7A 2PZFA 1UF9A 2VSOA 4LJYA 3FKSA 3BK7A 1DAHA 1HV8A 1II0A 4IRUB 2G1KA 2PCLA 5FOUA 4JZKA 1LF5A 4EJSB 1E79A 3HWSA 3FHCB 4Q19A 1HYQA 1ZM9A 1G8PA 5FL7A 2P67A 4KCGA 3SYKA 2GK7A 1GSIA 3P4YA 1RRPA 3PQCA 4PHHA 2FOLA 5CJ2A 3QKSA 4MRSA 2VF8A 2ZR9A 3IIKA 3CPJB 3Q5EA 2BVNA 3AB3A 2GZDA 4TTPA 4EDHA 4Z1MD 1YZLA 1GIAA 1YU9A 1FX0A 2ZRLA 3TW4A 3QBVA 1P6XA 1OV4A 2ZREA 2F1JA 2G88A 4A0GA 5L3QA 2Z6VA 1Z0DA 2QMEA 2CHQA 3PV0A 3SHWA 2R6FA 4FIDA 2JA1A 3QKSB 2FEOA 2GXSA 3ADKA 1NNEA 2DB3A 2CCKA 3QEJA 2WTUA 1P4SA 1FX0B 1W47A 4Q7MB 4M9ZA 3WYGA 1TADA 2FZ4A 3BFKA 4OI1A 3S1AA 2ZXUA 1JB1A 1Q3TA 1OJLA 5F2EA 4D26A 1I2DA 1NIJA 1AS0A 3K1JA 1JXMA 3GJ6A 4NE2A 4IFEA 1DAFA 1US8A 3TSWA 1YR9A 2CE2X 4KBGA 2FU5C 1E9AA 2MSEB 3SJBA 1CULC 3S1AB 1CKEA 4NPHA 1TF2A 4O2LA 2VBCA 4G01B 4KSCA 3QIAA 3ND9A 4V02A 4OHXA 2BEKA 4LRWA 1US8B 1ANKA 4DZZA 1KZ7B 3PR1A 1AK2A 2P65A 3QSYA 2BKEA 1P75A 3A37A 4HLDA 3K9LA 5J4YA 3QUSA 1ZU4A 3TVTA 2Z4SA 3MFYA 1L2TA 4Q1AA 3IEVA 1NN3A 3I5XA 1W48A 3B1ZA 2J45A 3O8BA 3PUYA 1IAQA 2QPAA 4M21A 3MRSA 1GAJA 5DE3A 3QXCA 4KFSA 4RZ2A 4TQAA 4B32A 1PLJA 5EUMA 2QM7A 2XNDD 3MUFA 1CLUA 4JLMA 2WBLC 2GBLC 2C9CA 2FWRA 3WNCA 2BCJQ 2B6HA 2WOJA 1W1WA 2FE4A 1F3OA 4Q9JA 4FCWA 2OG2A 1P2UA 4UNNA 2ZPTX 2F9LA 3UMFA 2BDTA 2AXPA 2IT1A 5CIWA 4OHYA 2BCGY 1NIPA 5KNCA 4RFVA 3THYA 4Z54A 1F2UB 2XZPA 3FHOA 2GF9A 5KOYA 3PEVA 1E2NA 3EIHA 3L0IB 4LGMA 4Y0AA 1NBME 1ZW6A 5E4FA 1NRJB 2QP3A 4URVR 1RYHA 4XWKA 5JLJA 3THYB 1UKZA 1HT1E 2VH5R 5FPKA 2XITA 3X1WA 1XD2A 2QPOA 3AVYA 4BRUA 3FTQA 3GPLA 3RRMA 3WXMA 1WBDA 4V0OA 2ANCA 2QUZA 2G1JA 3K09C 1OIXA 3AQ4A 4D4KA 2AWNA 2XNDA 521PA 1ZINA 3CRW1 3B9QA 3WHLA 4LK2A 5EP2A 4TLAA 2FSGA 5E95A 2PZGA 1XD2B 5EP3A 3DOEA 1JXOA 4KODA 1YZTA 3TUZC 1G291 2PLRA 4LBZA 4DDUA 3WMEA 2ORWA 2CE7A 4HDQB 4CYMA 4ZKEA 4LYFA 5H68A 5KUTA 4MA4A 2NMVA 2YWFA 3W3ZB 5K8UA 1LNZA 2PX0A 3QEOA 2JLVA 1KDRA 2GEVA 4K81B 2OUKA 2D62A 3ZVNA 1NSFA 1MABB 3EC2A 3DDCA 3AVTA 3L0SA 3T61A 1E2DA 4BWYA 4GP6A 2CCJA 3QQ5A 5BQ5A 2F1HA 3H1TA 1T0JB 3HU2A 5KU1A 4Q00A 3W6NA 5LPNA 4MDEA 4P0TA 5C18A 1G3MA 4EQ6A 1T9HA 5BYKA 3F8TA 4MITA 2F55A 3EZFA 4BLOA 1VYTA 2YV5A 3GJ5A 1Z83A 2P6NA 4QJ4A 4TZ6A 2HJVA 4JL5A 2ZIAA 4QNMA 4MYUA 2Q3HA 2YVUA 1W4CA 2ZJ5A 5TARA 4WXRA 5AUPB 4Z51A 1EFHA 4EQ6B 2RKOA 2WZQA 5C4MA 1OFHA 2VQSA 3HYTA 3B1YA 4FW9A 3U2QA 2O8BA 1SKYE 1FP7A 3KQHA 1W36C 4TYPA 2WAXA 4RD3A 4LX0A 2ZS7A 1N6OA 4B3XA 4NBSA 2BBOA 1NN0A 4TQUS 5DO9A 3VTKA 1P62B 4TN1A 1OPXA 3W9YA 4UQOA 1JR3D 1S9DA 3GJ8A 1D6JA 4NYIQ 1UADA 1DE0A 1Z07A 3GD7A 4JL8A 5JEEA 5FUVA 3THWA 1FMJA 2QENA 1ZMXA 2W0SA 3W5IA 1NVUQ 4QGFA 1Z2AA 2J7PD 4A0RA 2ZI5A 3EAQA 1P2SA 1ZM4A 1KAGA 4DWJA 1TQ4A 1ZD9A 2CBZA 2QQ0A 3VAAA 2R6CA 4OYHA 3WP0A 2QN6A 3EA0A 1Q20A 4OHZA 2IA5A 1UAAA 3BH7A 1P73A 1GVNB 1PJRA 4KBFA 1UBCA 2D2EA 1IN5A 2WWHA 1W4RA 1WDTA 3T5DA 4DLVA 4HATA 2YWEA 3QF7A 3OEED 4JYBA 1JR3A 2X8AA 1ZCBA 1RW4A 4M22A 2PT7A 4DDWA 1OE0A 3EA5A 3L8ZA 2VP9A 2FJUA 4WZAE 5B2ZA 2EFGA 2P0EA 1SXJB 3BH6A 1G3IA 1Q1BA 4HLUA 3LNCA 4RCZA 1XEXA 1OSNA 4M1KA 2GWHA 3DMDA 4Q4AB 2GXAA 4AK9A 3N70A 2OCAA 5AR1A 4DDTA 2EFCB 4HYYA 3DM9B 1XB2A 2QA5A 2WJGA 4PHGA 1ZYUA 4IDOA 1KK3A 2AN9A 4F4IA 1XEXB 1IN6A 1IOZA 1E9RA 2RGCA 1RFLA 2BKUA 1G4AE 4KJZA 4IEIA 1H8HA 4KHZA 3PEYA 1ZVQA 4XSHA 4DBLC 2GJSA 5G40A 4I1UA 1TU4A 2IW3A 4JVMA 4HB3A 2I3BA 3QI2A 3T06B 4Q48A 5JI2E 2J3EA 3OEEA 1XTJA 2WVJA 2V6JA 2ZAMA 3MJHA 1U8AA 4JSTA 2ODBA 1ZAKA 3I3SR 2JGNA 1LY1A 1FNNA 1ZBDA 3D6TB 3ZGXA 1RC8A 4N0EA 2FEMA 3LDAA 4EUNA 3JVVA 4IDHA 4C0HA 2VHJA 2JJ1A 3E2IA 1WMSA 1A82A 3NC0C 3Q9LA 3VKHA 2V3CC 1ZIOA 1D9ZA 1G8HA 2CHGA 2QL6A 3GLHE 3NKVA 4QBGB 5G3ZA 4MRRA 1A4RA 4OQMA 3RC3A 1E9CA 4XTRA 4OQFA 2DFTA 5DHAA 1OH5A 1E9EA 1E1RA 2JLRA 1W5SA 2UKDA 1G41A 2ZSEA 1KI3A 1YZKA 3B2EA 3ZVRA 1DAIA 1KI2A 4DUGD 3TJZA 5FBLB 3ZD7A 1GG2A 4DHEA 1FZQA 1K6MA 1Z0FA 4LPSA 4V0NA 4G5GA 4YLGA 3RSOA 5JWHA 4A2WA 4B47A 5FR1A 1QHSA 3K0FB 4I1VA 2CVFA 3I5YA 1HH4A 3BFXA 1GFIA 4UXIA 1Q44A 2VPPA 4PSKA 2CJWA 1AQYA 1CIPA 4PTLA 1NBMD 1NJGA 2MSCB 2HDNB 2D74A 2J59A 3CRQA 5G3YA 4URXR 4LUCA 2OE2A 4ZKDA 4MH0R 2WWWA 3X1XA 2RGNC 2CJWB 5EE9A 3NHBA 3EZ6A 2IWRA 4B3GA 2BEJA 1CXZA 1M7GA 1OXTA 4DUGA 2HUPA 3IKJA 3BB4A 3K70B 3IO5A 3OFND 2YZ2A 5FTNA 2O52A 4QBFA 2Q21A 3T15A 4P4SB 1TAGA 3ASZA 4PXAA 4M53A 3TLXA 4PO8A 1Z29A 4Q4JB 1AKYA 4V0LA 2NPFA 4JT4A 5JCPA 3A1WA 2ZE6A 5KPJA 1Z47A 2OCYC 1NBMA 4HEJA 2P5TB 1YKSA 4UNSA 4QGHA 2R6DA 4L15A 3ZDQA 1KKMA 5JJLA 1VG0B 3GEHA 1G9XA 1VYUA 2JLUA 2MSDB 1KDPA 4B2LA 3TAHA 2JAQA 2OT3B 2QY9A 3F0TA 1NY5A 2P6RA 1P72A 5G53C 4IDPA 4NU0A 1XBTA 3IDQA 2FH5B 4Q7KA 1Z0IA 3B78A 4W7SA 2WWIA 1KJYA 3OFNA 4BE7B 3Q7PA 2GCPA 4S35A 3A1TA 3LFUA 3AP2A 3U4QA 4AKIA 1I2MA 1KY2A 2TMKA 5TV2A 1QHGA 2DY1A 1XRJA 1DAEA 3EC1A 3TSZA 2ZU0C 3CX8A 4JLJA 4DCVA 4V03A 1AM4D 4G1UC 3RS7A 4XWAA 2YJTD 1ZUNB 2GEDA 2ZRDA 2UZ3A 4NMMA 4IKEA 3D31A 1NY6A 4PAMA 2QSZA 3O8CA 1E0KA 5CB6A 3TUJC 3RANA 1E9DA 3DOFA 2C5LA 1CRQA 5JRZA 2O0HA 2IYUA 4A8JB 4B74A 4AG5A 1AA9A 1XFAA 4A0HA 1TMKA 2ZJZA 4RCYA 5JCZA 4KYUA 4MKGA 3EPHA 2WKRA 3C5CA 1J99A 1UBFA 2CLDX 2FFHA 4IVPA 1KO4A 2GRJA 3U7EB 4YMVA 2CNWD 3BB1A 1G21E 2QQEA 1E3MA 2ZE8A 3EASA 4MRVA 3M1IA 1DELA 1G1MA 4WZBE 2JLWA 1S4QA 1NLZA 1KO7A 1R4AA 3KJIA 1FTSA 1G7CA 4R71A 3WYAA 4HUQA 1E0SA 4HI0E 4BFZA 4IOLA 2VYFA 3I62A 1E1QA 2WJYA 4RKEA 4QM7A 4OHWA 3R9IA 4OL0A 1P2TA 1T0HB 2NPIA 4HUQB 2WSSD 2GF0A 2JATA 3ZS8A 5F9HA 1R5BA 1S8FA 2ZUDA 2C77A 4BLPA 3NXSA 2QBYA 4UJ3A 2LWIA 5JBQA 5AUQA 1E96A 1CR1A 2GAAA 2P5SA 4PZYA 3LBIA 4L16A 1TUEA 5FFMA 4YONB 2JASA 4OJKA 3O8RA 2VP6A 3OESA 1S1MA 3RC8A 1DPFA 2IYQA 4JBWA 1QHYA 1X1RA 2H8KA 3LAWA 4LZZA 2WMOB 4PPNA 1TF5A 1W46A 2W0MA 4LOAA 3MAAC 2D3WA 2IEYA 4YXWD 2NO1A 421PA 4DLUA 1WA5A 2VHQA 2VA8A 1YHNA 2FDCA 3BS4A 2VSXA 1ZUHA 1RRGA 3NDPA 3WP1B 1E4VA 3F5FA 1OFTA 5DISB 3SE0A 2HYIC 2CDNA 3AP3A 1G7RA 3DL0A 1O3YA 5TVKA 3GMTA 3FE2A 2WSSA 3SQXA 4GMDA 4R2HA 2BOVA 1QHHA 4ERNA 3GFPA 4V0MA 2VL7A 4LJ7A 4AYWA 3CUEF 4M0LA 3DM5A 3NBZC 2XZLA 3OIWA 4EFMA 3VHXA 1E0JA 3ZZTA 1Z6GA 3VR2A 1JPNA 2FPKA 5GJWC 4A8JC 2IHYA 1M2OB 4PPQA 1SULA 3AM1A 5KHOC 4DB4A 1TPZA 2ZRPA 1OF1A 5HR5A 2O8DB 4YXWA 8OHMA 2EFEB 2AD5A 1ONBA 4QC2A 4MGZR 1KJZA 4F7WA 3R9WA 2XEXA 1XEWY 4JVNA 2XXAA 4BEBA 3ZVMA 1SVWA 3LBNA 3RHFA 3GJXC 2IS4A 1G64A 2ONKA 3CIOA 4CW7A 4URZR 3TRFA 2FX3A 1NLYA 2F7SA 2H57A 1NKSA 1ZJ6A 2IYZA 2O8CB 2J46A 1W2HA 2OO7A 5C1BA 4PO9A 4X8MA 2BMJA 4NCIA 3KJHA 5TDHA 5G41A 2WWXA 1VMAA 2P2LA 4RD0A 3R7WA 1DBSA 3SU8A 3TVDA 2FMXA 1A5TA 3Q72A 3KJGA 1VCIA 3CF2A 3Q3JB 2RGGA 5EZ6B 1UDXA 4GOXA 4UKDA 1UKYA 1NLFA 4EPTA 1Q22A 3K53A 3U60B 2QAGC 1PLLA 1YR8A 3GLHA 5EP1A 5H70A 3I4LA 3TBKA 2C9OA 3DKPA 3NH6A 3JZAA 2BJWA 2QRNA 4LYHA 1KHTA 2DYKA 4WIAA 3NVAA 4C0JA 1NMYA 5IT5A 1KI8A 1SXJE 5FL7D 2R6GA 3BORA 1E2HA 3AVOA 2HF9A 1HUQA 2ZJ2A 3GJ3A 2IYTA 4MDFA 1IXSB 2MMGA 2QI9C 3A1UA 3T1VA 3UIEA 4IOMA 1PZNA 3AVPA 3AF2A 1MH1A 2A9KA 4C0LA 2J0UB 2IF2A 3WHKA 1JALA 3CM0A 5B57C 2OLJA 1MO4A 3QKRB 2B7CA 4MRNA 2C8VA 3B9PA 4JVSB 4M9XA 1EFCA 3ONWA 1LS1A 4DSNA 4ITRC 2OXRA 4UNPA 1CTQA 3C14C 1QHIA 2PEZA 2ZU6A 3CZPA 5KDOA 5DSZA 3AVVA 3AVUA 3TUIC 3OIUA 3KQKA 1ZIPA 2XSZD 4QJ3A 2BHRA 1R0ZA 2GEUA 2WJJA 1U9IC 1OXSC 3G5UA 3LRPA 4LWZA 5F9FA 1WRBA 2GCNA 1VG9B 3CRRA 5DYIA 3EZ7A 2WHXA 4AIIA 1XTQA 3A4NA 821PA 1SVMA 3ECCA 1ZD8A 4ZPXA 1NMZA 3SJCA 3ZD6A 4YMSA 1KSJA 1RVDA 2GVZC 4URUR 2HYDA 4K46A 1JJVA 3ZIAD 1EXMA 3K09A 5M04A 1WQ1R 2IYRA 3Q5DA 1WXQA 4DEXA 2QT1A 3VMFA 1NG9A 3ADCA 3VR5A 1AKEA 1K8RA 1RYFA 5LDDC 4ZCMA 4ZCIA 2HT1A 4FWTA 5DGXA 2PT5A 4W9MC 1ZC3A 2WSMA 1XP8A 1IY2A 1FMLA 4AWXA 2PEYA 3U61B 2XSZA 4C7OB 1NJFA 2BBSA 2ODNA 2OLKA 3LW8A 1VIAA 1GZSA 4TTRA 4A2QA 3PUZA 4KFTA 4TYWA 1AGRA 1DG1G 1R10A 2OXCA 2J9RA 4Q1DA 4MYTA 3GLIA 3ZZUA 1YZUA 5EE1A 3R9XA 2G3YA 1A2BA 5JMTA 5KSPA 2NOAA 3QXSA 2GVDC 5FH9A 4GNKA 3PFIA 1V5WA 1BH2A 1GRNA 2YC2C 1GKYA 3LXXA 2A2ZA 1CP2A 4I81A 4N0DA 1EESA 1UJ2A 2ZSAA 1XZQA 1EWRA 2C9YA 1U81A 2J41A 4KLNA 2Y8EA 3LVRE 3ZIAA 2ZI6A 1U0JA 3GLIB 4RZ3A 5TXGA 2Q9CA 1G8GA 3LBHA 1H8EA 2ATVA 3FDIA 1Z0KA 1MO5A 3PEWA 4AY2A 2DHRA 2KB0A 4D0GA 2FV8A 4PAOA 4M1TA 4I1OA 2HF8A 1XTKA 2V55B 4BLSA 2YC4C 3LV8A 4FMBB 2ZJYA 3PENA 3O8DA 3NH9A 1TQ6A 4YMTA 4AKHA 5DIFA 5AJWA 1HQCA 4N3NA 3LX8A 2YOHA 3LXRA 2FFAA 4Q7JB 4YDSA 3KTAB 2BC9A 2DWPA 2GILA 2RHDA 3LY5A 4DCUA 3VNVA 4IFBA 3F3YA 1F2UA 1B23P 4WW0A 1NI3A 4XD7A 2OFWA 2QU8A 1RJ9B 1G4UR 1P3JA 3I61A 1E2IA 1EFRD 4G5RA 4ASUA 4GFDA 1W36B 3LQRA 1GNQA 1E2GA 1ETUA 1JJ7A 1R2QA 2QE7A 2QMUA 2Z83A 4HAYA 5DI9A 3ZYCA 1P5ZB 1UKEA 2PCJA 1TNDA 1HE8B 4TT3A 1WF3A 2ODWA 1KZGB 3PG5A 4AG6A 3BXZA 2ZR0A 4HAUA 5EXSA 2CL0X 3BIFA 4KXFB 1CU1A 2DWQA 3ADDA 2FGKA 1YVDA 1ZNZA 2REXB 1LS6A 4GSYA 4Q1EA 1QRAA 4P4TA 1FNMA 5AJZA 3WBKA 4KSBA 1YRBA 2Z0MA 2ZRJA 2JLSA 3DO6A 4ILEA 5L3SB 1M6NA 2R6AA 2ZSDA 3RS5A 4PX9A 3U44B 4R2IA 3HR7A 2HXYA 3MWJA 5GJBA 3V4FA 1J7KA 4CEHB 1T3HA 3A58B 4AD8A 4GMXA 3RVBA 2B8TA 5J5CA 3U3JA 4BPBA 3DPUA 1VYVA 3CR8A 4AYTA 1G6OA 1EFRA 3HR8A 5BN3A 1XCGB 3FWYA 2GZAA 1MABA 5F3WB 2B7BA 3W6OA 2OCBA 2ZJAA 2I1QA 4PQYA 3V9PA 3EPJA 2RHMA 2ZVPX 2VO1A 4Q9KA 4HB2A 1TTTA 2DPXA 4Q1BA 5CITA 4WOPA 2J0QA 2H92A 4A9AA 1U2RA 1E9FA 3G82C 4OKSA 4E03A 2IBMA 3QE0A 5CIQA 3KL4A 2WV9A 1ESNA 4GBMA 1QZXA 2O0KA 1OXXK 5FOVA 4CDGA 4Q4HB 2K5UA 5CYPA 2JLZA 3DMNA 4UNRA 2KI5A 2JLYA 3AH8A 2LKCA 1IXRC 5FOXA 4E5UA 1G7TA 3QVVA 4ON9A 1YZGA 1ZC4A 2P6UA 4NHOA 4C0BA 4ACAA 1OB5A 5J4KA 3EPLA 1DADA 2AK2A 5KSZA 5AJVB 5GVRA 3UMSA 4ESHA 3SFZA 3TW8B 2J7KA 3P26A 3BE4A 2GK6A 4R9UC 1QVRA 4GT1A 2IUUA 4US0R 3FMPB 3CLVA 3K9HA 5AUOB 3I72A 1P9NA 4RSGA 1E2LA 4NYJQ 1TEXA 3WNDA 5FOTA 4YQFA 2FSFA 3E5HA 5FBRB 1Z28A 3U7FB 2DCUA 3QPWA 5D3MA 4FMCB 1KDOA 2F6RA 3QKTA 1OT3A 5HCNA 3SR0A 1E2PA 4JLNA 3KQNA 3NTUA 3FPAA 1ZU5A 4AI6A 1SXJD 1IN8A 3KB2A 2MMCA 5D3MB 3VX4A 1KDTA 1Q57A 5BWMA 3VR3A 3X1YA 3IBGA 3WMGA 1N6IA 3FFAA 1MO3A 2VHCA 3IUYA 3AF3A 1LB1B 6Q21A 4NCKA 4JLDA 4CF7A 1TQDA 2KBFA 4DCSA 3LX5A 2W6ID 1VIYA 1KSHA 3L43A 4HAVA 2W2TA 1CF4A 4YMUA 1VHTA 4YC7A 1E2EA 2KSQA 1E9BA 3T1OA 4JLVA 5F98A 2G0TA 1KNQA 4TL6A 1MRSA 5FTLA 5DH9A 2X1VA 1ESMA 4LHWA 1H8HD 1RIFA 4TMWA 2Z43A 1BOFA 2PJRA 1SXJA 1J2JA 3NBXX 4O25A 4ZDWA 3RS3A 1SQ5A 1M74A 1WBBA 4Q4AA 2AFHE 1SHKA 2XNSA 2ZVQX 3WMFA 4EKDA 4DB2A 1XNJA 4V0ME 4URYR 2RGNA 4JLOA 2EU8A 4F91B 3RWMB 1ZNWA 2XJ9A 3W8RA 4EFLA 4S2EA 2V8OA 2YINC 4Z8XA 1DAMA 2ORIA 4Q01A 2JJ1D 1EFTA 4BFVA 4RD1A 1SHZA 3R8CA 4O2RA 2REBA 2W6IA 1VPLA 3K0AB 4XTCS 3LLUA 3REFA 2A78A 3SEAA 3TAUA 3ZZ0A 2YOFA 2AWOA 2GXQA 2W2XA 2V4ZA 1E1RD 1N0UA 2OFXA 4ZV4A 2X2EA 1N5JA 4HAXA 2V1UA 3RLFA 5FOWA 1DAKA 2QSYA 4MUAA 3K0CA 1EFUA 4BASA 2PBRA 5CLLA 2REOA 5E7IA 3OIYA 4K8OA 4NCJA 4PANA 3MD0A 3U6KA 1SVIA 2IUTA 3P1JA 2PMKA 3WY9A 2XB4A 2N46A 1RKBA 1G5TA 2CL7X 1N5IA 3KKQA 1KI4A 2Q0HA 4M1SA 3KKMA 4C0QC 3U3OA 1F6BA 1P7CA 3TNFA 4NTZA 2CMKA 3CX6A 5JZVA 3HU1A 3NEYA 3IQXA 5L3RA 1UM8A 2XOKD 3I1FA 4JSYA 4LHYA 4NH0A 2ZRFA 4JIMA 4PHTA 1HQYE 4L5BA 3K70D 4ZDJA 2ZE5A 1XXHB 5DLQC 4QFMA 2GJAA 4G5OA 2W6JA 3NG1A 3HPRA 3K0FA 1YR6A 4PZLA 2YNMA 1N5KA 1JPJA 2IYXA 4DCNA 3BAFA 1U99A 5E7MA 3B1WA 3FMFA 4D25A 2QRZA 3AF0A 1E98A 2O8EA 3IILA 4PSVA 4QM6A 2F1RA 2ZI3A 4IOKA 3GQBA 1FP6A 4DVGA 3KQUA 2JDID 2RH5A 4M2LA 2WIBA 1XPUA 4A15A 4Y0VA 3NDBB 4M1YA 5JS8A 1NVVR 4DT1B 2HCJB 2O8EB 4KI0A 5H8WA 1S0UA 4C0SA 5FL3A 3UPUA 1C1YA 221PA 2XOKA 2OZEA 1Z08A 5JEDA 4JLPA 3PCRB 3FB4A 4PAQA 3AKYA 4RD4A 4HB4A 1NKTA 1DS6A 4A6PA 4PQRA 1N5LA 4KYIB 2JEOA 3C16C 2IUSA 2IYLD 3W6PA 4A92A 1Y3AA 1OH6A 2RAPA 4P4SA 1XEFA 5EJEA 1GKUB 1KI6B 1KGDA 4MUBA 5EZ5A 4EIWA 1JEEA 4GP7A 2ZJ8A 4QBHA 4Q4JA 5JI3E 2J5XA 1XZPA 3EX7C 3SDZA 5P21A 1G20E 1XDBA 3BJIC 4HLCA 4JLKA 2JDIA 2NZJA 4FN5A 2C78A 1M1YE 2A30A 4OHVA 4LJ6A 1KMHB 2QNRA 5BN4A 4HZUB 1II8B 3KXKA 2R62A 3EXAA 1FW6A 4V0KA 4II7A 5HE8A 3GLFB 1IXZA 4AURA 1IONA 4IDQA 1FFHA 4KU4A 5KDLA 1XMSA 4EPWA 4L9WA 2C95A 4P3YA 3H2YA 1OXVA 2X19A 2EFDB 1J8YF 4Q9IA 4PPFA 1EGAA 1ZUIA 1G18A 2QMHA 4FMDB 4BZQA 2GAOA 3EWSA 3Q8XB 3VR6A 3CNOA 4Q7LA 4R98A 3SN6A 1LFDB 2WM9B 2ZEJA 4KO8A 4MGKR 1XMIA 5EE0A 2IYVA 4ARZA 3GLIE 4NYJR 3HJNA 3T1TA 1Z0AA 4U7DA 4QXAA 2EW1A 4XIGS 1LV7A 2OBLA 4A1FA 2WWFA 3KFXA 3DZ8A 1T4GA 3KX2A 4DLZA 2JJ8A 4LSGA 3RRNA 2XZOA 4JL6A 3G0HA 5JSZB 4LC0A 2V54A 5DHFA 4ARZB 4LHXA 4F38A 1XTSA 1CJMA 3ZH9B 5IHPA 1VDZA 3X1ZA 2IYWA 1M8PA 4JJKA 1NN1A 3BGWA 2V6IA 4GZMA 4D0LB 5D3QA 1AIPA 1FUKA 3TKLA 1CJVC 3QPUA 4Q4LA 4XVQA 1Q1EA 1EX6A 4CIDA 1W0KD 1U0LA 3KB1A 4A8JA 1Q3HA 4B3DA 2Q3MA 4HAZA 1TQ2A 1KNXA 2VTKA 3BBPA 5K8TA 2R65A 4TL9A 2ZYWX 1D2NA 1E1QD 4AYXA 2QTFA 2ZRKA 1YZQA 3QXXA 4Q66C 3RDPA 4GI7A 1OIVA 1F2TB 4ZDIA 4BZXA 3KUCA 4JBXA 1ZM7A 3B5JA 2ZI4A 2H16A 4DLYA 2Z4RA 4LJ5A 3U3MA 2Q9BA 3A4MA 4DLSA 5FI1B 3SHFA 4D4LA 1F60A 3LQQA 4B33A 2A7QA 3AV0B 4HAWA 4W5JA 4A0FA 5L8VA 4JKYA 2FF7A 4PQFA 5EP4A 2IYYA 4IJMA 1N2CE 1Q21A 1W0KA 4L9SA 1HT2E 4E09A 2O5VA 2HLDA 1NG1A 3BFVA 2H5EA 1Z5ZA 5EE3A 3W90A 2ZYUX 3A1VA 3EIEA 2QAGA 4DRZA 3DHWC 3MMPA 3FYHA 3C7KA 5DN6D 3U6BA 3P27A 2OM2A 3QPVA 1N6KA 1P60A 2ZROA 4J0QA 4M1MA 2C98A 4LI0A 1JI0A 2DR3A 2QAGB 1LVGA 5JRJA 3KUDA 3QBTA 3SYNA 1COWD 3TQFA 3GJ4A 3SOPA 1Z6YA 3THOA 3QJYA 4LC1A 4P32A 4F92B 3IPXA 1AN0A 3EIQA 5B64A 4B2PA 4F4JA 4G5QA 3TGPA 1YRAA 2N42A 2ZSFA 3I8SA 1W5TA 3EZ2A 3B1VA 5AWFC 4ABYA 1R5NA 4LJ9A 2O8FB 4WXPA 1T91A 4TLDA 3IIMA 3ZQJA 4TYYA 2R9VA 4KV9A 5LD2B 3ZQ6A 3AF4A 1E9SA 1OHHD 2QMOA 4N1AA 4XH9B 3BERA 1CS4C 5DN6A 2OILA 4BGDA 1CJTC 1DARA 1Q1ZA 2EWWA 5GADl 1U9IA 4QHYA 4TMXA 2LCFA 1CJUC 4IOJA 3D3QA 3OZXA 3A4LA 3CO5A 5EXTA 2OBMA 4DSUA 1COWA 2VHUA 2O8DA 1ZCAA 3AP1A 1E99A 1KSGA 1OXUA 5FPYA 1UDWA 4EPRA 5CDFE 1GKIA 3K0SA 4IW3B 1O87A 2ASEA 3W3AA 2AXNA 3C4JA 2GJKA 3QXJA 2XAUA 2GJ9A 2ZE7A 4TMTA 2WJHA 4C3ZA 3NBYC 1F5NA 3W5JA 3ICQB 3T34A 2O8CA 5B30A 1UEIA 5JJIA 1DTSA 4LHZA 1JAIA 2AR7A 3AKEA 4OQNA 4XSGA 1OHHA 2RMKA 5JWOA 1SKQA 4TLCA 1E4YA 4TMVA 3LWNA 1CR4A 5J4VA 3ICEA 1UKVY 3EWAA 4RFSA 4JLAA 4FD2A 4KLZA 3U3KA 3M0EA 4PC2A 1W4AA 3UG6A 2ZRIA 2XTZA 1M7HA 2F3RA 3VU9B 4D80A 4DKXA 2G0NA 2NO0A 3CH5A 1FOEB 3UMRA 3RS4A 1KOFA 1HE1C 5JECA 2RGAA 3JZMA 3K9GA 1KK1A 4XJXA 2ZRMA 3WRYC 4TZ0A 2G77B 1P2VA 3FGNA 4RFSB 2VP5A 2CEAA 4JMPA 1R0XA 2IHBA 4QL3A 3CB4A 3FHTA 2PZEA 4C30A 2XB2A 1OKKA 2JJ2D 4QG7A 1QG4A 4WA7A 5C4GB 1UEJA 3Q85A 1OYYA 4KAXA 2OV2A 1S3SA 2GCOB 5FBQB 4DC9A 3FKQA 4GDFA 1MKYA 3ZJYA 2OEPA 2W58A 2J0UA 3B1XA 4PPGA 4C9BA 4ZCLA 1HEIA 3QKRA 1T8UA 2E9SA 3VQTA 4D2IA 1ODFA 2RGXA 3EW9A 3L0OA 4TWZA 2BJVA 4IXNA 2CL6X 1N6RA 5A5GA 1X8LA 1XMVA 3FMIA 1ZNYA 2ZS9A 3HP1A 4DIDA 5LD2C 1GM5A 1BMFD 3LLMA 5ANRB 2ZJBA 5JWRA 3V00A 3FOZA 4IDNA 3QKUA 3U5ZB 3B8HA 1OW3B 1XU4A 1S9HA 2QROA 5FTJA 4BLRA 2GBLA 1GUAA 3DZDA 2IXEA 1Z0JA 3QF4A 3VNUA 2H18A 4TMZA 2F1IA 1VECA 4PO1A 3RABA 5JJKA 1X86B 4IVRA 1JBKA 4B43A 3WNBA 3VR4A 2JJ2A 3QXHA 3W8NA 4FINA 3PVSA 3UWKA 2V7QD 2ZR7A 3EG5A 4YMWA 3CRMA 2X77A 3QF4B 2IK8A 3TMKA 1JQLB 1CR2A 2QT0A 4PC6A 2HEIA 2XJ4A 3AKCA 2OFOA 3SNHA 1VTKA 1XTIA 4MYCA 4NKRA 1XF9A 3CWQA 4NYMR 1IN7A 4B6FA 4OQXA 1X1SA 3ZLJA 1JQJC 4RY2A 1HURA 1QHNA 1BMFA 1LW7A 4GOKA 4XWOA 2R2AA 3O47A 3BH0A 4W5WA 1YE8A 5KNBA 4JJZA 5H1YA 2GNOA 4C7OA 3FVQA 1H8ED 3SI7A 1FQKA 3FFBA 1XXHE 2H17A 1IN4A 4CT5A 4XVRA 1GNPA 2ZRBA 1HA3A 4HDOB 1N0WA 4P4UA 4C2TA 2V7QA 1XTRA 1DO2A 1S96A 3SBDA 4R7ZA 2GJ8A 2A5YB 4NP6A 2FGJA 3AGQA 1DVRA 4UXJA 3T5GA 1AZSC 4F4CA 4U02A 2PMDA 3QY0A 4HB0A 4P33A 1AS2A 2ZI7A 4QRHA 4AC9A 1KSFX 3CBQA 1W36D 1S1CA 4CRWB 3T35A 4KVGA 2IC5A 2Q3FA 1CRPA 5CK5A 4OQLA 4XD7D 2IEZA 3CNNA 4M8NE 4L4UA 1LF0A 2ERXA 2Q9AA 3CNLA 2X2FA 5SZJA 4XOIA 4BFUA 4CEJA 1MO6A 5L3QB 2AX4A 4ASUD 2O0JA 3VHLB 2XGJA 4DSTA 2SHKA 4RD6A 5GJCA 2FFQA 1NL3A 5TY0A 2QE7D 1JNYA 4GZLA 3TE6A 2EVWX 5TMPA 3B85A 4B44A 4ESVA 4TT3D 621PA 2IS2A 3JVUA 3KTAA 4CEJB 4Q21A 1UPTA 2IS1A 4URWR 2EYQA 3T12A 1GDDA 4Z1MA 3IGFA 3WYFA 1ZM2A 3D8BA 4IXMA 1K5DA 2CK3D 3R8FA 4ZDKA 4UJ5A 1KTVA 1RJ9A 1MV5A 1FUUA 2YWGA 2XX3A 3CPEA 4B48A 5SZIA 2QEQA 3MGCA 2VRWA 3U3RA 1G19A 4GOJA 4JVLA 3CW2A 3AEZA 5KYKA 3PIRA 1WP9A 1N6LA 3GLFE 3QG1A 5LB4A 2OAQ1 2ZETA 1MR3F 4MKFA 2IX3A 2QG6A 1UBEA 1ZRHA 1X6VA 3J81k 3EARA 3SS8A 4DLRA 3TR5A 1DOAA 1N6PA 4OI2A 3HPQA 2VEDA 1X3SA 3CH4B 4OK6A 3TR0A 1RRFA 1VKJA 3TH5A 4B3BA 5L3SA 1R0WA 5EUQB 2D06A 1D5CA 3MSXA 1FQJA 4Q1CA 4EJSC 3U44A 3H86A 4CEHA 1NSTA 3H84A 4UNQA 4HLQB 1I4LD 1CJKC 5FOSA 1XEWX 4B76A 2CK3A 4A6XA 3TK1A 4B35A 2OESA 4TTQA 2BMDA 1NVVQ 4B2IA 4Q1FA 1T8TA 3TSOA 1QVAA 4B3FX 2HJGA 3DVLA 4WZ6A 2A5FA 2ZUBA 4E22A 4BLTA 3ADBA 4Q03A 1YR7A 1KJWA 4LV5B 2W83A 2FPLA 5CLQA 4CVNA 2IXGA 4UXHA 2AHOA 4GL2A 5FUXA 2FSIA 2L0XA 2EQBA 1E0AA 1G3RA 2GKSA 2XTNA 3H4MA 4M1OA 4H1UA 4Q4HA 2RB4A 3BRWD 3CRVA 5DI3A 2YOGA 1KYIA 3OIVA 3LVQE 5CJPA 1GITA 1A1VA 4QHSA 3SFVA 1PUJA 5AJXA 4FWIB 4MKIA 2PL3A 4QNRA 1U98A 1RPZA 3C15C 5DI3B 2EYUA 4B75A 5J40A 5FPTA 1GILA 1MT0A 1A7JA 4W5HA 4HDCA 3WRXC 3AVXA 3C41J 2LKDA 1NF3A 1A2KC 1M7BA 3CONA 2NZ8A 2VIIA 4HZIA 1E94E 1RZ3A 2R44A 4PFSA 2VP2A 2WICA 3RWOA 2C96A 1BO6A 5SZHB 3EZ9A 2ONJA 1ZP6A 5FBVB 2IL1A 2F3TA 3GFTA 5CM8B 1W44A 5CDFA 4CEIA 2E87A 3RS0A 4TLEA 4JKIA 3MWKA 3B60A 4KVAA 4C2UA 4DEYA 5FUWA 2ZTSA 3I8XA 3M6AA 4G5SA 4FCVA 4DCTA 4DLWA 3MCAA 3QVUA 3R20A 4E07A 5DNYB 1PVOA 1GNRA 4CEIB 2CLSA 3I32A 5FTKA 5C46F 4TL7A 1QDEA 4LCBA 2VP0A 1X8KA 2I4IA 4C4PA 2CXXA 2BMFA 3QNUA 1FTNA 4BFWA 4DXAA 2A5GA 1RRCA 2ZITA 5AJYA 2J0SA 2CCGA 2WAYA 3U7HB 4ZI2A 3RS2A 1KO5A 3CF6R 1LTQA 1OYWA 3RRZA 3UWOA 2NO9A 5FI0B 5IF9A 2PLFA 2ZRHA 3QG5A 1L4UA 1BKDR 1NVWQ 4LDJA 5LBIA 2O8BB 2BBTA 3KKOA 1G17A 1KO1A 3AGPA 1XPOA 1GOTA 2HT6A 1GP2A 5BXQC 2H7VA 2KJQA 1D2EA 5EQTA 4ZIRA 2WWGA 3ZVLA 3GLGA 4PHFA 4PC7A 1XD9A 3IPYA 3BOSA 1N3BA 1L7VC 1K5GA 5IK2D 3K0AA 2HV8A 1H65A 2PJZA 4BLQA 3THWB 2QPTA 3NEJA 1Z3IX 3BC1A 2QAJA 4PSAA 3OAAD 4ZIRB 1D9XA 1MRNA 3GP8A 2FFBA 2FZLA 2ZI9A 4QGAA 3GLGB 1XMJA 4KFRA 3H0KA 3HDTA 3PUWA 3L8YA 1KAOA 2C99A 4LV8B 2ZYTX 4QOSA 4M1WA 4LYAA 1X8JA 4IHQA 2WJVA 3HYRA 5HPYB 1GL9B 1GL6A 4Q18A 4AKGA 4OBEA 4B73A 1U8YA 2RGEA 4FCTA 4TQ9A 1AQUA 2J87A 2VF7A 3MWYW 2DWOA 5TB5A 3RYTC 3UG7A 4BECA 2ZRGA 3CX7A 1BYUA 3B7GA 2WPDD 2FPMA 4NCHA 4WAUA 3X1DA 2W6JD 2BM1A 3SJAA 4D81A 3CWZA 4AKEA 3AUXA 1J70A 3MJRA 2JIZD 3AUYA 2J7PA 1XJ0A 1DEKA 2C03A 3IQWA 4H9GA 4P31A 1EG7A 2A5JA 4MQBA 1T3LA 5IK2A 4US1R 2W00A 4DIEA 3KJEA 2QM8A 2OBNA 4FI3C 4QGGA 3RAPR 2P3SA 4TYQA 5KPDA 1J90A 1U8ZA 2YHSA 3D7MA 3OAAA 4B34A 1W7AA 1E2JA 3QOFA 4LHVA 3AVWA 4OI4A 1JEDA 3IHLA 4LPKA 2A5DA 4M9SA 1VCMA 1Z6XA 4BRWA 3BB3A 1XXHA 2WKQA 3LH5A 5HCIA 4TSFD 1FL9A 5IRCD 4QHTA 4EFNA 2ORVA 1OH8A 2WIAA 4LV6A 4LYJA 2OHFA 1B0UA 4M4SA 4L8GA 1I4TD 1XCMA 1AS3A 1WB9A 2WPDA 2HCBA 2ZRAA 4IEEA 4LJ8A 3RSLA 4EPYA 1TX4B 2B21A 1T6NA 1NVXQ 3L2OB 2JIZA 4OJQA 3U7GA 3T1QA 2BM0A 2FN4A 5CM9C 4DT1A 3CR7A 4LJAA 3NBFA 1T5IA 3E1SA 4Q9LA 3Q7QA 5FBWB 2G83A 1Q12A 3KQLA 2G6BA 4JS0A 5FR2A 4JLBA 5HTKA 1P9RA 1D2MA 3K9NA 2C2HA 3OF5A 4EPXA 1XX6A 1IHUA 1JAHA 3C5HA 3M4YA 3VKWA 3B13B 4LBYA 3KDSE 3GJ0A 1ELOA 4TSFA 2JLXA 2ZSBA 4LJ4A 2KWIA 4GPTA 5BW8A 3X2SA 4FMCF 4A2PA 1KI6A 5FPSA 3GCGA 2IWHA 4HUTA 5AUNB 2FSHA 2BMEA 1R6BX 1C9KA 2D7DA 1BYIA 1II9A 5KNDA 1AJEA 1GRRA 3CF0A 2Z5FA 2QZ4A 4G0NA 3CPHA 4IVQA 3VKGA 4ACBA 1EWQA 1ZD1A 3EPKA 1SGWA 5HKKD 3IHWA 4RZUA 2IS6A 1CR0A 1KMHA 2J1LA 1IJFA 1II8A 4HZUA 4ZO4A 5IDVA 1SXJC 1SZPA 5GJVC 2YYZA 1HTWA 2VP4A 3K8YA 3GLFA 2GZHA 4M9QA 1IY0A 3K0EA 2B8WA 1R7RA 4A36A 4BQSA 5EXPA 3AF1A 1R5OA 2GXUA 3OE7D 1G8YA 2R8RA 3RNLA 2BV3A 4WBSA 3UKDA 3SBEA 1AZTA 3RRYA 1N0VC 1VCOA 2OSBA 2V1XA 4JYCA 1VG1A 2EWVA 4MGYR 4LBVA 4Q47A 2ATXA 4NL4H 1OIWA 2GA8A 4RZXA 3N5CA 4HLUC 4RVCA 2YKGA 3REGA 5FUYA 4BFSA 1OLOA 3IIJA 3ND8A 4BFXA 1MOZA 3THXA 3AVQA 2D4HA 5JSZA 1XPRA 2A3RA 2G9NA 3NWJA 5DYGA 2EFHB 4US2R 5E7JA 4C0KA 3HU3A 4PC3A 1R0YA 1R8SA 5HKKA 1NMXA 3B6EA 1BS1A 2NQ2C 1D8TA 3THXB 5BN5A 2ZUCA 2AL7A 1E2MA 3K0CC 4ZI3A 2W2VA 1EX7A 1G16A 2ZRCA 4RD2A 2GHIA 3CKLA 3OE7A 3PUVA 4B3CA 2I1VB 2V9PA 4NYMQ 4TL8A 4YDHB 3LD9A 3PXGA 2UVQA 2ZS8A 3GEIA 4KFUA 1F2TA 4B6EA 1TF7A 2HLDD 5LB2A 1G5RA 3A1SA 1Z6TA 2CLCX 2NGRA 1XCPA 4X8OA 2JCSA 3CZQA 1TUIA 1UBGA 1G3UA 4I4LA 2GETA 1CEEA 1E69A 2NTYC 1BIFA 3OEHD 3KKPA 1PUIA 3IO3A 2CVHA 1L4YA 1SVSA 3LW7A 4QBIA 2QGZA 1Y63A 1T3SA 4NYIR 2PH1A 4MKHA 3WBJA 5KSOA 1KI9A 1V43A 4D4JA 4TMKA 1NP6A 1Z8FA 1E2QA 1L8QA 4PC1A 3UXMA 5KSYA 2RGDA 3U4QB 1Z6AA 4Z8YA 5JHHB 2BIFA 3P32A 1N25A 3P4XA 3KKNA 4D4MA 1I4DD 2D2FA 1IY1A 5KO2A 4DSOA 1KK2A 1Z06A 3A8TA 3P20A 2DFLA 1IBRA 3C8UA 4CT4B 4EPVA 2GESA 1C4OA 3V4RA 2FNAA 1P61B 1XJCA 2ECKA 3MLEA 4JBYA 5CYOA 4F93B 1IQPA 2NG1A 3ZS9A 5JS7A 2QP4A 2IXFA 1Q1QA 5CK4A 2ZM5A 2AD1A 2GDJA 5J4HA 1P9WA 1OFUX 2ANBA 1WCV1 3OEHA 3GFOA 2D7CA 5A4JA 1NN5A 2ZQ5A 4PZZA 4WVFA 2WMNB 4JT2A 1G8FA 1CBUA 3I92A 2BBWA 2J0VA 2QP9X 4BFYA 3K70C 3A6PC 2VLIA 4LY6A 2O8FA 2DBYA 1VHLA 5SZKB 3DEFA 2NO6A 2ODEA 3GJ7A
chains in the Genus database with same CATH superfamily
1NJ2A 1GUZA 3F8WA 5I45A 1WEHA 1A95A 3OE1A 4LSZA 3AFOA 4BLVA 5DF1A 4HDMB 4QXMA 4X1YA 2PUJA 2YIMA 2WOOA 4GE3A 1KP9A 2AG5A 5J5VA 1T6YA 3VKUA 2FWBA 3C7CB 1OAOC 1GN9A 1N2EA 2B20A 2NLOA 5CLFA 5CXXA 2ZBRA 2DFKB 1DG3A 1UPAA 2AN3A 2HRCA 3CYFA 3DNMA 3UANA 1CE8B 3DFIA 3CN9A 5THKA 5K0TA 4ZVVA 4I8DA 3ZYZA 3NWOA 5A05A 3D7NA 1H2EA 5CVEA 4GOLD 1ZM3A 4MCJA 1U94A 1W19A 1UFOA 4Y18A 2EF0A 1K7YA 2CJYA 2JIQA 3LYAA 1WPGA 1ZXXA 4G4GA 5KYTA 4R6XA 4B87A 5L3ZA 4R68A 3TLCA 4CKXA 4PLVA 4HMOA 1QPBA 2IDJA 4JBNA 4NHEA 3SZRA 2ST1A 5KMGA 3MWLA 1UC8A 2H0QA 2OZVA 4HN4B 3ASYA 4U2CA 5DBEX 2GUWA 2M32A 4Y98A 2ZIXB 5K3BA 3TKYA 2C7QA 4D6YA 1HLFA 1JU9A 5IYZF 2YDYA 4CN8A 4N39A 5JHGB 4NBRA 1XWFA 1PCXA 4PYNA 4PX3A 2P4HX 4XIIA 1BX1A 5TF0A 3TPFA 1MORA 1OB2A 2VCEA 1EUZA 1KR2A 4YT5A 1Q15A 4GQIA 2JK0A 1H6BA 3H19A 3HHEA 4AXXA 3TLBA 4O4HA 1XJQA 3GH3A 4U00A 2QVZX 1K0FA 3EDQA 1JDSA 1DX6A 4DLXA 3OOSA 1R8QA 3VBCA 3QENA 4KITB 2G71A 1W1IA 4CQMB 3SEQA 1XGKA 2JVIA 2RGRA 5ALIA 1VBMA 5EGNA 4FMDF 1C1DA 4O3MA 3NALA 1P7YA 2FETA 3ESQA 2BZGA 4HWSA 3F9IA 3KXLA 3WLJA 4PR0A 3E0XA 3BHMA 3LP5A 5CBPA 2RCNA 3ZBTA 3IVRA 2IXTA 3KJZA 3BCHA 1EDEA 3L0PA 1XWIA 4QDUA 5JH7B 2Y1WA 3PRYA 5BPFA 3LSTA 4HVTA 3FCEA 4DLLA 1HDZA 3ONFA 4BEJA 1UFQA 3OPXA 1OI4A 4MPDA 3WB2A 3IKTA 5EMLA 4KOAA 3TZEA 5DHUA 1E1KA 2XKAA 3NAZA 4POAA 3EQ7A 1S7GA 1XZMA 2BAGA 4OXXA 2BGRA 4H7FA 5ICGA 4RJLA 3Q2IA 4L5IA 4QICA 2Q6TA 3NTRA 4NONA 2MSNA 5HGJA 4O1HA 3OTGA 5IKPA 2NACA 3TRJA 1WJGA 1Z2NX 5HJ5A 1LSSA 4B45A 3HL0A 3UJDA 1SVKA 5J2TF 2ZANA 4Q02A 4BFTA 4P54A 4H1VA 4W1QA 3SS9X 3JPYA 3MB5A 1S01A 4R2WA 2XUPA 2QZPA 4LGVA 1E2KA 2OAGA 1A8IA 2VJMA 3KYCA 1H85A 4OGLA 1W5BA 3H97A 1QF9A 3GRFA 4ME6A 2OCPA 4BUZA 1QK3A 4YMGA 1G6HA 4QLOA 2IHTA 5CNKA 1ZZGA 5AM3A 3CBGA 1UBHS 3RS9A 4G67A 4ZVSA 4H59A 1FLNA 3JARB 4PONA 4K3VA 1RI5A 1WE2A 4U7JA 2LV8A 3D4BA 2NU8A 5JFGA 2I6TA 2X76A 2N1BA 1Y8QB 1KIMA 2B9EA 4BQPA 1ETHA 4QUBA 2AKAB 1YQUA 2ERCA 2I34A 3LC0A 2TECE 4M1QA 4Q3NA 4ZO7A 3L9XA 4WBNA 2NTJA 3L82B 1OFIA 4Y9TA 2C9ZA 2VCHA 3H5LA 5DHTA 4BEWA 3TB4A 2BFFB 2QRMA 4HEA1 4EZIA 5CDYA 2PX3A 3I12A 4AZSA 3KT8A 2P9BA 2CYBA 4H60A 4PE5B 5EA2A 2HA2A 2GHQA 4JX8A 5EY5B 4BRSA 1KWGA 5GGXA 4R41A 5B1SA 1YZNA 3JVDA 2P9HA 2YWDA 5IWAB 4DR4B 1OXMA 1GKLA 1CZUA 1PK8A 3UK6A 3P5BA 5E3HA 3B82A 1QG2A 4E7PA 1Y6GA 5L3VA 1U0EA 1W49A 3AG6A 4LF5B 1O95D 2NO7A 1F9AA 1WPRA 2PZFA 2QNIA 2VSOA 4LWOA 1YFJA 3NIDB 5LKAA 1DAHA 1B16A 1K1EA 3LVBA 4YK7A 3IFSA 5FOUA 3QELB 4JZKA 1GLGA 4EA7A 3KJNA 5EL0A 1YQGA 3FHCB 2YZKA 3OWHA 4Q19A 1UXGA 4II3A 3UQZA 4TZ6A 1L7PA 3N86A 1U0GA 5C52B 3SHQA 3A6EA 1EMDA 4KCGA 4CM4B 4DR1B 2AB0A 4PSCA 3IODA 3EF0A 2NU6A 4I6GA 1Y1TA 5DM0A 3BWMA 4EJ0A 4PHHA 1PDVA 1ECBA 4IIHA 1P8JA 1VRWA 3HKCB 5CRIA 4NAUA 5G0WA 2QVBA 2JIRA 3ME5A 5K7SA 3B89A 3QKSA 4YAFA 4YP5A 4PG7A 5GZ1A 5KYUB 1GG9A 2B5OA 1GVHA 1WQ3A 2BVNA 4OGFA 2GZDA 5JRDS 1VRVA 1PNVA 3IKLA 1JA1A 2PL1A 4UBKA 3I34X 3JQAD 3PHHA 2ZREA 2F1JA 2PX6A 2FPIA 2G88A 3HMKA 2Z6VA 2CHQA 4Q93A 2VKQA 4YP9A 1CFJA 1WV1A 4MQEA 3QVOA 3D6NB 3IUPA 4MUXA 5EKDA 3UMBA 4L6IA 1Z6QA 4D9EA 5FUMA 4PYJA 1RI3A 1FX0B 3U4DA 1ENZA 2VF5X 1R8YA 4NSNA 5AI5A 4M9ZA 3FUWA 3RUDA 3GBVA 2I4TA 2FZ4A 4OI1A 1Q17A 2ZXUA 4REQB 3VUFA 1OJLA 3OA2A 3OZVA 4KGXA 3PF8A 2VH1A 4HH0A 3LFTA 4TRMA 1Q0ZA 1AS0A 3ZCRA 1YAJA 2JHPA 1ZOIA 3WK4A 2I67A 1DAFA 1G0NA 5CLIA 1YR9A 4GAEA 4KBGA 4MEAA 3SLKA 2FLVA 3NTQA 2MSEB 3L4EA 4F3YA 3S1AB 5LQMA 4OF4A 3ZCQA 1TF2A 2M9MA 3BDVA 4O4JB 3AETA 3DEZA 1VP3A 3T5TA 4EB6A 1THGA 2QLBA 1TA4A 2CDRA 3FA2A 4EMBA 5D7NA 1US8B 1WCIB 1Z35A 2I6GA 3O0TA 4J0GA 4J4BA 2B69A 4DZZA 3PR1A 4P5EA 4NARA 1XRSB 2WT4A 2A9FA 3ETCA 3IMFA 3IP5A 3PTLA 3K9LA 3OJLA 3F3MA 4K05A 5K4HA 1QGAA 1FSGA 3TYXA 3WLLA 5ARBA 4QYXA 1JEQA 2Z4SA 3HJUA 1F06A 2IHJA 4Q12A 1E6LA 1KXZA 3E5RA 1RYMA 3KALA 2ENUA 4CM5A 1N36B 1A3CA 3PUYA 2EJVA 1UBMS 1YB6A 2V0CA 3MRSA 3QU7A 4RVGA 1GAJA 4BBZA 1CP3A 1HYGA 4J16A 1P1FA 1XV5A 4DW8A 2C0CA 2Q1SA 1DQRA 2GPBA 5I6DA 3PSHA 4JLMA 2H1HA 2GBLC 2IZ5A 5HSGA 3EC7A 4MHOA 5ALNA 4ZZIA 4XQCA 3A6JA 2VHXA 2H0AA 2B6HA 1OROA 3ITKA 4EW2A 3MMZA 2WKSA 2WOJA 3AU9A 4YYZA 3V8PA 2J09A 2RBEA 4MCAA 3TZQA 1RHQA 3V33A 2F2TA 3A6GA 1NIPA 1YQ9A 3AERB 3IT1A 2A1TR 2YJ6A 4G85A 5K0SA 1RDFA 4L72A 1GO2A 1NBEA 1TKCA 2GF9A 4PVCA 5ICFA 3DT6A 5FAXA 1BS2A 1RZRA 1XDDA 4UE3S 5F5LA 4JA2A 1JIIA 4URVR 4AJPA 4H77A 5I5GA 1EFLA 5JLJA 3FUXA 1HT1E 3HZOA 1KEWA 4LGYA 2I80A 4RQUA 2R79A 4NS4A 1QK4A 3OOYA 4JJ7A 2A9OA 3U40A 3FTQA 3MCWA 3RRMA 3WXMA 1M34A 4V0OA 2ANCA 4D8VA 2IYPA 5JNLA 1OIXA 2ID8A 4KZKA 1EUDB 3OQNA 521PA 1RAIA 3B9QA 4YR7A 1NQAO 2WB4A 4JEMA 5EP2A 2QRUA 1P0FA 1QV7A 3B6KA 2PZGA 2C2YA 1XDSA 4XYMA 4H27A 1EK6A 1DKLA 1EHCA 1TUGA 1JXOA 2LIPA 2G5GX 3HI6A 2XMBA 1YZTA 1Z4PX 4FEYA 1CNMA 2PVSA 1Y1QA 1CJBA 1J09A 3EEFA 3ETNA 3RFUA 3TUZC 5A7HA 3MQ2A 1NXQA 3QBEA 2CE7A 2CUKA 2BGWA 1Q92A 4LYFA 4H0NA 4X41A 4ZKEA 3VOSA 4UFPA 4ZK6A 2P8JA 4FKMA 5JIBA 2NMVA 4YP7A 2JIBA 1EZ1A 4IIDA 4KQEA 2YWFA 1BXZA 1VJGA 4ICIA 4C29A 2GAJA 3FXAA 2JLVA 1KDRA 2WU3A 2OUKA 3ZVNA 5CB4F 1FX1A 1B00A 1R0SA 1XVIA 2H2FA 3DDCA 5F33A 3O74A 3VGJA 4KQ6A 1J49A 3GJTA 3LL4A 4MDHA 4RK0A 3B1KA 3RG2A 3LUDA 3T61A 3WQRA 5JC1A 1ZHHA 1Z18A 1C7IA 1U9JA 2F1HA 3PYMA 5GV7A 2GFIA 4ZT3A 1U2GA 1U04A 2PZ8A 2ZGVA 3A4IA 3H1TA 1IBKB 1ZHOA 1T0JB 3O95A 5ALTA 2PUCA 2PBZA 1XQWA 1M67A 3GUZA 4Q00A 3ZDDA 1YI8A 1CUXA 5EJ2A 3G5MA 5C18A 2J31A 4WKGA 2UYQA 2EGUA 3KC2A 2E4ZA 4RK4A 4BLOA 5GOTA 4ENSA 2FK8A 2DQSA 3AV3A 2ZIAA 1LNQA 1RXSA 3P9YA 1TCUA 4JELA 2PH7A 4MYUA 1ABBA 1C7JA 1D03A 1EM8B 1SWWA 2ZRQA 1TFUA 2GPWA 3DE2X 4BGVA 4YCCA 1A4UA 4CG1A 1RWPA 5AUPB 1CUHA 3H99A 4EJMA 2XDWA 4X66B 3II6X 2DGDA 4KQWA 2WZQA 5B37A 4TTIA 3VNBA 5C51B 2QVCA 3PQ8A 1S8NA 3G5AA 4F84A 1XZLA 2OO5A 1FP7A 3PNPA 2ONCA 1P0CA 1BVRA 2VKTA 2ZOSA 2E21A 1W36C 2WAXA 3STTA 3ICOA 1N6OA 1GLVA 3LT5A 1YHZA 4TQUS 5FI3A 3VTKA 3OZ7A 2UUBB 4O4LF 3QE3A 1CVIA 1RRMA 5BSRA 1PUXA 1V3UA 1VSTA 1X7GA 1YB4A 3F67A 1JHUA 3ILSA 3L7CA 4TN1A 4UQOA 1YJCA 4WUTA 4NYIQ 4B8WA 2G07A 4LDAA 3GD7A 4BVFA 4P82A 5K2OA 4HAOA 4GVPA 4LYGA 4MICA 5EWMA 2DC1A 1CK4A 3KHUA 3THWA 3A9RA 2ECFA 4OHFA 1NVUQ 3JASA 1Z2AA 3FYDA 3FYTA 3LXUX 3DCYA 4A0RA 1ZIDA 5J2UA 5GOZA 3WYCA 1TQ4A 1Z5VA 1ZD9A 4DV6B 4IHJF 3WP0A 1G59A 3GYGA 4OYLA 5HQ3B 2WYHA 3VPAA 1T9GS 3BH7A 8ATCA 1P73A 1USGA 2JIPA 4OLJA 4KBFA 1PJRA 3DBIA 1PWXA 2XMCA 4XCXA 2XT6A 2AG0A 1W4RA 1QFSA 2XZTA 3FROA 3N76A 3B12A 4MAAA 4P35A 1G42A 4KZPA 4UZFA 3T5DA 2YWEA 2VUSA 5K1ZA 1XN1A 2VXOA 4RQTA 3MFQA 3SJUA 1GPAA 2ONYA 4EP1A 4Z5XA 4GR5A 1OXBB 4XB6B 3DT8A 4RL4A 1MUUA 4WZAE 3WDMA 4E5VA 2EFGA 4KR2A 1X74A 1PWYE 2VHVA 3ELBA 2B7LA 4QQNA 4F46A 1U6KA 3A25A 3ICPA 5IZCC 2X15A 4KR7A 1NW6A 3CA8A 4MRMA 1XN4A 4RCZA 1XEXA 4Q4AB 5K01A 3HXQA 4QYIA 3RJ9A 3RFXA 2GMWA 2GN0A 3I4CA 1MX3A 1FFDA 2EFCB 4D4GA 1E5VA 1XB2A 4XD2A 2VWQA 1FLDA 1KK3A 3B3AA 3NM4A 5F12A 3INYA 4IIJF 4F4IA 2PXHA 3H9CA 4MQ4A 1IOZA 4IWNA 1IQ0A 2NO4A 1E9RA 5C3UA 4IEIA 2R8ZA 3CEJA 1ZVQA 5ABPA 4EECA 3PVZA 1RYDA 1TDJA 4HYEA 3ILVA 4HJXA 3QI2A 1L5WA 3DS8A 5LMZA 2OMEA 3D6JA 1N3YA 5AO9A 3V1KA 1XTJA 5KVVA 1GFWA 1FB5A 2J5BA 3EDRA 2E5WA 4MO2A 1ZLXA 2B4QA 4JSTA 4KPGA 2YJ3A 4IH1A 4KNVA 1PEKE 2ODBA 3CURA 4KMMA 5DGCA 2H2IA 4U3JB 5HVNA 1ZBDA 5GP1A 3LQ2A 4HGQA 3EZYA 4TS4A 1W5AA 5U4XA 3RK0A 1C5KA 4GI3A 1PWHA 4IDHA 3VVMA 2J9FB 2VHJA 3RAFC 1MB0A 2Q41A 4JUCA 3E2IA 1A82A 3FCSB 3A3PA 3Q9LA 5HM8A 2V3CC 2Z30A 1ZIOA 2CHGA 1VLHA 3G2JA 4GVLA 4V24A 2L19A 4YGYA 1W581 2XB6A 4L5YA 5U9CA 2WFLA 2NVOA 2O14A 5DU2A 4BMYA 1KTIA 1LSJA 4D42A 2Y27A 3HNRA 4XTRA 4NMLA 2DFTA 4NCAA 2JJMA 1E9EA 1E1RA 3GRCA 1YZKA 2C4KA 1AKQA 4WADA 3EOAI 3QA9A 3ZR4B 1IL0A 4BJ3A 5H4GA 3G7UA 4RPIA 1KI2A 1H2XA 1XJWA 5FBLB 2IPNA 3RVLA 3VYUB 1KJJA 1N2BA 2BLNA 4MR8B 3UJAA 2PIAA 3P0HA 5I9IA 3I6MA 4ZOQI 1Z0FA 2GD0A 1JH9A 3RUAA 3EVEA 3BGOS 1Q50A 4G5GA 4YI3A 1P80A 4FI3F 4GE0A 5DWDA 4G37A 1MX1A 3RRFA 4M55A 3K0FB 2HU2A 3TO5A 1WB4A 3F3KA 2FHSA 5EUCA 4ZT7A 3SAJA 1GU7A 1UBRS 4DA6A 5JXWA 2AR9A 4CKBB 5H3CA 4UXIA 1YZ3A 3GZNA 2VYND 2COKA 4JWTA 1Y1LA 2O4CA 4ECEA 4QPNA 2VPPA 1XNHA 2ZWIA 1IEWA 3RT1A 3RW9A 5F1OA 1AQYA 1P7ZA 4N0MA 1YDEA 4EJ2A 3RU7A 1Y0BA 3GU3A 1CIPA 1JF8A 1NBMD 3O82A 4LYEA 4MI6A 3O75A 1SR8A 2XWBF 4WWHA 1NJGA 4PIPA 3RF7A 5K3OA 2CKDA 2X4IA 2Z1DA 3DZIA 2G7MC 3CRQA 4URXR 4LUCA 2R47A 2OE2A 3E1GA 3W5UA 2O2DA 4DWWA 2RGNC 2CJWB 1Q7BA 2O48X 4DG9A 2YUTA 1B8UA 1TVEA 2IWRA 2ACVA 4LECA 2JHFA 1MLDA 1OXTA 3WSWA 4DUGA 1PK9A 3E1KA 3JD2A 3R0QA 4AS2A 1TJPB 3AEKB 1ADBA 2O7VA 2PKQP 5KJFA 3EZGA 2VSYA 3M4JA 3TGWA 3T15A 1LLUA 5KS2A 3WXBA 2C7GA 5CXQA 4M53A 1FPQA 4PO8A 1Z29A 4BTLA 3IEKA 1XZAA 4I4IA 4Q4JB 5CCXA 3E0QA 3O1LA 4YQEA 3U3ZA 1PGJA 3KG2A 4REMA 5TQVA 4H4DA 5AHWA 2DE0X 1P39A 4M0CA 3JAKA 3OQIB 2XRFA 4MPTA 3TQHA 3WL8A 1BWSA 4HEJA 1V8BA 1P0PA 4QGHA 2R6DA 4L15A 1XTBA 4BKRA 3VSBA 1U1GA 3GRZA 3O9VA 3ORSA 4DF3A 3GEHA 4F06A 5JJLA 1HBJA 3E2PA 4M0FA 1OUMA 3O8OA 2YV3A 3QYAA 3TAHA 3IJEB 4B2LA 4LF8B 2BGIA 3DZJA 3JQGB 1P72A 1T8SA 1JTEA 3PDIB 5G53C 1KJQA 3ZTYA 1V3VA 2JBAA 2R48A 1D6SA 2F1KA 3N0XA 4XASA 5IW8A 5CEEA 4BE7B 2H3HA 5IT4A 1XT6A 4JJ8A 1MW9X 1UFRA 4U2EA 5BW5A 2GCPA 3PFKA 1DKUA 3LKDA 6AT1A 2QAIA 5CNIA 3U4QA 5K45A 1QRTA 3BDAA 3CLTC 4BMSA 2YQ5A 3TTXA 3HFRA 1QHGA 1XR3A 5EMHA 1B8PA 1A50B 1ORVA 4MVJP 3EC1A 1R0CA 4N5NA 1O4VA 1R4MB 3O3NB 4W99A 5BOSA 2QD5A 3GB9A 4JLJA 1XK7A 3NRJA 4HNUA 1SJ9A 3FI0A 4KIJA 5CFPA 5IEBA 3BG5A 1ZUNB 2GEDA 2JGLA 2PS1A 2V9CA 3V8EA 2Z56A 4PNHA 1V8ZA 1KPIA 2FCRA 3IAS6 4GPD1 1NI5A 2GN1A 4N5MA 1ZIYA 3DV0A 5JW6A 2JPDA 1G2PA 2VRCD 4RLQA 4OAOA 1H4SA 4UD2A 3RANA 1DCMA 1TD9A 3A1NA 1LXCA 3F98A 2C5LA 1CRQA 2Q27A 5JV5A 1H4VB 4XYEA 4P92A 1USVA 1AA9A 3P9SA 3TRIA 1DIAA 2A1UA 2XZDA 2AG1A 3AG5A 1GD1O 2E7ZA 4L75A 4QXQA 4R3WA 4YJFA 4L4ZA 1ADCA 3PKJA 4I6EA 2Z8XA 2JRLA 4FYVA 5TPZD 4DRYA 5JTUA 5JBIA 4DMUB 4O8ZA 4TZTA 1CUFA 3C5CA 3HZZA 5T4FA 2C4MA 1P81A 4IVPA 4YEDA 1Y89A 3DP9A 4QEKA 4OLHA 4ZAFA 1RCUA 4QUAA 2DLNA 2FWPA 3OEYA 1P4HA 1NU6A 1SFRA 3DO8A 3N0WA 3QZUA 3UXEA 3WGMA 1I0ZA 1VQ1A 1ZK2A 3EASA 3M1IA 3QYJA 4R1OA 1DELA 1G1MA 3IEPA 4D9KA 1HFJA 1GGJA 1RM4A 1W52X 2JNWA 5JCJD 5KNCH 1NLZA 1NE2A 3HCOA 1X80B 3V1LA 4X20A 1QIMA 1FQOA 3BL6A 5TS3A 3WYAA 4HI0E 3G8DA 2XVMA 1FXWA 5EKSA 2NQTA 4IOLA 1WPXA 3I62A 1E1QA 3CWCA 2P2ZA 2WJYA 5F52A 5TS2A 4RKEA 1W9MA 1O8BA 2I6UA 4KFCA 4Z4QA 1IMOA 4UW9A 3Q8KA 3IMGA 4PIVA 2VRNA 3H7AA 2NPIA 1CW2B 1GPKA 1I2CA 2FZEA 5F9HA 1L5OA 2ZBVA 3TIGA 5HX7A 3WAJA 2QBYA 3DMPA 3VH1A 3RYFA 4PLZA 2MHCA 2X6TA 4GM1A 2PS0A 2QTRA 4L16A 1AB6A 1TUEA 4C0WA 5IKEA 3O8RA 1A7KA 1IOWA 1BH6A 1ZH2A 3ZIDA 2P4EA 2PMCA 4ZQIA 3V3TA 4IDBA 3RC8A 4FFSA 4M49A 2QTNA 3DB1A 4JBWA 1X1RA 5JCOA 3TZBA 1QKJA 4CQLA 2WMOB 2JZNA 3IR5A 3C3XA 3EULA 1W46A 3V55A 3MAAC 2AFVA 3OPNA 1W8IA 2WP8J 3C3MA 3MS2A 3LKZA 5ILGA 3USCS 3HL4A 2VWGA 3LRTA 3WP1B 3N8NA 2WQZA 4LNHA 4ZCQA 4CV2A 4Z1OA 1E4VA 5AM0A 3NIGB 5CVTA 3S44A 3AUKA 3SHTA 4D46A 5LIPA 5LBUA 3EFEA 5MFZA 1T8PA 4GXNA 4TVOA 3DL0A 1O3YA 1OC4A 3FDFA 3H1GA 4J0HA 2WSSA 4QODA 5TVKA 3TXXA 2WUWE 3RB8A 3TTSA 4D57A 5A5DA 3GJQA 1I1QB 4JYPA 2J4DA 1XKLA 2PZKA 3B5IA 4IR7A 4LJ7A 4MVJI 4QXOA 3CUEF 4V0MA 5PNTA 3DM5A 4PLWA 5EJ7A 1ZGHA 3RK1A 2VJPA 2CLEB 3ANLA 2WAMA 3BJRA 2G80A 1F2VA 2GZSA 2A9QA 2ZYDA 1GNSA 1SULA 3AM1A 5HG0A 1TPZA 1R1DA 2ZPAA 3D43A 4L9AA 2GUGA 4YXWA 2A88A 1XAJA 3H5AA 1SXQA 1ONBA 2Q2WA 3FUUA 1KJZA 4QC2A 5DTMA 4F7WA 3R9WA 1GZ3A 5EJ9A 4JVNA 2XXAA 3T9BA 3FWHA 1UR5A 2EEZA 3HA2A 3RHFA 5AXDA 4CHGA 4Y9DA 4WN9A 5FBZA 3S2GA 2O6LA 3KZMA 5CVVA 4RK5A 4CW7A 4URZR 3ESRA 5C8ZA 2H11A 1NLYA 2F7SA 1A9ZA 4OLAA 1NKSA 3M3HA 2V7UA 4Z4HA 3NRCA 2ZBGA 2O8CB 5LLSA 1VIMA 1JX6A 3ZGYA 2R8XA 2AMJA 3LOQA 2OO7A 2A6PA 1PZHA 4WKBA 4U9HS 4JI4B 2VPWA 4X8MA 1ESCA 2A86A 1J33A 3R7WA 5TDHA 4RD0A 1CHNA 1TLTA 4LDQA 4BS9A 5HWSA 2QS9A 3AUFA 3TVDA 1W73A 2FHPA 4TV9A 3RAEC 1TZ2A 3RIHA 3CF2A 3Q3JB 2RGGA 4QDZA 1UDXA 5IDYA 3ZDYB 3PDCA 4UKDA 3FPFA 2FR8C 1VB5A 2NZ2A 2ZYGA 5JY1A 1CY6A 3RT9A 4D79A 3K53A 4LY0A 5ALFA 3WL3A 1CQWA 3VZDA 4CDRA 3U60B 2QAGC 2VOEA 1XNQB 5KKNB 2AN5A 3DXXA 4L2IA 2C57A 1ZXLA 5EP1A 1NQVA 2C9OA 4OYRA 3CU5A 3DHEA 1SHTX 3JZAA 3G9XA 4O33A 2BJWA 4ZV9A 3ZXUB 2QRNA 2R7LA 1KHTA 4LYHA 1VL6A 1IUOA 4MS1B 3M9LA 2HM7A 3A9UA 1G2QA 3NVAA 3G2MA 1U0RA 4KH0A 4C0JA 5F23A 4JU9A 4RY9A 1DDOA 2HHCA 1KI8A 1SXJE 2C61A 3AFGA 1W2WB 1PJQA 1E2HA 2HK7A 1GQSA 1R37A 3ELUA 2Y0DA 1ZJ5A 2HF9A 1HUQA 1X0XA 1EZ4A 2J9ZB 2C7PA 1IXSB 3ETDA 2MMGA 5CGZA 3V46A 3T1VA 4YJKA 1JG2A 5FNVB 4LMRA 2EF1A 3AF2A 4MUKA 3RNOA 2A9KA 4LVOA 2DQZA 2VJLA 2IF2A 1O7JA 4W1RA 3TX2A 1BW9A 2OLJA 3N2ZB 4U39A 3VO2A 1S4MA 4O5AA 1X87A 2NP6A 4MRNA 5F77A 4Y67A 3LDGA 5IBPA 2CZQA 1RSZA 1LS1A 4ITRC 2BKXA 4OFWA 4E70A 1R6UA 2PEZA 1M0WA 4C05A 2ZU6A 3ZQKA 5KDOA 3GDHA 5DGIA 3AVUA 3H2SA 3TUIC 5AKZA 4BN0A 5DCYA 4QJ3A 5FV4A 1R0ZA 5KWIA 1WCWA 5IANA 1OXSC 4N47A 3G5UA 4AMZA 4LWZA 3REOA 5JYEA 1P17A 1WRBA 3G9UA 5GGYA 4W9NC 4EG7A 2GCNA 1VG9B 1KAEA 4TS9A 2WHXA 4JGBA 1IOLA 1H23A 4LTMA 3UKJA 3JYLA 1ZD8A 1DKQA 2Y76A 1JWLA 8ABPA 4ZPXA 2O0LA 2WIGA 4TXNA 1E1DA 1SMKA 1U0TA 2XCOA 3MYYA 5K3EA 3LDHA 1USUA 3ROFA 4HGZA 1WHTB 4GG1A 5JT1A 1QCDA 1QB7A 2IYRA 2EIXA 1GGHA 3CX4A 1WXQA 3Q5DA 4DEXA 1LLQA 1FMCA 3IJPA 1RXVA 1OOEA 4QRIA 4V3BA 1GUFA 3WAKA 2P0AA 3DV9A 3Q9SA 1UP4A 3IOBA 2E85A 4WJKB 4ZCIA 2HT1A 4XR4A 1G8KA 5JAUA 4JNCA 2X6QA 2AW3A 5F9MA 1RRVA 3AUTA 1ZC3A 4AUNA 3NBUA 2W6QA 5JASA 1FMLA 2J07A 1M1YB 2I2DA 2XECA 1NJFA 1QAMA 5BSMA 3VTZA 3EGWA 1OA0A 4G0QA 3NWPA 2BBSA 3SF8B 3QRWA 2UYYA 3ETJA 5GONA 4LFCB 1OZ0A 3GA0A 1S2DA 1U2ZA 4TYWA 1AGRA 1UDBA 1YZFA 2OXCA 2J9RA 1UMCA 3KM0A 1Z7BA 4HX2A 4I36A 1RYNA 1YDWA 4B4DA 5EE1A 2CHFA 1RPJA 2G3YA 5JMTA 2YJNA 2NOAA 3QXSA 5DLYA 4EHDA 1O6GA 3KPWA 1GRNA 3GFRA 4I81A 3FRIA 1W93A 3U3XA 2ZJ4A 1AE1A 4N6GA 4GUDA 4KLNA 1K9VF 1B0PA 3JVIA 3LVRE 4R01A 3TDNA 2FMTA 1GPMA 3MELA 5D5PA 1H0HA 2Q9CA 4XAQA 4ISCA 3FNGA 1NJ1A 5JH7F 2RAVA 3VU3A 2BLLA 4A6DA 3ZU4A 1KVRA 1TC2A 1PT6A 2E82A 4EK9A 2B36A 4NEHB 2HPVA 4NZZA 1E3SA 1MENA 3OO1A 4TYMA 1Z4KA 3IOMA 3LV8A 5C37A 3EJWA 3I9OA 3PNSA 4AKHA 4M9UA 5DIFA 3FPSA 3MN1A 1HQCA 4OQEA 3PR3A 1ML3A 1JBQA 1A27A 3LX8A 4DCGA 2A0WA 3PDHA 4Q7JB 3PLAE 4Y3UA 5JO0A 4AZ3B 3G8AA 4TT8A 2BC9A 2DWPA 3AJEA 1BMQA 5BW4A 1ZOLA 4DCUA 4EHKA 2JFFA 1F2UA 1B23P 2JCYA 4ZC1A 5KI6A 1FFBA 4MUMA 2WR8A 1SRQA 2ZB7A 1G4UR 3I61A 1E2IA 4GYJA 1GSHA 1W6UA 1KAHA 3RVNA 1JAZA 4Y9RA 1DXOA 4ASUA 5SICE 1AA6A 1E2GA 2V59A 1R2QA 2QMUA 4YFYA 1OY1A 3TNLA 1OX4B 3NV7A 3HVIA 2ONZA 1HE8B 4TT3A 4OQDA 1GV1A 2Q2OA 2QW1A 1RBQA 4BMOB 5J59A 1KZGB 4INPA 1DRWA 4AG6A 3DBRB 3Q4GA 4OP1A 3IALA 2D1SA 3K1ZA 2AGVA 1ZITA 1CU1A 1QYWA 3IIIA 3QJ5A 4S12A 4F3KA 4ARIA 1EXVA 4IWYA 1NPDA 3GNQA 1LS6A 1M72A 3ZHUA 2WPNA 4GSYA 5AVYA 1T9KA 1QRAA 5ALRA 1FNMA 1AQJA 2ZUEA 3DAHA 4KSBA 3T9DA 1YRBA 2FWNA 3O2NA 3L79A 2WM8A 3DO6A 3F2IA 1M6NA 4L4SA 2EJUA 4XPIA 5CGQB 2HXYA 1F14A 1J7KA 1IEQA 2ZR8A 3I2JA 1T3HA 1C3XA 4CEHB 2GERA 2FPUA 3A58B 5JROA 1ORTA 1HT3A 1Q95A 2BN4A 1T0BA 3B1JA 4MW1A 4OHBA 1VYVA 1CG6A 1UJBA 5BN3A 1Y42X 2FDRA 4R54A 1ORHA 2DG2A 4O1IA 1FDOA 4ZCPA 5I7FA 5ECYA 1TJ3A 1HNNA 1IBMB 2ZJAA 4JJ4A 2I1QA 3LPAA 1QRRA 1B4DA 2RHMA 2ZIWB 4HB2A 4P86A 2DPXA 4HV4A 4O6VA 4R1PA 5CITA 4HWGA 2J0QA 3B5EA 2H92A 3O0DA 4LF7B 3BFPA 4S05A 1QS0A 1ZD4A 1R3DA 4E03A 3QE0A 3B7PA 2VZ8A 1Q2XA 2WNSA 5CNMA 4V1CB 1QZXA 3LHIA 4BMXA 5CYPA 6ADHA 1M2KA 3AJAA 3DMNA 3IQHX 2B34A 1E7SA 4GDMA 4ENTA 3AH8A 4UNRA 1YDFA 2CXPA 2LKCA 4FR0A 1KVUA 5AKIA 1T24A 1YZGA 1YWGO 4ON9A 1XCOA 5HMMA 3ZNQA 4YJ2A 2UUPA 4BX9A 1IBLB 2IBTA 4C0BA 4ZMBA 5KOJA 2OY0A 3SDBA 4OU5A 4UU7A 1Y33E 3A6DA 1DADA 2PDAA 3JZFA 2YR0A 1JLLB 5J4KA 2IV7A 5DRTA 3CC8A 3UMSA 4BNIA 4HNRA 3TW8B 3T3NA 3T3PB 2GK6A 3L0DA 1QVRA 2JFOA 3K4PA 4GT1A 4QOEA 1D4AA 1PT8A 3GG2A 3K9HA 4MB6A 1Y9AA 2H7XA 4RSGA 5AUOB 5HJ7A 4GXRA 2H5IA 3WNDA 4I0WB 4QGBA 1KPHA 6REQA 1RM5A 3FYCA 5D3MA 5IPFA 4YPVA 4MJXA 3U26A 3Q12A 2VK1A 3NETA 4P3PA 3TXYA 1ISHA 2ZZKA 2XD9A 4FDTA 3FPAA 3D8RA 4E3ZA 2FEXA 3HB4X 3M6WA 5BWLA 4IDCA 3ZY4A 1IN8A 1KE2A 5KU7A 4HNTA 5JALA 4Z7OB 4I3GA 4G25A 1Q57A 1LQTA 3Q7IA 5F21A 3SXUB 2O5RA 2WJAA 3VR3A 2FMHA 3WMGA 1QTQA 4PPYA 1MP0A 1YUNA 2OQRA 4O4JF 3FFAA 5G1OA 1GAXA 1MIHA 3D8TA 5LQKA 3H75A 4M98A 1LB1B 1L6IA 1ZDMA 3C87A 4JLDA 3WLNA 3EUWA 3FCAA 2KBFA 2W6ID 1VIYA 2HBZA 1ZUD1 2DPHA 1CEQA 4KUGA 4EVSA 5LQAA 5E0OA 2OHIA 1LBQA 1DIGA 1HG1A 3N58A 1E2EA 1ESEA 2Q8QA 5HS6A 2FY8A 3EVNA 3EGIA 4AG3A 4O63O 3H8VA 4XEUA 4ZYWA 2IJGX 3VI4B 1RRKA 5G1NA 1UINA 2X1VA 3VOBA 4UM8B 1IY8A 3QYPA 4KR9A 2FSVC 4MMYB 2NZVG 3PHBE 4EUEA 1JTFA 4F6LA 1AO0A 2QV0A 1SOVA 2HO5A 3H83A 1EK2A 2L17A 3RS3A 3RJ5A 1XDUA 3R0JA 4CTOA 4E2XA 1GJRA 1JIUA 2AFHE 1XNJA 4EG4A 1CUDA 1KR5A 1V0JA 2IU6A 4V0ME 5A9SA 4JLOA 3KJFA 4F2GA 5GINE 4F91B 3RWMB 1HDEA 4RHTA 3GMIA 2B2CA 3SZUA 3DAGA 4LZLA 4Z8XA 1ECPA 3WGLA 4ZZ1A 4B3MB 2JJ1D 4KKXB 4TRRA 3R8CA 1IEVA 2R97A 3BTUA 4HH3C 1N7IA 5FP0A 2C2OA 5KYYA 1NQUA 5AKEA 5KWJA 5KINB 4R40A 1KJIA 3LLUA 1EP3B 4PLPA 3RPEA 3E22B 2PD6A 4DMGA 2A78A 4GLOA 4LRSB 3L8EA 1JIKA 1PG0A 5TJHA 4JWKA 1B26A 1BX0A 4CMBA 2X2EA 1SC4A 5CCBA 5IMBA 2Q0QA 1OX5A 2II6A 4M0EA 3PDUA 5FOWA 3ZJ4A 5L51A 4OLBA 3QFCA 3MT9A 2FPPB 1HQKA 1VIVA 4G0VA 5CLLA 4RV5A 1M6VA 1E64A 5E7IA 3K8OE 1E7YA 2KW5A 1NXWA 3OIYA 4NCJA 1GZ4A 3KFLA 3Q3VA 2BCEA 4TSKA 3P1JA 2PMKA 5DBOA 1JMVA 3BILA 1E8NA 1VKRA 1YSCA 4O2BB 4TWIA 1RKBA 5LC1A 2EERA 3K30A 3KKQA 3KZKA 2YQZA 4QBKA 3DF7A 5KTRA 1F6BA 1F8FA 1P7CA 2WHPA 4CV0A 4YCSA 2YN4A 1KWKA 5AXBA 1RCTE 3VRHA 5JZVA 1EFKA 3HU1A 5L3RA 3U17A 1UM8A 1PFUA 3N74A 1H6DA 2XOKD 3NEAA 3L7NA 3I1FA 4JSYA 2PRKA 3DG9A 5KKAA 2V7XA 4YCBA 3VZPA 2VG8A 1NDHA 4FSDA 3CQ9A 4ZYZA 5AW8A 5DLQC 1YK0A 4YT8A 5LOVB 4WHMA 3EEOA 4QFMA 1FDRA 4G5OA 5T57A 2O2XA 2C42A 2JIDA 3KZCA 3QE2A 2YNMA 2ZB3A 4GBED 5AM4A 4M0DA 3W5CA 2C5BA 3A6HA 4IL5A 3K6SB 3PL5A 2GYYA 2LIVA 3MTBA 5CCEA 1QNFA 3B1WA 4GL4A 5E7MA 3AF0A 4X93A 1L5NA 1TZJA 2QLMA 2AX3A 3AM5A 3RWBA 1DEHA 1VJTA 2O2EA 1SPBS 3TW6A 4D45A 2XCSB 3KQUA 4L51A 4WV3A 1PX2A 3VNAA 4QZVA 3GJRA 2CXSA 1VFNA 1T5TA 1N92A 4A15A 4Y0VA 1WKVA