1HV7A

Porcine pancreatic elastase complexed with gw311616a
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNDGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The discovery of a potent, intracellular, orally bioavailable, long duration inhibitor of human neutrophil elastase--GW311616A a development candidate
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords ELASTASE 1
total genus 63
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2001-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1hv7A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1hv7A01
2P95A 3UIRA 1Y59T 4K1EA 5JB8S 4I32A 5JPMH 4UFDH 3VGCB 1EAUA 4HTCH 1C5TA 1ID5H 1HCGA 4ABIA 5EGMA 4NFFA 2ZTXA 4LZ1H 1O34A 1O3EA 1IQKA 1V2VT 4Y11E 4LZ4B 4ISOA 1O5CB 4FUCA 1TPOA 1C1NA 1O2VA 2VH6A 2BZAA 2DE8A 1UK2A 3RM2H 4OGXA 4D9QA 2SGPE 1DWDH 1YPHE 3SZNA 3OY6U 1ZOMA 4UDWH 4MTBA 3PLPA 3I78A 4AOQA 3V12A 1FY3A 1B5GH 2Z3EA 5A0AE 4YESB 3QLPH 2BLOA 1EZSC 4JZEH 1HJAC 1O5FH 4WWYA 1E34B 1K1LA 4X8SH 2ZFRH 7GCHF 4JZIA 5F03A 2A45B 4DVAU 1QRWA 3SNAA 1NS3A 2GD4B 2SGFE 3L3TA 3U8TH 4QT8C 3S7KB 1D3PB 1L4ZA 4KGAA 1ZGVA 1QURH 3GCHB 3RXOA 5FCKA 5C67A 1FAXA 2TIOA 1TMTH 3DFLA 1VITH 2Q6DA 3SI3H 1DT2A 3RXHA 3JZ1B 2FPZA 2QC2A 1ZMJA 2C90B 1GCTC 2XW9A 3VB7A 2Z3DA 3SUFA 1NFXA 3U98H 2OC8A 2A31A 3BEFB 3GCTF 2HPQH 2IJOB 3RXIA 5PTPA 2O8TA 3ZZ8A 1O2NA 1G9IE 3TJVA 1MQ5A 2BQ7B 3TH2H 2BMGB 4KELA 3E0NB 3QTOH 3ZVAA 1M9UA 1HXFH 4CBNA 4LOYH 1GMDF 1KLTA 1RGQA 3SUEA 2PLXA 1WTGH 1GCDA 4X1SU 3A83A 5CE1A 4AX9H 3LGVA 1JXPA 1VCPA 2VWOA 3SBKA 5A8XA 2ZA5A 1TNKA 3SQHE 3M7TA 1K21H 2FTMA 2VIVA 1XM1A 2IN2A 3AAVA 3PLKA 1Y5AT 2Y7ZA 3KNXA 4WF8A 2B5TB 2Z9LA 3MH6A 4IN2A 1O5BB 4X1QU 2VGCB 1P12E 2PUXB 1G3EA 3E91A 1DITH 1W14U 3A8CA 2C8XB 4FXGH 1Y3YA 3RXEA 3NPSA 1QR3E 5DPAA 2STAE 1QJ7B 2BY6X 4OS2A 3KQDA 4ISHH 4U2WA 2WYJA 1NESE 1YCPH 3QK1A 2TBSA 3SNEA 3GDVA 1SL3A 1QQUA 2W7SA 1OWDA 4CRFA 2ZCLP 1UVTH 1LO6A 2A7CA 5F8ZA 5AVDA 1YM0A 4BOHA 1NZQH 1O2JA 1FAKH 1TB6H 2H9HA 3OX7U 6LPRA 3P6ZB 3T26A 3KL6A 4Y8XA 4XOJA 1BUIA 1H8DH 1LQEA 4MLFB 1E37B 2ZU1A 1XXFA 1TX8A 2G4TA 1ZRKA 1N8OC 1XKBC 3RM0H 1S85A 4ZMAH 1EJMA 1O3OA 4OS4A 1CA0B 1QJ1B 3TK9A 2PGQB 2ZFPH 2QA9E 2I6SA 4AZ2B 4FUJA 3GICB 1LHFH 1AWFH 3A80A 2ZHEH 1A3BH 1WCZA 1TOCB 1HAVA 1LHCH 3LGWA 5C2ZA 2B9LA 2WPLS 2W3IA 1GVLA 2P3UB 1TMBH 2FOGA 3LH1A 2ZG0H 3TJNA 2ZGCA 3GDSA 4FU8A 2FOBA 2CV3A 1GMDG 3FZDA 2IOTA 1W3CA 1O3LA 1IQFA 4RKJB 1O3AA 1RTLA 1DUAA 4ZROA 3ZV8A 4B2AA 1LKAA 3MOCA 3GDUA 3NZIA 3BEIB 4AGKA 2Z9IA 1NRPH 1HUTH 3MWIU 1G32B 1O5DH 4DURA 4A6LA 1C5ZB 1CHGA 2JH5D 3LKWA 1VGCB 2BHGA 4MPXA 3ZVEA 3ESTA 1OS8A 1P9SA 2VIPA 3BTEE 1EP6A 5JDUB 4J1YA 1O3IA 2V3HH 2BVXH 3TGKE 2YNAA 4YLQH 1TLDA 1H4WA 3F9FA 3URDA 1SGYE 1YP9A 3SUGA 1PQAA 2ZDNA 4I8GA 1V2RT 4X2WA 3O8DA 1VGCC 1SGPE 4YO9A 4NIXA 5AHGH 1V2ST 4TY6A 1NFYA 2EI6A 2GT7A 2BD3A 1O2KA 1Y3XA 1MTNB 2BDBA 8GCHF 4D8NA 1JIRA 2QXJA 4ISLA 1BTHH 3O8RA 1AFEH 2VINA 1DSUA 3SHCH 1D3TB 1L1JA 4IS5A 4A92A 4X1RU 5DGJA 1O5AB 2BM2A 3D62A 4TYDA 1NO9H 1Z7KA 1GHVH 2ZI2H 4MPWA 4XDEA 2P3TB 4X6PA 1TIOA 4GCHG 8KME2 1TQ7B 1DLKB 3JZ2B 3D65E 3UWJH 2LNCA 1KXBA 4K69A 1T8NA 2KAIA 1BTXA 1O37A 5K0HA 1K1NA 4UONA 1AIXH 3LC5A 1GI1A 1BZXE 1LDTT 2BXUH 1Y8TA 1FJSA 2A1DB 3A82A 1TABE 4R0IA 3FZZA 1TBZH 4A1XA 1YBWA 3SHAH 4ZHLU 2C8WB 3RXPA 2ZDKA 4Y79A 4X1NU 9LPRA 2I6QA 5A0BA 1BTZA 1OWEA 2XCNA 4ISNA 3ODFA 2UUYA 1AKSB 1O5GH 3PV4A 4B2CA 4D76A 3F68H 1P03A 4O03A 5FPTA 1F92A 1O2ZA 1GI0A 1Z8GA 3EE0B 4ZXYH 1YPMH 7GCHG 1EZQA 1E36B 2ZDAH 1EPTC 1ABIH 1QIXB 5A09A 3AASA 4D9RA 2O8WA 1W2KH 3F9GA 3IG6B 3PTBA 1CBWC 4WXIA 4XBDA 4WMEA 3TH4H 4BTUB 2ZEBA 5T3HA 2ZQ1A 2WPHS 1C1VH 1BMLA 1SHYA 1V2WT 3PM3A 4CRDA 1QBVH 1GPZA 4KKDA 1S82A 1WQSA 3ZZDA 3RXMA 1OP0A 3ZYDA 1ZZZA 5EXMA 4Y7BA 2EC9H 3OYPA 3SU4A 1FY5A 2FZZA 2GMTC 2BOHB 1IQEA 2BLWA 3DUXH 3FFGA 2F3CE 2O8MA 1DUEA 2G52A 1F5KU 2XC0A 1ZSJA 3A86A 1EJAA 1PQ7A 4BXWA 1HAZB 1P04A 1BTPA 2GDDA 4UFGH 3SW2B 1JWTA 2C8YB 1AUJA 2ZFSA 3ITIA 3LOXA 2F9OA 4I31A 1MKWK 4WVPE 3M5OA 1ELBA 3LU9B 1V2UT 1GHXH 1G3BA 1BTUA 2B7DH 1GHBG 1F5LA 2AIPA 1GJBB 3NKKA 1SLXB 4IC5A 3SNDA 2F9PA 1Q3XA 2BDYA 4DW2U 9ESTA 1TA2A 3RDZA 1QCPA 3SORA 1GHYH 2OC7A 5HGGA 4JK6A 4UFEH 1OWIA 1T8LA 2H1UA 3QZQA 3PTNA 3H7TA 3TIUA 2ESTE 2HWLB 2VGCC 4THNH 3TITA 2F91A 1N8OB 5DP3A 1O2YA 1O3CA 1MH0A 1V2LT 1DM4B 2HRVA 1BTWA 5JB9S 3E1XB 1ZPZA 2QN5T 1UMAH 5FCRA 4ZUHA 3UOPA 2DE9A 3MNSA 2WINI 1YLCA 1FXYA 1P57B 1SGEE 1BBRK 4M7GA 1C5OH 5IYTA 1DX5M 2BLVA 1CA8B 1OXGA 4Y8ZA 3B9FH 4TPYA 1VZQH 3UTUH 4Y0ZE 3HGPA 4A7IB 1HJAB 2Q6GA 3V3MA 1ETTH 2WPJS 3SV6A 1CO7E 2F9VA 3SJIA 4DT7B 1QBNA 3A8AA 4AORA 1QBOA 3KGPA 4I8LA 1VITF 1ELEE 2H9EH 3P8OA 2V3OH 4CHAB 1E0FD 1HYLA 1XUHA 1YKTA 4SGAE 2OQ5A 7KMEH 3MFJA 1AO5A 3LONA 4U30A 4GHTA 5EPNA 1P0SH 4DIIH 1ZMLA 1GJ6A 1PYTD 4BTIB 2QYIA 3A7YA 2FM2A 3LJOA 1O3NA 1D6WA 3RXJA 1VITG 3Q3YA 4GUXA 1ZPBA 4Y10E 2G8TA 1JOUB 1GG6C 1Y3UA 4FVBA 1MD8A 2BB4A 2Y7XA 5T6FA 1EKBB 3MO3A 1V6DA 2UUFB 1IQHA 1SI5H 2C4FH 3RMLH 1LCYA 1A61H 1FIZA 1PPEE 3P17H 2ALVA 3RU4E 3RXAA 5ABWA 1A0JA 3NCLA 2VH0A 1SGCA 4FUGA 3CS7A 1G3DA 2ZGJA 3KF2A 2AS9A 2PUQH 3BIVH 3BF6H 2FDAA 2A32A 4YOGA 3SV9A 8LPRA 3WY8A 5T6GA 4CBOA 2FI3E 4DGJA 1XUGA 3ATWA 4X8UH 4K8YA 3BTDE 3PROA 2PGBB 1XUJA 4FUIA 1YF4A 1ESBA 3UNRA 1KYNA 1DVAH 2G4UA 1TFXA 3CS0A 4X6MA 1K1PA 1V2QT 1BITA 2GGVB 1GDQA 3T27A 4E05H 3CP7A 3EDXB 4YT7H 1O3PB 4K2YA 1O2IA 4NWKA 3S0NA 1DWBH 1LHDH 3VXFH 5HM9A 3VGCC 4K8BA 1MQ6A 1A5GH 4NZQA 5FXLA 3BSQA 4JCNA 2FI4E 4FUDA 4JZFH 2XXLA 3SN8A 3E8LA 3SV2H 1EPTB 2PKAA 1DWEH 1AE8H 2AGIX 4DOQA 1YPGH 1ACBE 4KTSA 1GBLA 1HFDA 4JYVH 3SGBE 1HV7A 1P2MA 3BEUA 1EP5A 2AYWA 3ZVFA 3SU1A 1CT0E 3HATH 3TNSA 2CN0H 1O31A 1QY6A 1YLDA 2WYGA 3QN7A 1BT7A 1OOKB 5A2MH 4WY3A 3SQEE 1AE5A 1MU6B 2ZDVH 1WU1A 1UVOA 1Z8RA 1GBAA 3UPEA 1HRTH 3BTKE 4CR9A 1FPCH 1NFUA 1SQTA 2CXVA 2ZFQH 2FX6A 1HPGA 1P2JA 2D8WA 1TBQH 1CQQA 1INCA 1P2QA 4NZLA 4B75A 3BTFE 2EI8A 1B0FA 3SU0A 1S0QA 1GG6B 1SQAA 6CHAB 1Z6EA 3UQVA 1LPZB 1CT4E 1A0HB 3LPRA 3RXBA 1MTNC 1DDJA 3PMHB 4ABDA 3SV8A 1PPGE 1ETRH 2XRCA 1UTNA 2BY8X 1XUKA 2Y5GA 3LGIA 2AMPA 2ZDLA 1YCPM 2XBVA 4R8TB 1O2UA 1GVZA 4E06H 1YCPK 1C2DA 2FS9A 3SU5A 2H9TH 2OP9A 3BTME 1EATA 5C3NA 2BDHA 1MZAA 4B74A 1QL9A 3TJOA 4BAHB 2JETC 1J17T 1PJPA 3QTVH 1WQVH 5G4BA 2BD7A 2FXRA 5DP8A 4K3JA 3PMAB 1XMNB 2GP9B 2BX4A 1YPKH 1PPCE 1A7SA 3TK6A 2G00A 1GHZA 3AW0A 2D2DA 5LPRA 1HAPH 2VVCA 3UY9A 4NA7A 2Y81A 3O8BA 1VCQA 3SGAE 1O33A 1PPHE 2ANKH 3MU5A 1YPLH 1KDQB 3RXLA 2J4IA 4YTAA 1G2MA 1S6HA 1C1QA 4FUEA 4MPUA 1W0YH 1QA0A 1KIGH 2W5EA 1ANBA 3AAUA 1AVWA 3OSYA 1C5VA 1BHXB 4H42U 1JIMA 1WTHD 3V13A 2G51A 5DKMA 1IHSH 3SJ9A 3LT3A 1IOEA 5EW2H 1O3DA 4AGJA 2ZP0H 2GZ7A 4IN1A 1MKXH 4ZHMU 5I46H 3SO3A 3Q00A 5FBIA 2R3YA 4RSPA 5L2YH 3M35A 1KXDA 1E35B 1MTUA 4NWLA 1RTKA 1THRH 3M37A 3FVFB 4UE7H 1P3EA 1AU8A 2EI7A 3M7QA 4B1TA 1BJUA 1BA8B 1D3QB 1MKWH 2TGTA 5LPEA 1C5WB 1GJCB 1MCVA 3SU6A 1J9CH 4WXVA 4LK4A 4MNWA 4NA9H 1S0RA 1DS2E 1PPBH 3RMMH 1AVGH 1NY22 1GL0E 1ZTJA 1TRNA 1O2GH 2Z6BD 4TY7A 1KTTB 2BTCE 1IQNA 1TNIA 1C2IA 1IQLA 2J95A 4X8TH 2QXGA 2VIQA 4AFZA 3MMGA 2BY5X 5F6MA 2HALA 2AFQB 2CHAB 2NU2E 1MKXK 4YZUA 1K1IA 4CREA 3MU8A 1GCTB 3SJOA 3KEEA 5EG4A 1KLJH 3LGUA 2P3FH 2Z3CA 2ZIQH 1GBKA 2ZHWH 5JBTA 3EA9A 1P2IA 5DP6A 1W7GH 1CVWH 3KQBA 3LGTA 2V35A 1V2TT 2BX3A 1RRKA 3BN9A 3SGQE 1TGNA 2ZNKH 4GCHF 4GVUA 1MD7A 2W7UA 2AMDA 2J38A 1C1TA 1HAYB 6GCHF 1S5SA 1RXPA 1AN1E 1MBQA 1BRBE 4ABAA 1L1NA 2ZKSA 3T62A 1ARBA 1ELAA 1SGRE 3B8JA 2VU8E 1P06A 2YNBA 1BB0B 1H9LB 3DA9B 3GY3A 1AVXA 1JBUH 4ABHA 1CGHA 1B0EA 3ATLA 1RIWB 1IAUA 4GPGA 4A1VA 1GMHG 1O2RA 1ZMNA 4IC6A 2XTTB 1CU1A 2AIQA 3GY8A 3T25A 1Z71A 1T4VH 2P16A 3TNTA 1LHEH 1RD3B 2ZTZA 4NIVA 1ELVA 1Q31A 1SGNE 1FMGA 2ZFTA 1CE5A 4DY7B 5LH8A 1ZSKA 1P11E 5FPSA 3P8GA 3MH4A 2GCHF 2RDLA 4D7FA 3ELAH 1WAYB 3BG8A 4LXBH 1KXCA 3P8NA 3QO6A 2HOBA 4Y0YE 4K5ZA 5FX5A 1NRQH 3OY5U 1VJAU 4Y8YA 1P3CA 2FOAA 3AVZA 1CSOE 3TVJB 1G36A 1QNJA 1VCWA 3RXUA 1UK3A 3VFEA 2AH4X 2R3UA 2SGQE 3TPIZ 2O9QA 2QV1A 1LVOA 1KY9A 2A7JA 1O2TA 4DIHH 4UFFH 4ASHA 1EAIA 4H4FA 1QB6A 5IDKA 3S9BA 5F8TA 3M5MA 1NT1A 4FUHA 3PO1C 5C1XA 5C5NA 3RUOA 3UWIA 1ARCA 1C9TA 2V0BA 1NM6A 5BRRE 4XBBA 2OXSA 2BVSH 3Q3KA 3N7OA 2Y5HA 1F5RA 2EEKA 5HYOA 1V2PT 1QFKH 3A7VA 4I8JA 2PHBA 2FO9A 1LPGB 5ETXA 4KTCA 2HNTF 1NRRH 3SNBA 4ZH8A 5DP9A 3PYHA 5I25A 1F0SA 2HNTC 3LDXH 1HIAA 1OKXA 1K28D 3UOUA 1TAWA 5AFZH 3RXTA 1GI6A 2ANMH 1V2NT 5GWZA 3GY4A 3VEQB 2ZHFH 4H6SB 4Z0KA 1A46H 4WJG2 4WMDA 1P05A 3TGJE 1AKSA 1H9HE 3K2UA 1LMWB 1V2JT 8GCHG 1O2XA 1TALA 3Q76A 3DFJA 1UVUH 1OWHA 1ETSH 5DP4A 2F9UA 1EOLA 2A7HA 3MH7A 1EZUC 1O3HA 4PROA 5K7RA 1CHOG 1Z1IA 1MTSA 4AFQA 2XBYA 2Y80A 1WBGB 1SGIB 4GSOA 3U1JB 1O3GA 1SLWB 1GHAG 2ZU2A 4CR5A 8ESTE 5EU8A 3RXFA 2P8OC 1Y5UT 4FVDA 3Q77A 3MNXA 1XVOA 3ZZ6A 1J14A 4AB9A 2B0FA 3VXEH 1C4Y2 3QDZB 1RIWC 2VJ1A 2Z9JA 1C1WH 1TPPA 3SNCA 1ZHMA 5TJXA 3S69A 1FZZA 1VJ9U 5A8YA 1NPMA 1GL1A 1GGDB 5C20A 2BD4A 2O8UA 2A5KA 3QGNB 1QA7A 2FIRH 1ZPCA 2J34A 3SU3A 1JRTA 1W11U 3GY5A 2FLBH 2QAAA 2ZDMA 2FP7B 3ZZ3A 2GX4A 4X6NA 4X0WU 1PPZA 1GGDC 5E0JA 4HZHA 4O3UA 2GVFA 2C93B 4DJZB 2O8LA 1CA0C 1P09A 1TGSZ 1UTOA 1TNLA 4Y6DA 4MPVA 3RXQA 3GCNA 2FTLE 3RLWH 3M5NA 3A87A 3KHVA 5E0GA 4Q2KA 1MCTA 5A0CA 2LPRA 3S9CA 3SJKA 1C2HA 1UTPA 1S81A 2BQ6B 3T29A 1O5EH 2STBE 1CBWB 4RKOB 5EW1H 2UUKB 1LVMA 4ZXXH 1SQOA 2PTNA 1YGCH 3K9XB 4K60A 4INLA 4BXSA 1HAIH 1XUIA 3BG4B 4RN6A 1PQ8A 3EYDA 1CT2E 2ANWA 2CJIA 1ANDA 1NN6A 1N6XA 1F2SE 2UWOA 3P95A 3D23A 2FS8A 2J94A 1SMFE 2GCHG 3UFAA 4ABBA 1GI8B 2QXHA 2VIDA 4K1SA 1DANH 5LGOA 4TWWA 1O38A 4XBCA 3A8DA 2GMTB 4WMFA 3FANA 1SGDE 1AB9C 1WYKA 2C8ZB 1GHBF 2SNVA 2VNTA 1L2EA 3FP7E 5DP5A 1BBRE 1J8AA 2VIWA 1P9UA 1UCYE 4B71A 1K1OA 2SGDE 3PLBA 1UK4A 4AG1A 4ZKNU 2Y5FA 2YOLA 1UHBB 2FWWA 1LKBA 2ZECA 2WUCA 1FUJA 2ZCKP 2JETB 5EODA 2XWBI 1GBIA 2FYRA 3IWMA 1T31A 2ANYA 6ESTA 1Z8IB 2ZCHP 3RXVA 1EAWA 3URCA 4B76A 2W26A 1ZHRA 2ZF0H 1K22H 5B6OA 1E38B 2RCEA 1JRSA 2PR3A 2KAIB 2WPKS 3UNSA 1UTQA 1V2MT 5E0HA 2XBWA 1ESAA 2ZHDA 2Y6TA 2OC1A 2UWLA 1C5XB 1WSSH 1YPEH 3RXGA 1SSXA 2HLCA 3VB3A 3PWBA 2VWNA 4F4OC 2UUJB 3LGYA 4GHQA 3QUMP 1C5QA 1SGTA 2ZGBH 1HIAB 4FU9A 4IMZA 1KXFA 2DUCA 5J4QA 1O3MA 2OQUA 3RXDA 1GBEA 4GLYA 3ATIA 3BV9B 3ENSB 1GBCA 1SB1H 3NXPA 2VVVA 1CHOF 1Z6JH 4I8HA 4IBLH 1GJ5H 2A5AA 4WH8A 2QY0B 1KSNA 4FUFA 4AFSA 4AFUA 1WUNH 4ABFA 2BDCA 1TPSA 1YYY1 3M3SA 5DO4H 1A0LA 4I7YH 1TWXB 1TNHA 1F0TA 1H8IH 2UWPA 3GCHC 4XFQA 1QHRB 3GYLB 4BAQB 1Y5BT 1ZR0A 1OX1A 5FX6A 1RJXB 2OC0A 1GJ8B 1T8OA 3UQOA 3M61U 1AB9B 1T32A 2G5VA 2R0LA 3PO1B 2H6MA 1C1RA 2ZPSA 4O97A 4DG4A 3DHKH 1IQGA 1IQIA 1SHHB 2H2ZA 3FAOA 4BAKB 3A7XA 3SI4H 1EZXC 2A4QA 1C2FA 3ZZ7A 4UD9H 2ODYB 5ESTE 3MNCA 1CGJE 1GMCG 1UO6A 2BDIA 5HM2A 1IHTH 4AG2A 1T7CA 1O39A 3LIWA 2P93A 3U9AH 3O8CA 2JKHA 1DOJA 4NIWA 3RC4A 1C5MD 1GVKB 2JH6D 1K2I1 2ODQA 4UEHH 4AN7A 3TJUA 1TRMA 2OCVB 3BIUH 5A8ZA 1P10A 1QGFA 1HGTH 2VVUA 4FUBA 1GMCF 3MU4A 3AW1A 5FPYA 3ZVBA 3A88A 1ELGA 2AMQA 2CF8H 2G55A 3I77A 1BJVA 2ZC9H 1LVBA 1SPJA 1C2GA 3F9EA 3GY6A 5J4SA 1NTPA 1UTMA 4X1PU 2XCFA 1LHGH 3Q3XA 1BMAA 1OWJA 3HGNA 1MTWA 2BD5A 1YPJH 3S7HB 2FOMB 3MTYA 4ZAEA 1C5LH 1SGQE 1TNJA 2M5TA 2PTCE 1C4U2 3ZVDA 3RLYH 3MNBA 1UHBA 1SGFA 4NG9H 3HK3B 3RXRA 2ZGHA 1GMHF 3ZVCA 1L1GA 1X7AC 5EQSA 1GWAA 3STJA 2ILNA 1FDPA 1C9PA 1FI8A 5H4IB 4U01A 3LJJA 1ELCA 5DP7A 2PKAB 2FODA 1DFPA 3F1SB 2FOFA 3H5CB 2NU1E 3M7UA 1W13U 1GJAB 4OS1A 2VWMA 5EXNA 2OBOA 2J9NA 1SC8U 1SLUB 2QF3A 3ODDA 1PQ5A 5GPIB 1SFIA 2XBXA 1EB2A 2WV4A 3A89A 3B23B 2AERH 3QGJA 5L2ZH 1AY6H 1HAXB 1GI5A 4B2BA 4INKA 4CRBA 1C5PA 1Y3VA 5FHTA 1SOZA 2Z9KA 3PWCA 3F6UH 2TGPZ 1GI3A 1BRAA 1ESTA 4JYTA 7LPRA 3C27B 3UREA 3L33A 2GT8A 3RU4D 1C5NH 4BAMB 1EAXA 1A5IA 3GY2A 1FLEE 4FU7A 4AYVB 1MUEB 5AF9H 1XX9A 4TWYA 1GDNA 3RXCA 1DLEA 2ZPQA 1BMNH 1OP8A 1EUFA 3U69H 1LVYA 1Z8JB 4Z6AH 2R2WU 2GKVE 3SOSA 2FOEA 4INHA 3KQEA 2CMYA 1G2LA 1FQ3A 3HKJB 4AB8A 1D9IA 5CHAC 4IGDA 4O3TA 1RTFB 1MZDA 1ANCA 1UVSH 1C1PA 1O35A 2PFEA 3MYWA 5ESBA 2H5DA 1P2NA 1WV7H 4ZHAA 1ZGIA 1C2JA 1GDUA 1BTYA 6CHAC 2AEIH 4BNRA 1DWCH 5DG6A 5HMAA 2FI5E 4E7RG 3RMNH 2BY7X 1TQ0B 4X8VH 1GBBA 2QCYA 2P59A 4MNYA 1O36A 3EAJA 2ALPA 4VGCB 3UR6A 4CH2B 3IITA 1HJ9A 1SVPA 2PKSB 4MVNA 4OS7A 2WPMS 4VGCC 1G37A 1F7ZA 1O2QA 3D49H 2BQWB 3NUMA 3S9AA 1GBDA 2PV9B 1OYQA 1W0ZU 4HFPB 1KXEA 1T4UH 1HAGE 1C2MA 2SFAA 1EOJA 5LPFA 3V0XA 1AQ7A 3MU1A 1THPB 1GI7B 1MAXA 3TH3H 4ESTE 1SFQB 3MI4A 4CRAA 1ZJKA 2HVXA 1BCUH 3BTWE 2SGEE 2BDAA 2OBQA 5CMXH 2AGGX 1TOMH 1MU8B 1WOFA 4IW4E 3ZZ4A 4HGCA 1HXEH 1NRNH 4I33A 2ZWLH 1DY9A 2RA0A 1O2HA 1BBRH 1FY4A 3E6PH 1GI9B 2THFB 3A7WA 1AZZA 1GJ7B 3A7TA 4JZDH 1IQMA 3TK5A 2A0QB 2ZU3A 1C1UH 4YOIA 1FV9A 2BZ6H 3ATKA 2A4RA 2BD9A 1AI8H 3RU4T 3QWCH 4X2XA 1DXWA 3GISB 1IQJA 1TE0A 1B7XB 2NWNA 2TGDA 4YM9A 1FN8A 1KXAA 2D26C 2GV6A 1C5UA 1C2EA 3HKIB 4WH6A 1BDAA 2FLRH 1PYTC 2BYAX 5C5OA 1ZJDA 1K1MA 1OP2A 3H7OA 5C1UA 3K6ZA 3T5FH 1EB1H 2A5IA 2Y82A 3STIA 3MU0A 1QB1A 4Q7YA 1OSSA 4XSKU 3EA7A 4NSVA 2VB0A 1J15A 1L4DA 1UJ1A 5CHAB 1QL7A 1P2OA 5GXPA 2EA3A 3RXKA 5L30H 3MHWU 2A4OA 1KLIH 3ZZCA 3FP8E 5C1YA 1ELTA 1FIWA 2GDEH 1ZTLA 3KIDU 1TONA 2QIQA 4YT6H 1DY8A 1ELFA 1F0UA 1LPKB 1FPHH 1V3XA 1D4PB 3ATMA 2CHAC 1GJ9B 4ABEA 2R9PA 3PB1E 3T28A 1U6QA 2F9NA 4CRCA 2GTBA 3BTQE 4ISIH 2CGAA 3UNQA 3QZRA 3L6PA 3TGIE 1DICA 2WV5A 1A1RA 4ZKSU 4O9VA 1EJNA 3ZZ5A 2NU4E 4DCDA 2P94A 2ZPRA 4A5TS 4U32A 1GJ4H 2F83A 4JZ1A 3A84A 3SV7A 4TPIZ 1AHTH 2PKSC 1UTJA 5GJ4B 3NWUA 1EX3A 1A5HA 5T6DA 2XC4A 1Y3WA 1S6FA 1ORFA 1QRXA 3DT0H 5GIBA 1BOQA 1O3FA 5AFYH 2OUAA 1C1MA 1QTFA 3A7ZA 1QJ6B 3EGKH 2ASUB 1A3EH 1W12U 1OWKA 2G5NA 3LC3A 4J2YB 2Q1JA 1O2SA 4Q80A 1GBTA 2PWXA 3E3TA 1EXFA 4H6TA 2ZZUH 3GCTG 2HPPH 1FONA 2HNTE 7ESTE 3HK6B 1SLVB 4X2VA 3MO6A 3BTTE 2RG3A 4MNXA 1P8VC 2CF9H 1GBFA 5SGAE 1BIOA 1O2PA 3KQCA 3ZYEA 2A2XH 5JBCS 3ZZAA 5GCHG 1FNIA 1ZRBA 4D7GA 1P2KA 5DK1A 2R0KA 1GI4A 3OTJE 2NU3E 1O3BA 1C5YB 2A4GA 3C1KA 3M3VA 1ZYOA 2FYQA 1GBMA 3SJ8A 1O2MA 3P92A 1O0DH 1ABJH 1GHAF 1HJ8A 3BTGE 3ZZ9A 4CRGA 2RA3A 4GAWA 2ZTYA 2IPHA 1HBTH 2XC5A 4NGAH 1S83A 4K1TA 3R3GB 6GCHG 1C1SA 3T2NA 2HGTH 3SUDA 3MH5A 1UTLM 4Y71A 3TU7H 1MMJN 1P01A 1S84A 2TRMA 3G01A 3RP2A 4B73A 1MTVA 2ZGXH 1AWHB 1SG8B 3F9HA 1C5SA 1FN6A 1NC6A 4Q7XA 5E8EH 3K65B 1A2CH 1AZ8A 1TBRH 3PMBB 4I8KA 1TA6A 5HXFA 4MNVA 1K1JA 5BPEA 4CHAC 3P8FA 3KCGH 1T8MA 2B8OH 2G81E 3R0FA 4ZKRU 1CGIE 1FY8E 5TCAA 1ZLRA 2FOHA 3FP6E 2OLGA 3RC6A 3GCOA 1O30A 1RFNA 1O2WA 5EXLA 2BVRH 2PSXA 2GCTC 4OGYA 1ANEA 1RS0A 4A1TA 1D6RA 3PMJA 3UR9A 2BD2A 2TPIZ 5JYIA 2PSYA 1HAHH 1H1BA 2AGEX 2BLQA 4JMYA 2XYAA 1DE7H 1W7XH 2SGAA 1O3KA 3A81A 2J2UA 2XNIA 1OYTH 1TRYA 1HB0B 1BRUP 5E2OA 3ZV9A 2BY9X 3P70B 1BHXF 2A2QH 3EQ0H 1NU7B 1UCYK 2SNWA 1TGTA 1V2OT 1G30B 4OS6A 4HI3A 4BAOB 1THSH 1TPAE 1ELDE 2BXTH 2QF0A 3VB4A 4NA8A 1BMMH 3NK8A 1C4V2 1N1LA 1QL8A 4YLUA 1O2LA 1UVPA 2XWAA 2QXIA 1AGJA 1HAOH 4NCYA 1SOTA 1HNEE 1XUFA 3GOVB 2BD8A 1QB9A 1PFXC 2J92A 2Z9GA 1YC0A 2D1JA 2GZ8A 4OS5A 1BQYA 5FBEA 1PPFE 1VR1H 3RMOH 1HAVB 4CH8B 2Q6FA 3A8BA 1GJDB 2F9BH 1EQ9A 2OD3B 2VWLA 2ZHQH 1KDQA 4ABGA 2H5CA 2Z94A 4MDSA 1Z1JA 2GV7A 2GZ9A 1GHWH 1C2KA 1LQDB 2Z7FE 3W94A 3GY7A 3VB6A 1UCYH 1G3CA 2BDGA 3RXSA 5JBAS 1GI2A 2WUBA 4AYYB 1OPHB 2NU0E 1QRZA 1NU9A 4NIYA 1XVMA 1DSTA 1AUTC 3LH3A 1P02A 3RC5A 5FAHA 1L0ZA 1HDTH 1AMHA 1O32A 4BTTB 2ZU5A 2ZU4A 1SGFG 2R2MB 2FESH 4JYUH 4Y7AA 1NRSH 4SGBE 3VPKA 1AD8H 2QGRA 1XKAC 3HPTB 5F8XA 3I29A 5GDSH 3QX5H 4NSYA 4MG3A 3U8RH 3U1IB 3CENA 2ZFFH 4KTUA 1UTKA 3U8OH 3E0PB 1C5RA 1H9IE 2OINA 3MO9A 2FX4A 3ZZBA 1C2LA 5E2PA 1GBHA 1YPHC 2C3SA 4NFEA 4X2YA 3A85A 4E7NA 3M3TA 3DD2H 1NFWA 4JK5A 2ZO3H 3W95A 1ZHPA 1AFQC 1TX7A 5EOKA 1GBJA 3GYMA 2VIOA 1MAYA 2FMJA 4ABJA 1V2KT 3OU0A 3EA8A 2K1QA 4KP0A 5JBBS 1XXDA 4IMQA 4ZKOU 3M36A 2ODPA 3BG4C 1DPOA 1TGCA 1AFQB 1C1OA 4F49A 4MQAA 4XE4A 1SBWA 1O2OA 3V7TA 1JMOH 2GCTB 3KN2A 2V6NA 3M5LA 3UUZA 2PW8H 5EQQA 3E16B 1F0RA 2FOCA 4Q7ZA 5EQRA 1EPTA 1KTSB 1N6YA 1A4WH 1K9OE 1DXPA 1TYNA 1TGBA 1TNGA 1W8BH 1EASA 1W10U 1FY1A 1BRCE 1D3DB 1O3JA 4YOJA 1ZSLA 3BTHE 2W3KA 1ZTKA 3SU2A 5TCCA 2P8OB 3TLOA 2BOKA 2TGAA 1SR5C 2FEQH 2JH0D 4Y76A 1NROH 3VB5A 1Q2WA 5DJ7A 1HLTH 5EPYA 1LTOA 5L6NH 4BANB 1QQ4A 1MBMA 2ULLA 2ZQ2A 5GCHF 3ZVGA 3K6YA 2WPIS 4X6OA 3E90B 1J16A 1TMUH 1TX6A 2OTVA
chains in the Genus database with same CATH superfamily
2P95A 3UIRA 1Y59T 4K1EA 3PV2A 5JB8S 4I32A 5JPMH 4UFDH 3VGCB 1EAUA 4HTCH 1C5TA 1ID5H 1HCGA 4ABIA 5EGMA 4NFFA 2ZTXA 4LZ1H 1O34A 1O3EA 1IQKA 1V2VT 4Y11E 4LZ4B 4ISOA 1QZ8A 1O5CB 4FUCA 1TPOA 5C17A 1C1NA 1O2VA 4YXWD 2VH6A 1NBMD 2BZAA 1UK2A 2DE8A 3RM2H 4OGXA 4D9QA 2SGPE 1DWDH 1YPHE 3SZNA 3OY6U 1ZOMA 4UDWH 4MTBA 3PLPA 3I78A 4AOQA 3V12A 1FY3A 1B5GH 2Z3EA 5A0AE 4YESB 3QLPH 2BLOA 1EZSC 4JZEH 5DSFA 1HJAC 1O5FH 4WWYA 1E34B 1K1LA 4X8SH 2J5UA 2ZFRH 7GCHF 5HIZA 4JZIA 5F03A 2A45B 3KQ5A 4DVAU 1QRWA 3SNAA 1NS3A 2GD4B 2SGFE 3L3TA 3U8TH 3OFND 4QT8C 3S7KB 1D3PB 1L4ZA 4RT1A 4P02A 4KGAA 1ZGVA 1QURH 3GCHB 3RXOA 5FCKA 5C67A 1FAXA 2TIOA 1TMTH 3DFLA 3OE7D 1VITH 2Q6DA 3SI3H 1DT2A 3RXHA 3JZ1B 2FPZA 2QC2A 1ZMJA 2C90B 1GCTC 2XW9A 3F2GA 3VB7A 2Z3DA 3SUFA 1NFXA 3U98H 5DN6D 2OC8A 2A31A 3BEFB 3GCTF 2HPQH 2IJOB 3RXIA 5PTPA 2O8TA 3ZZ8A 1O2NA 1G9IE 3TJVA 1MQ5A 2BQ7B 2WV9A 3TH2H 2BMGB 4KELA 3E0NB 3QTOH 3ZVAA 1M9UA 1HXFH 4CBNA 4LOYH 1GMDF 1KLTA 1RGQA 3SUEA 2PLXA 1WTGH 1GCDA 2WZQA 4X1SU 3A83A 5CE1A 2K0QA 4AX9H 3LGVA 1JXPA 1VCPA 2VWOA 3SBKA 5A8XA 2ZA5A 1TNKA 3SQHE 3M7TA 1K21H 2FTMA 2VIVA 3OTPA 1XM1A 2IN2A 3AAVA 3PLKA 1Y5AT 2Y7ZA 3KNXA 4WF8A 3SZEA 2B5TB 2Z9LA 3MH6A 4IN2A 1O5BB 4X1QU 2VGCB 1P12E 2PUXB 1G3EA 3E91A 1DITH 1W14U 3PV5A 3A8CA 2C8XB 4FXGH 1Y3YA 3RXEA 3NPSA 1QR3E 5DPAA 2STAE 1QJ7B 2BY6X 4OS2A 3KQDA 4ISHH 4U2WA 2WYJA 1NESE 1YCPH 3QK1A 3CNRA 2TBSA 3SNEA 3GDVA 1SL3A 1QQUA 2W7SA 1OWDA 4CRFA 2ZCLP 1UVTH 1LO6A 2A7CA 2XNDD 5F8ZA 5AVDA 1YM0A 4BOHA 1NZQH 1O2JA 1FAKH 1TB6H 2H9HA 3OX7U 6LPRA 3P6ZB 3T26A 3KL6A 4Y8XA 4XOJA 1BUIA 1H8DH 1LQEA 4MLFB 1E37B 2ZU1A 1XXFA 1TX8A 2G4TA 1ZRKA 1N8OC 1XKBC 3RM0H 1S85A 4ZMAH 1EJMA 1O3OA 4OS4A 1CA0B 1QJ1B 3TK9A 2XOKD 2PGQB 2ZFPH 2QA9E 2I6SA 4AZ2B 4FUJA 5KEDA 3GICB 1LHFH 1AWFH 3A80A 2ZHEH 1A3BH 1WCZA 1TOCB 1HAVA 1LHCH 3LGWA 5C2ZA 2B9LA 2WPLS 2W3IA 1GVLA 2P3UB 1TMBH 2FOGA 3LH1A 2ZG0H 3TJNA 2ZGCA 1FX0B 3GDSA 4FU8A 3FKSD 2FOBA 2CV3A 1GMDG 3FZDA 2IOTA 1W3CA 2QF5A 1O3LA 1IQFA 4RKJB 1O3AA 1RTLA 1DUAA 4ZROA 3ZV8A 4B2AA 1LKAA 3MOCA 3GDUA 3NZIA 3BEIB 4AGKA 2Z9IA 1NRPH 1HUTH 3MWIU 1G32B 1O5DH 4DURA 5EJZA 4A6LA 1C5ZB 1CHGA 2JH5D 3LKWA 1VGCB 2BHGA 4MPXA 3ZVEA 3ESTA 1OS8A 1P9SA 2VIPA 3BTEE 1EP6A 5JDUB 4J1YA 1O3IA 2V3HH 2BVXH 3TGKE 2YNAA 4YLQH 1TLDA 1H4WA 3F9FA 3URDA 1SGYE 1YP9A 3SUGA 1PQAA 2ZDNA 4I8GA 1V2RT 4X2WA 3O8DA 1VGCC 1SGPE 4YO9A 4NIXA 5AHGH 1V2ST 4TY6A 1NFYA 2EI6A 2GT7A 2BD3A 1O2KA 1Y3XA 1MTNB 2BDBA 8GCHF 4D8NA 1JIRA 2QXJA 4ISLA 1BTHH 3O8RA 1AFEH 2VINA 1DSUA 3SHCH 1D3TB 1L1JA 4IS5A 4A92A 4X1RU 3U28C 5DGJA 1O5AB 2BM2A 3D62A 4TYDA 1NO9H 1Z7KA 1GHVH 2ZI2H 4MPWA 4XDEA 2P3TB 4X6PA 1TIOA 4GCHG 8KME2 1TQ7B 1DLKB 3JZ2B 3D65E 3UWJH 3WW7A 2LNCA 1KXBA 4K69A 1T8NA 2KAIA 1BTXA 1O37A 5K0HA 1K1NA 4UONA 1AIXH 3LC5A 1GI1A 1BZXE 1LDTT 2BXUH 1Y8TA 1FJSA 2A1DB 3A82A 1TABE 4R0IA 3FOAA 3FZZA 1TBZH 4A1XA 1YBWA 3N7DA 3SHAH 4ZHLU 2C8WB 3RXPA 2ZDKA 4Y79A 4X1NU 9LPRA 2I6QA 5A0BA 1BTZA 1OWEA 2XCNA 4AC9A 4ISNA 3ODFA 2UUYA 1AKSB 5EIYA 1O5GH 3PV4A 4B2CA 4D76A 3F68H 1P03A 4O03A 1WXRA 5FPTA 1F92A 1O2ZA 1GI0A 1Z8GA 3EE0B 4ZXYH 1YPMH 7GCHG 1EZQA 1E36B 2ZDAH 1EPTC 1ABIH 1QIXB 5CHBA 5A09A 3AASA 4D9RA 2O8WA 1W2KH 3F9GA 3IG6B 3PTBA 2RFKC 1CBWC 4WXIA 4XBDA 4WMEA 3TH4H 4BTUB 5C0UA 5C94A 3F0OA 2ZEBA 5T3HA 2ZQ1A 2WPHS 2KCOA 1C1VH 1BMLA 1SHYA 1V2WT 3PM3A 4CRDA 1QBVH 1GPZA 4KKDA 1S82A 1WQSA 3ZZDA 3RXMA 1OP0A 3ZYDA 1ZZZA 5EXMA 4Y7BA 2EC9H 3OYPA 3SU4A 1FY5A 2FZZA 2GMTC 2BOHB 1IQEA 2BLWA 3DUXH 3FFGA 2F3CE 2O8MA 1DUEA 2G52A 1F5KU 2XC0A 3N99A 1S6LA 1E1QD 1ZSJA 3A86A 1EJAA 1PQ7A 4BXWA 1HAZB 1P04A 2HLDD 1BTPA 2GDDA 4UFGH 3SW2B 1JWTA 2C8YB 1AUJA 2ZFSA 3ITIA 3LOXA 2F9OA 4I31A 1MKWK 4WVPE 4ZCNA 3M5OA 1ELBA 1YY3A 3LU9B 1V2UT 1GHXH 1G3BA 1BTUA 2B7DH 1GHBG 1F5LA 2AIPA 1GJBB 3NKKA 1SLXB 4IC5A 3SNDA 2F9PA 1Q3XA 2BDYA 4DW2U 9ESTA 1TA2A 3RDZA 1QCPA 3SORA 1GHYH 2OC7A 5HGGA 4JK6A 2KZ4A 4UFEH 1OWIA 1T8LA 2H1UA 3QZQA 3PTNA 3H7TA 3TIUA 2ESTE 2HWLB 2VGCC 4THNH 3TITA 2F91A 1N8OB 5DP3A 3MQKC 1O2YA 1O3CA 4ASUD 1MH0A 1V2LT 1DM4B 2HRVA 1BTWA 4ACBA 5JB9S 3E1XB 1ZPZA 2QN5T 1UMAH 5FCRA 4ZUHA 3UOPA 2DE9A 3MNSA 2WINI 1YLCA 1FXYA 1P57B 1SGEE 1BBRK 4M7GA 1C5OH 1H8HD 5IYTA 1DX5M 2BLVA 1CA8B 1OXGA 4Y8ZA 3B9FH 4TPYA 1VZQH 3UTUH 4Y0ZE 3HGPA 4A7IB 1HJAB 2Q6GA 3V3MA 1ETTH 2WPJS 3SV6A 1CO7E 2F9VA 3SJIA 4DT7B 1QBNA 3A8AA 4AORA 1QBOA 3KGPA 4I8LA 1VITF 1ELEE 2H9EH 3P8OA 1E1RD 2QE7D 2V3OH 4CHAB 1E0FD 1HYLA 1XUHA 1YKTA 4SGAE 2OQ5A 7KMEH 3MFJA 1AO5A 3LONA 4U30A 5HIYA 4GHTA 5EPNA 1P0SH 4DIIH 1ZMLA 1GJ6A 1PYTD 4BTIB 2QYIA 3A7YA 2FM2A 2VBCA 3LJOA 1O3NA 1D6WA 3RXJA 1VITG 3Q3YA 4GUXA 1ZPBA 4Y10E 2G8TA 1JOUB 1GG6C 1Y3UA 4FVBA 1MD8A 2BB4A 2Y7XA 5T6FA 1EKBB 3MO3A 1V6DA 2UUFB 1IQHA 1SI5H 2C4FH 3RMLH 1LCYA 1A61H 1FIZA 3FO8D 1PPEE 3P17H 2ALVA 3RU4E 2PP6A 3RXAA 5ABWA 1A0JA 3NCLA 2VH0A 1SGCA 4FUGA 3CS7A 1G3DA 2ZGJA 3KF2A 2AS9A 2PUQH 3BIVH 3BF6H 2FDAA 2A32A 4YOGA 3SV9A 8LPRA 3WY8A 5T6GA 4CBOA 1YLNA 2FI3E 4DGJA 1XUGA 3ATWA 4X8UH 4K8YA 3BTDE 3PROA 2PGBB 1XUJA 4FUIA 2QF4A 1YF4A 1ESBA 3ZIAD 3UNRA 1KYNA 1DVAH 2G4UA 1TFXA 3CS0A 4X6MA 1K1PA 1V2QT 1BITA 2GGVB 1GDQA 3T27A 4E05H 3CP7A 3EDXB 4YT7H 1O3PB 4K2YA 1O2IA 4NWKA 2F4LA 3S0NA 1DWBH 1LHDH 3VXFH 5HM9A 3VGCC 2L6OA 4K8BA 1MQ6A 1A5GH 4NZQA 5FXLA 2KCYA 3BSQA 4JCNA 2FI4E 4FUDA 4JZFH 2XXLA 3SN8A 3E8LA 3SV2H 1EPTB 2PKAA 2EQNA 1DWEH 2YMSB 1AE8H 2AGIX 4DOQA 1YPGH 1ACBE 4KTSA 1GBLA 1HFDA 4JYVH 3SGBE 1HV7A 1P2MA 3BEUA 1EP5A 2AYWA 3OAAD 3SU1A 3ZVFA 1CT0E 3HATH 3TNSA 2CN0H 2J98B 1O31A 1QY6A 1YLDA 2WYGA 3QN7A 1BT7A 1OOKB 5A2MH 4WY3A 3SQEE 1AE5A 1MU6B 2ZDVH 1WU1A 1UVOA 1Z8RA 1GBAA 3UPEA 1HRTH 3BTKE 4CR9A 1FPCH 1NFUA 1SQTA 2CXVA 2ZFQH 2FX6A 1HPGA 1P2JA 2D8WA 1TBQH 1CQQA 1INCA 1P2QA 4NZLA 4B75A 3BTFE 2EI8A 1B0FA 3SU0A 1S0QA 1GG6B 2V7QD 1SQAA 6CHAB 1Z6EA 3UQVA 1LPZB 1CT4E 1A0HB 3LPRA 3RXBA 1MTNC 1DDJA 3PMHB 4ABDA 3SV8A 1PPGE 1ETRH 2XRCA 1UTNA 2BY8X 1XUKA 2Y5GA 3LGIA 2AMPA 2ZDLA 1YCPM 2XBVA 4R8TB 1O2UA 1GVZA 4E06H 1YCPK 1C2DA 2FS9A 2RDEA 3SU5A 2H9TH 2OP9A 3BTME 1EATA 5C3NA 2BDHA 1MZAA 4B74A 1QL9A 3TJOA 4XD7D 4BAHB 2JETC 1J17T 1PJPA 3QTVH 1WQVH 5G4BA 2BD7A 2FXRA 5DP8A 4K3JA 3PMAB 1XMNB 2GP9B 2BX4A 1YPKH 1PPCE 1A7SA 3TK6A 2G00A 1GHZA 3AW0A 3EE7A 2D2DA 5LPRA 1HAPH 2VVCA 3UY9A 4NA7A 2Y81A 3O8BA 1VCQA 3SGAE 1O33A 1PPHE 2ANKH 3MU5A 5KECA 1YPLH 1KDQB 3RXLA 2J4IA 4YTAA 1G2MA 1S6HA 1C1QA 4FUEA 4MPUA 1W0YH 2KCAA 1QA0A 1KIGH 2W5EA 1ANBA 3AAUA 1AVWA 3OSYA 1C5VA 1BHXB 4H42U 1JIMA 1WTHD 3V13A 4F55A 2G51A 5DKMA 1IHSH 3SJ9A 3LT3A 1IOEA 5EW2H 1O3DA 4AGJA 2ZP0H 2GZ7A 4IN1A 1MKXH 4ZHMU 5I46H 3SO3A 3Q00A 5FBIA 2R3YA 4RSPA 5L2YH 1K0HA 3M35A 1KXDA 1E35B 1MTUA 4NWLA 1RTKA 1THRH 3M37A 3FVFB 4UE7H 1P3EA 3DSOA 1BMFD 1AU8A 2EI7A 3M7QA 5KGOA 4B1TA 1BJUA 1WDIA 1BA8B 1D3QB 1MKWH 2TGTA 5LPEA 1C5WB 1GJCB 1MCVA 3SU6A 1J9CH 4WXVA 4LK4A 4MNWA 4NA9H 5HKKD 1S0RA 1DS2E 1PPBH 3RMMH 1AVGH 1NY22 1GL0E 1ZTJA 1TRNA 1O2GH 2Z6BD 4TY7A 1KTTB 2BTCE 1IQNA 1TNIA 1C2IA 1IQLA 2J95A 4X8TH 2QXGA 2VIQA 3F2FA 4AFZA 3MMGA 2BY5X 5F6MA 2HALA 2AFQB 2CHAB 2NU2E 1MKXK 4YZUA 1K1IA 4CREA 3MU8A 3WWBA 1GCTB 3SJOA 3KEEA 5EG4A 5EJLA 1KLJH 3LGUA 2P3FH 2Z3CA 2ZIQH 1GBKA 2ZHWH 5JBTA 3EA9A 1P2IA 5DP6A 4Q63A 1W7GH 1CVWH 3KQBA 3LGTA 2V35A 1V2TT 2BX3A 1RRKA 3BN9A 3SGQE 1TGNA 2ZNKH 4GCHF 4GVUA 1MD7A 2W7UA 2AMDA 2J38A 1C1TA 1HAYB 6GCHF 1S5SA 1RXPA 1AN1E 1MBQA 1BRBE 4ABAA 1L1NA 2ZKSA 3T62A 1ARBA 1ELAA 1SGRE 3B8JA 2VU8E 1P06A 2YNBA 1BB0B 1H9LB 3DA9B 3GY3A 2WPDD 1AVXA 1JBUH 4ABHA 2GJGA 1CGHA 1B0EA 3ATLA 1RIWB 1IAUA 4GPGA 4A1VA 1GMHG 1O2RA 1ZMNA 4IC6A 2XTTB 1CU1A 2AIQA 3GY8A 3T25A 1Z71A 1T4VH 2P16A 3TNTA 1LHEH 1RD3B 2ZTZA 4NIVA 1ELVA 1Q31A 1SGNE 1FMGA 2ZFTA 1CE5A 4DY7B 5LH8A 1ZSKA 1P11E 5FPSA 3P8GA 3MH4A 2GCHF 2RDLA 4D7FA 2KCPA 3F0PA 3ELAH 1WAYB 3BG8A 4LXBH 1KXCA 3P8NA 3QO6A 2HOBA 3KYGA 5F53A 4Y0YE 4K5ZA 5FX5A 1NRQH 3OY5U 1OHHD 1VJAU 4Y8YA 4Z1MD 1P3CA 2FOAA 3AVZA 1CSOE 3TVJB 1G36A 1QNJA 1VCWA 3RXUA 1UK3A 3VFEA 2AH4X 2R3UA 2SGQE 3TPIZ 2O9QA 2QV1A 1LVOA 1KY9A 2A7JA 1O2TA 4DIHH 4UFFH 4ASHA 1EAIA 4H4FA 1QB6A 5IDKA 3S9BA 5F8TA 3M5MA 1NT1A 4FUHA 3PO1C 5C1XA 5C5NA 3RUOA 3UWIA 1ARCA 1C9TA 2V0BA 1NM6A 5BRRE 4XBBA 2OXSA 2BVSH 3Q3KA 3N7OA 2Y5HA 1F5RA 2EEKA 5HYOA 1V2PT 1QFKH 3A7VA 4I8JA 2PHBA 2FO9A 1LPGB 5ETXA 4KTCA 2HNTF 1NRRH 3SNBA 4ZH8A 4I86A 5DP9A 4RI0A 1SKYE 3PYHA 5I25A 4TSFD 1F0SA 2HNTC 3LDXH 1EFRD 1HIAA 1OKXA 1K28D 3UOUA 4M9FA 1TAWA 5AFZH 3RXTA 1GI6A 2ANMH 1V2NT 5GWZA 3GY4A 3VEQB 2ZHFH 4H6SB 4Z0KA 1A46H 4WJG2 4WMDA 1P05A 3TGJE 1AKSA 1H9HE 3K2UA 1LMWB 1V2JT 8GCHG 5T1VA 1O2XA 1TALA 3Q76A 3DFJA 1UVUH 1OWHA 1ETSH 5DP4A 2F9UA 1EOLA 2A7HA 3MH7A 1EZUC 1O3HA 4PROA 5K7RA 1CHOG 1Z1IA 1MTSA 4AFQA 2XBYA 2Y80A 1WBGB 1SGIB 4GSOA 3U1JB 1O3GA 1SLWB 1GHAG 2ZU2A 4CR5A 8ESTE 5EU8A 3RXFA 2P8OC 1Y5UT 4FVDA 3Q77A 3MNXA 1XVOA 3ZZ6A 1J14A 4AB9A 2B0FA 3VXEH 1C4Y2 3QDZB 1RIWC 2VJ1A 2Z9JA 1C1WH 3OEHD 1TPPA 3SNCA 1ZHMA 5TJXA 3S69A 3DSGA 1FZZA 1VJ9U 5A8YA 1NPMA 1GL1A 1GGDB 5C20A 2BD4A 2O8UA 2A5KA 3QGNB 1QA7A 2FIRH 1ZPCA 2J34A 3SU3A 1JRTA 1W11U 3GY5A 2FLBH 2QAAA 1KMHB 2ZDMA 2FP7B 3ZZ3A 2GX4A 2IJD1 4X6NA 4P00A 4X0WU 1PPZA 1GGDC 5E0JA 4HZHA 2L74A 4O3UA 2GVFA 2C93B 4DJZB 2JIZD 2O8LA 1CA0C 1P09A 1TGSZ 1UTOA 1TNLA 4Y6DA 4MPVA 3RXQA 3GCNA 2FTLE 3RLWH 3M5NA 3A87A 3KHVA 5E0GA 4Q2KA 1MCTA 5A0CA 2LPRA 3S9CA 3SJKA 1C2HA 2KM0A 1UTPA 1S81A 2BQ6B 3T29A 2LP6A 1O5EH 2STBE 1CBWB 4RKOB 5EW1H 2UUKB 1LVMA 4ZXXH 1SQOA 2PTNA 1YGCH 3K9XB 4K60A 4INLA 4BXSA 1HAIH 1XUIA 3BG4B 4RN6A 1PQ8A 3EYDA 1CT2E 2ANWA 2CJIA 1ANDA 1NN6A 1N6XA 1F2SE 2UWOA 3P95A 3D23A 2FS8A 2J94A 1SMFE 2GCHG 3UFAA 4ABBA 1GI8B 2QXHA 2VIDA 4K1SA 1DANH 5LGOA 4TWWA 1O38A 2W6ID 4XBCA 3A8DA 2GMTB 4WMFA 3FANA 1SGDE 1AB9C 1WYKA 2C8ZB 1GHBF 2SNVA 2VNTA 1L2EA 3FP7E 5DP5A 1BBRE 1J8AA 2VIWA 1P9UA 1W0KD 1UCYE 1NBME 4B71A 1K1OA 2SGDE 3PLBA 1UK4A 4AG1A 4ZKNU 2Y5FA 2YOLA 1UHBB 2FWWA 1LKBA 2ZECA 2WUCA 1FUJA 2ZCKP 2JETB 5EODA 2XWBI 1GBIA 2FYRA 3IWMA 1T31A 2ANYA 6ESTA 1Z8IB 2ZCHP 3RXVA 1EAWA 3URCA 4B76A 2W26A 1ZHRA 2ZF0H 1K22H 5B6OA 1E38B 2RCEA 3KYFA 1JRSA 2PR3A 2KAIB 2WPKS 4Q4LA 3UNSA 1UTQA 1V2MT 5E0HA 2XBWA 1ESAA 2ZHDA 2Y6TA 2OC1A 2UWLA 1C5XB 1WSSH 1YPEH 3RXGA 1SSXA 2HLCA 3VB3A 3PWBA 2VWNA 4F4OC 2UUJB 3LGYA 4GHQA 3QUMP 1C5QA 1SGTA 4ACAA 2ZGBH 1HIAB 4FU9A 4IMZA 1KXFA 2DUCA 2IPQX 5J4QA 1O3MA 2OQUA 3W1EA 3RXDA 1GBEA 4GLYA 3ATIA 3BV9B 3DSPA 3ENSB 1GBCA 1SB1H 3NXPA 2VVVA 1CHOF 1Z6JH 4I8HA 4IBLH 1GJ5H 2A5AA 4WH8A 2QY0B 1KSNA 4FUFA 4AFSA 4AFUA 1WUNH 4ABFA 2J97A 2BDCA 1TPSA 1YYY1 3M3SA 5DO4H 1A0LA 4I7YH 1TWXB 1TNHA 1F0TA 1H8IH 3PRBA 2UWPA 3GCHC 4XFQA 1QHRB 3GYLB 4BAQB 1Y5BT 1ZR0A 1OX1A 5FX6A 1RJXB 2OC0A 1GJ8B 1T8OA 3UQOA 3M61U 1AB9B 3SYJA 1T32A 2G5VA 2R0LA 5B6LA 3PO1B 2H6MA 1C1RA 2ZPSA 4O97A 4DG4A 3DHKH 1IQGA 1IQIA 1SHHB 2H2ZA 3FAOA 4BAKB 3A7XA 3SI4H 1EZXC 2A4QA 1C2FA 3ZZ7A 4UD9H 2ODYB 5ESTE 3MNCA 1CGJE 1GMCG 1UO6A 2BDIA 5HM2A 1IHTH 3FN8A 3GS9A 4AG2A 1T7CA 1O39A 3LIWA 2P93A 3U9AH 3O8CA 2JKHA 1DOJA 4NIWA 3RC4A 1C5MD 5FL7D 1GVKB 1COWD 2JH6D 1K2I1 2ODQA 4UEHH 4AN7A 3TJUA 1TRMA 2OCVB 3BIUH 5A8ZA 1P10A 1QGFA 1HGTH 2VVUA 4FUBA 1GMCF 3MU4A 3AW1A 4B6FA 5FPYA 3ZVBA 3A88A 1ELGA 2AMQA 2CF8H 3UAIC 2G55A 3I77A 1BJVA 2ZC9H 1LVBA 1SPJA 1C2GA 3F9EA 3GY6A 5J4SA 1NTPA 1UTMA 4X1PU 2XCFA 1LHGH 2HVYB 3Q3XA 1BMAA 1OWJA 3HGNA 1MTWA 2BD5A 1YPJH 3S7HB 2WHXA 2FOMB 3MTYA 4ZAEA 1C5LH 1SGQE 1TNJA 2M5TA 2PTCE 1C4U2 3ZVDA 3RLYH 3MNBA 1UHBA 1SGFA 4NG9H 3HK3B 3RXRA 2ZGHA 1GMHF 3ZVCA 1L1GA 1W0JD 1X7AC 5EQSA 1GWAA 4HG6A 3STJA 2AHME 2ILNA 1FDPA 1C9PA 1FI8A 5H4IB 4U01A 3LJJA 1ELCA 5DP7A 2PKAB 2FODA 1DFPA 3F1SB 2FOFA 3H5CB 2NU1E 3M7UA 1W13U 1GJAB 2YMSC 4OS1A 2VWMA 5EXNA 2OBOA 2J9NA 1SC8U 1SLUB 2QF3A 3ODDA 1PQ5A 5GPIB 1SFIA 2XBXA 1EB2A 2WV4A 3A89A 3B23B 2AERH 3QGJA 5L2ZH 1AY6H 1HAXB 1GI5A 4B2BA 4INKA 4CRBA 1C5PA 1Y3VA 5FHTA 1SOZA 2Z9KA 3PWCA 3F6UH 2TGPZ 1GI3A 1BRAA 1ESTA 4JYTA 7LPRA 3C27B 3UREA 3L33A 2GT8A 3RU4D 1C5NH 4BAMB 1EAXA 4FOUC 1A5IA 3GY2A 4FETA 1FLEE 4FU7A 4AYVB 1MUEB 5AF9H 5C0TA 1XX9A 4TWYA 1GDNA 3RXCA 1DLEA 2ZPQA 1BMNH 1OP8A 1EUFA 3U69H 1LVYA 1Z8JB 4Z6AH 2R2WU 2GKVE 3SOSA 2FOEA 4RT0A 4INHA 3KQEA 2CMYA 3F3BA 1G2LA 1FQ3A 3HKJB 4AB8A 1D9IA 5CHAC 4IGDA 4O3TA 1RTFB 1MZDA 1ANCA 1UVSH 1C1PA 1O35A 2PFEA 3MYWA 5ESBA 3OEED 2H5DA 1P2NA 1WV7H 4ZHAA 1ZGIA 1C2JA 1GDUA 1BTYA 6CHAC 2AEIH 4BNRA 1DWCH 5DG6A 5HMAA 2FI5E 4E7RG 3RMNH 2BY7X 1TQ0B 4X8VH 1GBBA 2QCYA 2P59A 4MNYA 1O36A 3EAJA 2ALPA 4VGCB 3UR6A 4CH2B 3IITA 1HJ9A 1SVPA 2PKSB 4MVNA 4OS7A 2WPMS 4VGCC 1G37A 1F7ZA 1O2QA 3D49H 2BQWB 3NUMA 3S9AA 1GBDA 2PV9B 1OYQA 1W0ZU 4HFPB 1KXEA 1T4UH 1HAGE 1C2MA 2SFAA 1EOJA 5LPFA 3V0XA 1AQ7A 3MU1A 1THPB 1GI7B 1MAXA 3TH3H 4ESTE 1SFQB 3MI4A 4CRAA 1ZJKA 2HVXA 1BCUH 3BTWE 4XRNA 2SGEE 2BDAA 2OBQA 5CMXH 2AGGX 1TOMH 1MU8B 1WOFA 4IW4E 3ZZ4A 4HGCA 1HXEH 1NRNH 4I33A 2ZWLH 1DY9A 2RA0A 1O2HA 1BBRH 1FY4A 3E6PH 1GI9B 2THFB 3A7WA 1AZZA 1GJ7B 3AK5A 3A7TA 4JZDH 1IQMA 2F43B 3TK5A 2A0QB 2W6JD 1C1UH 2ZU3A 4YOIA 1FV9A 2BZ6H 3ATKA 2A4RA 2BD9A 1AI8H 3RU4T 3QWCH 4X2XA 1DXWA 3GISB 1IQJA 1TE0A 1B7XB 2JDID 3F2HA 2NWNA 2TGDA 4YM9A 1FN8A 1KXAA 2D26C 2GV6A 1C5UA 1C2EA 3HKIB 4WH6A 1BDAA 2FLRH 1PYTC 2BYAX 5C5OA 1ZJDA 1K1MA 1OP2A 3H7OA 5C1UA 3K6ZA 3T5FH 1EB1H 2A5IA 2Y82A 3STIA 3MU0A 1QB1A 4Q7YA 1OSSA 4XSKU 3EA7A 4NSVA 2VB0A 1J15A 1L4DA 1UJ1A 5CHAB 1QL7A 1P2OA 5GXPA 2EA3A 3RXKA 5EJ1A 5L30H 2KFWA 3MHWU 2A4OA 1KLIH 3ZZCA 3FP8E 5C1YA 1ELTA 1FIWA 2GDEH 1ZTLA 3KIDU 1TONA 2QIQA 4YT6H 1DY8A 1ELFA 1F0UA 1LPKB 1FPHH 1V3XA 1D4PB 3ATMA 2CHAC 1GJ9B 2V3MA 4ABEA 2R9PA 3PB1E 3T28A 1U6QA 2F9NA 4CRCA 2GTBA 3BTQE 4ISIH 2CGAA 3UNQA 3QZRA 3L6PA 3TGIE 1DICA 2WV5A 1A1RA 4ZKSU 4O9VA 1EJNA 3ZZ5A 2NU4E 4DCDA 4DT4A 1YWUA 2P94A 2ZPRA 4A5TS 4U32A 1GJ4H 2F83A 4JZ1A 3A84A 3SV7A 4TPIZ 1AHTH 2PKSC 1UTJA 3H09A 5GJ4B 3NWUA 1EX3A 1A5HA 5T6DA 2XC4A 1Y3WA 1S6FA 1ORFA 1QRXA 2WSSD 3DT0H 5GIBA 1BOQA 1O3FA 5AFYH 2OUAA 1C1MA 1QTFA 3A7ZA 1QJ6B 3EGKH 2ASUB 3NRLA 1A3EH 1W12U 1OWKA 2G5NA 3LC3A 4J2YB 2Q1JA 1O2SA 4Q80A 1GBTA 2PWXA 3E3TA 1EXFA 4H6TA 2ZZUH 3DCLA 3GCTG 2HPPH 1FONA 2HNTE 7ESTE 3HK6B 1SLVB 4X2VA 3MO6A 3BTTE 2RG3A 4MNXA 1P8VC 2CF9H 1GBFA 5SGAE 1BIOA 1O2PA 3KQCA 3ZYEA 2A2XH 5JBCS 3ZZAA 5GCHG 1FNIA 1ZRBA 4D7GA 1P2KA 5DK1A 2R0KA 1GI4A 3OTJE 2NU3E 1O3BA 1C5YB 2A4GA 3C1KA 3M3VA 1ZYOA 2FYQA 1GBMA 3SJ8A 1O2MA 3P92A 1O0DH 1ABJH 1GHAF 1HJ8A 3BTGE 3ZZ9A 4CRGA 2RA3A 4F48B 1MABB 4GAWA 2ZTYA 2IPHA 1HBTH 2XC5A 4NGAH 3N7EA 1S83A 4K1TA 3R3GB 6GCHG 1C1SA 3T2NA 2HGTH 3SUDA 3MH5A 1UTLM 4Y71A 3TU7H 1MMJN 1P01A 1S84A 2TRMA 3G01A 3RP2A 4B73A 4TT3D 1MTVA 2ZGXH 1AWHB 1SG8B 3F9HA 1C5SA 1FN6A 1NC6A 4Q7XA 5E8EH 3PRDA 2KX4A 3K65B 1A2CH 1AZ8A 1TBRH 3PMBB 4I8KA 1TA6A 5HXFA 4MNVA 1K1JA 5BPEA 4CHAC 3P8FA 2CK3D 3KCGH 1T8MA 5IK2D 2B8OH 2G81E 3R0FA 4ZKRU 1CGIE 1FY8E 5TCAA 1ZLRA 2FOHA 3FP6E 2OLGA 3RC6A 3GCOA 1O30A 1RFNA 1O2WA 5EXLA 2BVRH 2PSXA 2GCTC 4OGYA 1ANEA 1RS0A 4A1TA 1D6RA 3PMJA 3UR9A 2BD2A 2TPIZ 5JYIA 2PSYA 1HAHH 1H1BA 2AGEX 2BLQA 4JMYA 2XYAA 1DE7H 1W7XH 2SGAA 1O3KA 3A81A 2J2UA 2XNIA 1OYTH 1TRYA 1HB0B 1BRUP 5E2OA 3ZV9A 2BY9X 3P70B 2KR7A 1BHXF 2A2QH 3EQ0H 1NU7B 1UCYK 2SNWA 1TGTA 1V2OT 2M2AA 1G30B 2EY4C 4OS6A 4HI3A 4BAOB 1THSH 1TPAE 1ELDE 1H8ED 2BXTH 2QF0A 3VB4A 4NA8A 1BMMH 3NK8A 1C4V2 1N1LA 1QL8A 4YLUA 1O2LA 1UVPA 2XWAA 2QXIA 1AGJA 1VKYA 1HAOH 4NCYA 1SOTA 1HNEE 1XUFA 3GOVB 2BD8A 1QB9A 1PFXC 2J92A 2Z9GA 1YC0A 2D1JA 2GZ8A 4OS5A 1BQYA 5FBEA 1PPFE 1VR1H 3RMOH 1HAVB 4CH8B 2Q6FA 3A8BA 2OK5A 1GJDB 2F9BH 1EQ9A 2OD3B 2VWLA 2ZHQH 1KDQA 4ABGA 2H5CA 2Z94A 4MDSA 1Z1JA 2GV7A 2GZ9A 1GHWH 1C2KA 1LQDB 2Z7FE 3W94A 4OM9A 3GY7A 3VB6A 1UCYH 1G3CA 2BDGA 3RXSA 5JBAS 1GI2A 2WUBA 4AYYB 1OPHB 2NU0E 1QRZA 1NU9A 2K8IA 4NIYA 1XVMA 1DSTA 1AUTC 3LH3A 1P02A 3RC5A 5FAHA 1L0ZA 1HDTH 1AMHA 1O32A 2LELA 4BTTB 2ZU5A 2ZU4A 1SGFG 2R2MB 2FESH 4JYUH 4Y7AA 1NRSH 4SGBE 3VPKA 1AD8H 2QGRA 1XKAC 3HPTB 5F8XA 3I29A 5GDSH 2JJ1D 3QX5H 4NSYA 4MG3A 3U8RH 3U1IB 3CENA 1E79D 2ZFFH 4KTUA 1UTKA 3U8OH 3E0PB 1C5RA 1H9IE 2OINA 3MO9A 2FX4A 3ZZBA 1C2LA 5E2PA 1GBHA 1YPHC 2C3SA 4NFEA 4X2YA 3A85A 4E7NA 3M3TA 3DD2H 1NFWA 5GNDA 4JK5A 2ZO3H 3W95A 1ZHPA 1AFQC 1TX7A 5EOKA 1GBJA 3GYMA 2VIOA 1MAYA 2FMJA 3UB0A 1V2KT 3OU0A 3EA8A 4ABJA 2K1QA 4KP0A 5JBBS 1XXDA 4IMQA 4ZKOU 3M36A 2ODPA 2J98A 2YMSD 3BG4C 1DPOA 1TGCA 1AFQB 1SQRA 1C1OA 4F49A 4MQAA 4XE4A 1SBWA 1O2OA 3V7TA 1JMOH 2GCTB 3KN2A 2V6NA 3M5LA 3UUZA 2PW8H 5EQQA 3WWFA 2JJ2D 3E16B 1F0RA 2FOCA 4Q7ZA 5EQRA 1EPTA 1KTSB 1N6YA 1A4WH 1K9OE 5CDFE 1DXPA 1TYNA 1TGBA 1TNGA 1W8BH 1EASA 1W10U 1FY1A 1BRCE 1D3DB 1O3JA 4YOJA 1ZSLA 3BTHE 2W3KA 1ZTKA 3SU2A 5TCCA 2P8OB 3TLOA 2BOKA 2TGAA 1SR5C 1UW7A 2FEQH 2JH0D 4Y76A 1NROH 3VB5A 1Q2WA 5DJ7A 1HLTH 5EPYA 1LTOA 5L6NH 4BANB 1QQ4A 1MBMA 2ULLA 2ZQ2A 5GCHF 3ZVGA 3VG8A 3K6YA 2WPIS 4X6OA 3E90B 1J16A 4B6EA 1TMUH 1TX6A 2OTVA
chains in the Genus database with same CATH topology
2P95A 3UIRA 1Y59T 4K1EA 5JB8S 4I32A 5JPMH 4UFDH 3VGCB 1EAUA 4HTCH 1C5TA 1ID5H 1HCGA 4ABIA 5EGMA 4NFFA 2ZTXA 4LZ1H 1O34A 1O3EA 1IQKA 1V2VT 4Y11E 4LZ4B 4ISOA 1O5CB 4FUCA 1TPOA 1C1NA 1O2VA 2VH6A 2BZAA 2DE8A 1UK2A 3RM2H 4OGXA 4D9QA 2SGPE 1DWDH 1YPHE 3SZNA 3OY6U 1ZOMA 4UDWH 4MTBA 3PLPA 3I78A 4AOQA 3V12A 1FY3A 1B5GH 2Z3EA 5A0AE 4YESB 3QLPH 2BLOA 1EZSC 4JZEH 1HJAC 1O5FH 4WWYA 1E34B 1K1LA 4X8SH 2ZFRH 7GCHF 4JZIA 5F03A 2A45B 4DVAU 1QRWA 3SNAA 1NS3A 2GD4B 2SGFE 3L3TA 3U8TH 4QT8C 3S7KB 1D3PB 1L4ZA 4KGAA 1ZGVA 1QURH 3GCHB 3RXOA 5FCKA 5C67A 1FAXA 2TIOA 1TMTH 3DFLA 1VITH 2Q6DA 3SI3H 1DT2A 3RXHA 3JZ1B 2FPZA 2QC2A 1ZMJA 2C90B 1GCTC 2XW9A 3VB7A 2Z3DA 3SUFA 1NFXA 3U98H 2OC8A 2A31A 3BEFB 3GCTF 2HPQH 2IJOB 3RXIA 5PTPA 2O8TA 3ZZ8A 1O2NA 1G9IE 3TJVA 1MQ5A 2BQ7B 3TH2H 2BMGB 4KELA 3E0NB 3QTOH 3ZVAA 1M9UA 1HXFH 4CBNA 4LOYH 1GMDF 1KLTA 1RGQA 3SUEA 2PLXA 1WTGH 1GCDA 4X1SU 3A83A 5CE1A 4AX9H 3LGVA 1JXPA 1VCPA 2VWOA 3SBKA 5A8XA 2ZA5A 1TNKA 3SQHE 3M7TA 1K21H 2FTMA 2VIVA 1XM1A 2IN2A 3AAVA 3PLKA 1Y5AT 2Y7ZA 3KNXA 4WF8A 2B5TB 2Z9LA 3MH6A 4IN2A 1O5BB 4X1QU 2VGCB 1P12E 2PUXB 1G3EA 3E91A 1DITH 1W14U 3A8CA 2C8XB 4FXGH 1Y3YA 3RXEA 3NPSA 1QR3E 5DPAA 2STAE 1QJ7B 2BY6X 4OS2A 3KQDA 4ISHH 4U2WA 2WYJA 1NESE 1YCPH 3QK1A 2TBSA 3SNEA 3GDVA 1SL3A 1QQUA 2W7SA 1OWDA 4CRFA 2ZCLP 1UVTH 1LO6A 2A7CA 5F8ZA 5AVDA 1YM0A 4BOHA 1NZQH 1O2JA 1FAKH 1TB6H 2H9HA 3OX7U 6LPRA 3P6ZB 3T26A 3KL6A 4Y8XA 4XOJA 1BUIA 1H8DH 1LQEA 4MLFB 1E37B 2ZU1A 1XXFA 1TX8A 2G4TA 1ZRKA 1N8OC 1XKBC 3RM0H 1S85A 4ZMAH 1EJMA 1O3OA 4OS4A 1CA0B 1QJ1B 3TK9A 2PGQB 2ZFPH 2QA9E 2I6SA 4AZ2B 4FUJA 3GICB 1LHFH 1AWFH 3A80A 2ZHEH 1A3BH 1WCZA 1TOCB 1HAVA 1LHCH 3LGWA 5C2ZA 2B9LA 2WPLS 2W3IA 1GVLA 2P3UB 1TMBH 2FOGA 3LH1A 2ZG0H 3TJNA 2ZGCA 3GDSA 4FU8A 2FOBA 2CV3A 1GMDG 3FZDA 2IOTA 1W3CA 1O3LA 1IQFA 4RKJB 1O3AA 1RTLA 1DUAA 4ZROA 3ZV8A 4B2AA 1LKAA 3MOCA 3GDUA 3NZIA 3BEIB 4AGKA 2Z9IA 1NRPH 1HUTH 3MWIU 1G32B 1O5DH 4DURA 4A6LA 1C5ZB 1CHGA 2JH5D 3LKWA 1VGCB 2BHGA 4MPXA 3ZVEA 3ESTA 1OS8A 1P9SA 2VIPA 3BTEE 1EP6A 5JDUB 4J1YA 1O3IA 2V3HH 2BVXH 3TGKE 2YNAA 4YLQH 1TLDA 1H4WA 3F9FA 3URDA 1SGYE 1YP9A 3SUGA 1PQAA 2ZDNA 4I8GA 1V2RT 4X2WA 3O8DA 1VGCC 1SGPE 4YO9A 4NIXA 5AHGH 1V2ST 4TY6A 1NFYA 2EI6A 2GT7A 2BD3A 1O2KA 1Y3XA 1MTNB 2BDBA 8GCHF 4D8NA 1JIRA 2QXJA 4ISLA 1BTHH 3O8RA 1AFEH 2VINA 1DSUA 3SHCH 1D3TB 1L1JA 4IS5A 4A92A 4X1RU 5DGJA 1O5AB 2BM2A 3D62A 4TYDA 1NO9H 1Z7KA 1GHVH 2ZI2H 4MPWA 4XDEA 2P3TB 4X6PA 1TIOA 4GCHG 8KME2 1TQ7B 1DLKB 3JZ2B 3D65E 3UWJH 2LNCA 1KXBA 4K69A 1T8NA 2KAIA 1BTXA 1O37A 5K0HA 1K1NA 4UONA 1AIXH 3LC5A 1GI1A 1BZXE 1LDTT 2BXUH 1Y8TA 1FJSA 2A1DB 3A82A 1TABE 4R0IA 3FZZA 1TBZH 4A1XA 1YBWA 3SHAH 4ZHLU 2C8WB 3RXPA 2ZDKA 4Y79A 4X1NU 9LPRA 2I6QA 5A0BA 1BTZA 1OWEA 2XCNA 4ISNA 3ODFA 2UUYA 1AKSB 1O5GH 3PV4A 4B2CA 4D76A 3F68H 1P03A 4O03A 5FPTA 1F92A 1O2ZA 1GI0A 1Z8GA 3EE0B 4ZXYH 1YPMH 7GCHG 1EZQA 1E36B 2ZDAH 1EPTC 1ABIH 1QIXB 5A09A 3AASA 4D9RA 2O8WA 1W2KH 3F9GA 3IG6B 3PTBA 1CBWC 4WXIA 4XBDA 4WMEA 3TH4H 4BTUB 2ZEBA 5T3HA 2ZQ1A 2WPHS 1C1VH 1BMLA 1SHYA 1V2WT 3PM3A 4CRDA 1QBVH 1GPZA 4KKDA 1S82A 1WQSA 3ZZDA 3RXMA 1OP0A 3ZYDA 1ZZZA 5EXMA 4Y7BA 2EC9H 3OYPA 3SU4A 1FY5A 2FZZA 2GMTC 2BOHB 1IQEA 2BLWA 3DUXH 3FFGA 2F3CE 2O8MA 1DUEA 2G52A 1F5KU 2XC0A 1ZSJA 3A86A 1EJAA 1PQ7A 4BXWA 1HAZB 1P04A 1BTPA 2GDDA 4UFGH 3SW2B 1JWTA 2C8YB 1AUJA 2ZFSA 3ITIA 3LOXA 2F9OA 4I31A 1MKWK 4WVPE 3M5OA 1ELBA 3LU9B 1V2UT 1GHXH 1G3BA 1BTUA 2B7DH 1GHBG 1F5LA 2AIPA 1GJBB 3NKKA 1SLXB 4IC5A 3SNDA 2F9PA 1Q3XA 2BDYA 4DW2U 9ESTA 1TA2A 3RDZA 1QCPA 3SORA 1GHYH 2OC7A 5HGGA 4JK6A 4UFEH 1OWIA 1T8LA 2H1UA 3QZQA 3PTNA 3H7TA 3TIUA 2ESTE 2HWLB 2VGCC 4THNH 3TITA 2F91A 1N8OB 5DP3A 1O2YA 1O3CA 1MH0A 1V2LT 1DM4B 2HRVA 1BTWA 5JB9S 3E1XB 1ZPZA 2QN5T 1UMAH 5FCRA 4ZUHA 3UOPA 2DE9A 3MNSA 2WINI 1YLCA 1FXYA 1P57B 1SGEE 1BBRK 4M7GA 1C5OH 5IYTA 1DX5M 2BLVA 1CA8B 1OXGA 4Y8ZA 3B9FH 4TPYA 1VZQH 3UTUH 4Y0ZE 3HGPA 4A7IB 1HJAB 2Q6GA 3V3MA 1ETTH 2WPJS 3SV6A 1CO7E 2F9VA 3SJIA 4DT7B 1QBNA 3A8AA 4AORA 1QBOA 3KGPA 4I8LA 1VITF 1ELEE 2H9EH 3P8OA 2V3OH 4CHAB 1E0FD 1HYLA 1XUHA 1YKTA 4SGAE 2OQ5A 7KMEH 3MFJA 1AO5A 3LONA 4U30A 4GHTA 5EPNA 1P0SH 4DIIH 1ZMLA 1GJ6A 1PYTD 4BTIB 2QYIA 3A7YA 2FM2A 3LJOA 1O3NA 1D6WA 3RXJA 1VITG 3Q3YA 4GUXA 1ZPBA 4Y10E 2G8TA 1JOUB 1GG6C 1Y3UA 4FVBA 1MD8A 2BB4A 2Y7XA 5T6FA 1EKBB 3MO3A 1V6DA 2UUFB 1IQHA 1SI5H 2C4FH 3RMLH 1LCYA 1A61H 1FIZA 1PPEE 3P17H 2ALVA 3RU4E 3RXAA 5ABWA 1A0JA 3NCLA 2VH0A 1SGCA 4FUGA 3CS7A 1G3DA 2ZGJA 3KF2A 2AS9A 2PUQH 3BIVH 3BF6H 2FDAA 2A32A 4YOGA 3SV9A 8LPRA 3WY8A 5T6GA 4CBOA 2FI3E 4DGJA 1XUGA 3ATWA 4X8UH 4K8YA 3BTDE 3PROA 2PGBB 1XUJA 4FUIA 1YF4A 1ESBA 3UNRA 1KYNA 1DVAH 2G4UA 1TFXA 3CS0A 4X6MA 1K1PA 1V2QT 1BITA 2GGVB 1GDQA 3T27A 4E05H 3CP7A 3EDXB 4YT7H 1O3PB 4K2YA 1O2IA 4NWKA 3S0NA 1DWBH 1LHDH 3VXFH 5HM9A 3VGCC 4K8BA 1MQ6A 1A5GH 4NZQA 5FXLA 3BSQA 4JCNA 2FI4E 4FUDA 4JZFH 2XXLA 3SN8A 3E8LA 3SV2H 1EPTB 2PKAA 1DWEH 1AE8H 2AGIX 4DOQA 1YPGH 1ACBE 4KTSA 1GBLA 1HFDA 4JYVH 3SGBE 1HV7A 1P2MA 3BEUA 1EP5A 2AYWA 3ZVFA 3SU1A 1CT0E 3HATH 3TNSA 2CN0H 1O31A 1QY6A 1YLDA 2WYGA 3QN7A 1BT7A 1OOKB 5A2MH 4WY3A 3SQEE 1AE5A 1MU6B 2ZDVH 1WU1A 1UVOA 1Z8RA 1GBAA 3UPEA 1HRTH 3BTKE 4CR9A 1FPCH 1NFUA 1SQTA 2CXVA 2ZFQH 2FX6A 1HPGA 1P2JA 2D8WA 1TBQH 1CQQA 1INCA 1P2QA 4NZLA 4B75A 3BTFE 2EI8A 1B0FA 3SU0A 1S0QA 1GG6B 1SQAA 6CHAB 1Z6EA 3UQVA 1LPZB 1CT4E 1A0HB 3LPRA 3RXBA 1MTNC 1DDJA 3PMHB 4ABDA 3SV8A 1PPGE 1ETRH 2XRCA 1UTNA 2BY8X 1XUKA 2Y5GA 3LGIA 2AMPA 2ZDLA 1YCPM 2XBVA 4R8TB 1O2UA 1GVZA 4E06H 1YCPK 1C2DA 2FS9A 3SU5A 2H9TH 2OP9A 3BTME 1EATA 5C3NA 2BDHA 1MZAA 4B74A 1QL9A 3TJOA 4BAHB 2JETC 1J17T 1PJPA 3QTVH 1WQVH 5G4BA 2BD7A 2FXRA 5DP8A 4K3JA 3PMAB 1XMNB 2GP9B 2BX4A 1YPKH 1PPCE 1A7SA 3TK6A 2G00A 1GHZA 3AW0A 2D2DA 5LPRA 1HAPH 2VVCA 3UY9A 4NA7A 2Y81A 3O8BA 1VCQA 3SGAE 1O33A 1PPHE 2ANKH 3MU5A 1YPLH 1KDQB 3RXLA 2J4IA 4YTAA 1G2MA 1S6HA 1C1QA 4FUEA 4MPUA 1W0YH 1QA0A 1KIGH 2W5EA 1ANBA 3AAUA 1AVWA 3OSYA 1C5VA 1BHXB 4H42U 1JIMA 1WTHD 3V13A 2G51A 5DKMA 1IHSH 3SJ9A 3LT3A 1IOEA 5EW2H 1O3DA 4AGJA 2ZP0H 2GZ7A 4IN1A 1MKXH 4ZHMU 5I46H 3SO3A 3Q00A 5FBIA 2R3YA 4RSPA 5L2YH 3M35A 1KXDA 1E35B 1MTUA 4NWLA 1RTKA 1THRH 3M37A 3FVFB 4UE7H 1P3EA 1AU8A 2EI7A 3M7QA 4B1TA 1BJUA 1BA8B 1D3QB 1MKWH 2TGTA 5LPEA 1C5WB 1GJCB 1MCVA 3SU6A 1J9CH 4WXVA 4LK4A 4MNWA 4NA9H 1S0RA 1DS2E 1PPBH 3RMMH 1AVGH 1NY22 1GL0E 1ZTJA 1TRNA 1O2GH 2Z6BD 4TY7A 1KTTB 2BTCE 1IQNA 1TNIA 1C2IA 1IQLA 2J95A 4X8TH 2QXGA 2VIQA 4AFZA 3MMGA 2BY5X 5F6MA 2HALA 2AFQB 2CHAB 2NU2E 1MKXK 4YZUA 1K1IA 4CREA 3MU8A 1GCTB 3SJOA 3KEEA 5EG4A 1KLJH 3LGUA 2P3FH 2Z3CA 2ZIQH 1GBKA 2ZHWH 5JBTA 3EA9A 1P2IA 5DP6A 1W7GH 1CVWH 3KQBA 3LGTA 2V35A 1V2TT 2BX3A 1RRKA 3BN9A 3SGQE 1TGNA 2ZNKH 4GCHF 4GVUA 1MD7A 2W7UA 2AMDA 2J38A 1C1TA 1HAYB 6GCHF 1S5SA 1RXPA 1AN1E 1MBQA 1BRBE 4ABAA 1L1NA 2ZKSA 3T62A 1ARBA 1ELAA 1SGRE 3B8JA 2VU8E 1P06A 2YNBA 1BB0B 1H9LB 3DA9B 3GY3A 1AVXA 1JBUH 4ABHA 1CGHA 1B0EA 3ATLA 1RIWB 1IAUA 4GPGA 4A1VA 1GMHG 1O2RA 1ZMNA 4IC6A 2XTTB 1CU1A 2AIQA 3GY8A 3T25A 1Z71A 1T4VH 2P16A 3TNTA 1LHEH 1RD3B 2ZTZA 4NIVA 1ELVA 1Q31A 1SGNE 1FMGA 2ZFTA 1CE5A 4DY7B 5LH8A 1ZSKA 1P11E 5FPSA 3P8GA 3MH4A 2GCHF 2RDLA 4D7FA 3ELAH 1WAYB 3BG8A 4LXBH 1KXCA 3P8NA 3QO6A 2HOBA 4Y0YE 4K5ZA 5FX5A 1NRQH 3OY5U 1VJAU 4Y8YA 1P3CA 2FOAA 3AVZA 1CSOE 3TVJB 1G36A 1QNJA 1VCWA 3RXUA 1UK3A 3VFEA 2AH4X 2R3UA 2SGQE 3TPIZ 2O9QA 2QV1A 1LVOA 1KY9A 2A7JA 1O2TA 4DIHH 4UFFH 4ASHA 1EAIA 4H4FA 1QB6A 5IDKA 3S9BA 5F8TA 3M5MA 1NT1A 4FUHA 3PO1C 5C1XA 5C5NA 3RUOA 3UWIA 1ARCA 1C9TA 2V0BA 1NM6A 5BRRE 4XBBA 2OXSA 2BVSH 3Q3KA 3N7OA 2Y5HA 1F5RA 2EEKA 5HYOA 1V2PT 1QFKH 3A7VA 4I8JA 2PHBA 2FO9A 1LPGB 5ETXA 4KTCA 2HNTF 1NRRH 3SNBA 4ZH8A 5DP9A 3PYHA 5I25A 1F0SA 2HNTC 3LDXH 1HIAA 1OKXA 1K28D 3UOUA 1TAWA 5AFZH 3RXTA 1GI6A 2ANMH 1V2NT 5GWZA 3GY4A 3VEQB 2ZHFH 4H6SB 4Z0KA 1A46H 4WJG2 4WMDA 1P05A 3TGJE 1AKSA 1H9HE 3K2UA 1LMWB 1V2JT 8GCHG 1O2XA 1TALA 3Q76A 3DFJA 1UVUH 1OWHA 1ETSH 5DP4A 2F9UA 1EOLA 2A7HA 3MH7A