1HV7A

Porcine pancreatic elastase complexed with gw311616a
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
240
structure length
240
Chain Sequence
b'VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNDGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ELASTASE 1
publication title The discovery of a potent, intracellular, orally bioavailable, long duration inhibitor of human neutrophil elastase--GW311616A a development candidate
pubmed doi rcsb
molecule tags Hydrolase
total genus 63
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2001-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1hv7A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1hv7A01
1ZHMA 1F0SA 2ODYB 4WXVA 1MCVA 1RRKA 3S7KB 7GCHF 3NWUA 4AN7A 4K5ZA 1RTFB 3T2NA 1FNIA 3FFGA 1L2EA 1SQTA 4FU7A 2ZPRA 1UJ1A 2FOBA 1A3EH 1K1NA 3KNXA 3UWJH 3UTUH 1HYLA 1ZJKA 2GZ9A 4ZAEA 1UK2A 2UUFB 5EPYA 1TABE 5JBTA 2W7UA 1O2PA 4BAHB 4B74A 4B1TA 1BRBE 1OWKA 1QBNA 5JB9S 1RFNA 1UTPA 1CE5A 2TGDA 2BOKA 1Y8TA 3P95A 5E0JA 2FOMB 3UNSA 2BY5X 3LKWA 4HZHA 3SV9A 1GL1A 1QJ7B 2ZGJA 1GG6B 5JPMH 1SGQE 6LPRA 1V2RT 1N1LA 1HBTH 5FPSA 1M9UA 1TAWA 3MU4A 3S69A 4NWKA 2W3KA 4MPVA 2TBSA 5ESTE 2A5IA 1V2LT 1C5QA 2VWLA 1L1NA 1LVMA 1THPB 1XUGA 1SQAA 1B5GH 4ZKNU 2BVRH 3TGIE 4SGBE 3RU4D 2HOBA 1XMNB 1P2NA 3OY5U 1LQDB 3RC6A 3U9AH 2GCTC 1TMTH 2GZ8A 4DIIH 1XXFA 1O2NA 3LT3A 2ZEBA 4X2YA 4DURA 1AKSA 3A83A 2KAIA 2D26C 4BAOB 3GCOA 1AWFH 1AQ7A 3I77A 1O5FH 1OWEA 1KLJH 1Z71A 2HRVA 1QNJA 5DP4A 3RXDA 1MKXH 2PTNA 4JYUH 1QJ1B 1HLTH 1T31A 3ATKA 3SO3A 3GISB 1S83A 4M7GA 1C2LA 2FZZA 1EJMA 4PROA 1C1OA 4BTIB 4J1YA 1FN6A 4E06H 3GY5A 1PPFE 1MTUA 1BCUH 2KAIB 1UTNA 1LVYA 1C1VH 2B0FA 3BF6H 3Q3YA 1NRNH 3MYWA 1BJUA 1HAXB 4TY7A 1D9IA 1GBAA 4MPWA 1BQYA 5DP8A 1CGJE 2FOAA 4ISNA 1G9IE 1TB6H 1YPGH 1NY22 1UHBA 5FAHA 5C2ZA 3KHVA 1YCPH 3WY8A 3M7UA 3A7YA 1GCTB 3MNXA 2Z9JA 1BOQA 2IN2A 1HAGE 3SUGA 1UK3A 3FP6E 1EJAA 4I8HA 5AFZH 2Y82A 4WMEA 1OPHB 2FIRH 1Q2WA 1O2OA 1K1PA 3I29A 4OS2A 2VVUA 4OS6A 3AW0A 1ZGIA 1UHBB 1ZSJA 1EAIA 1FQ3A 5FPTA 2JETC 4ISIH 2ODQA 1VJ9U 4RKOB 3F6UH 3URCA 1FDPA 1KXBA 2P3UB 1SLUB 3E1XB 3P8NA 3GY4A 1GI4A 3IG6B 3BEIB 2BHGA 3BTEE 8KME2 4HTCH 5HM9A 4I32A 1O2QA 4NSYA 1OWIA 4RKJB 5K7RA 1GGDC 4FVBA 2QN5T 2ZP0H 2XNIA 2I6QA 2QYIA 5DP6A 3E3TA 1H9LB 2FWWA 1BBRH 1O32A 1G36A 4GSOA 3BTWE 4ABEA 3SU3A 1G2MA 1MAYA 2STBE 4O3UA 4TYDA 2ODPA 1HAVA 3SJ9A 1GJ7B 1Q31A 1CT2E 1HDTH 3R3GB 3SI4H 4DIHH 4MPXA 5K0HA 4Y11E 3SUDA 1AWHB 1O2KA 2ASUB 2ZFFH 1QY6A 2G5VA 3NXPA 3BN9A 1O33A 1NFUA 1H4WA 1IQGA 3RXOA 5F8ZA 3P6ZB 4FUIA 1EX3A 3LGYA 1X7AC 1PQ8A 4X6MA 1S82A 1Z6JH 3SJOA 3MH5A 3UIRA 1LKBA 1QFKH 3E91A 3T5FH 1G3EA 1JIMA 1O5AB 5GWZA 3KQEA 1HAVB 3GDVA 3UOPA 1C5ZB 1O2UA 3TLOA 3SOSA 4X1RU 4JK5A 4WMDA 1C1SA 1T7CA 2FOGA 2H9TH 2WPIS 2XC0A 4B2BA 1BHXB 4O97A 3EGKH 2R3UA 4I31A 2GT7A 3PTNA 3ZVFA 1YYY1 2Q6DA 2BDCA 2B8OH 1C5TA 2PTCE 1ZPZA 1BDAA 3DFJA 3RXUA 2SGQE 1BRAA 1XUKA 2ZG0H 1TGTA 1Z8JB 2QF3A 2UWLA 4Q7ZA 1O2VA 1LMWB 1O0DH 2A7JA 1NS3A 1AIXH 1NFYA 1P3EA 1F5LA 2HNTF 1AFEH 1V2NT 4OS1A 1G3DA 1CHGA 4LZ1H 1UO6A 2VIQA 1UCYE 3FAOA 5FBEA 1C5WB 1GVZA 3VEQB 3BG4B 4A1TA 7ESTE 2VVCA 3BTQE 1LHCH 1P9SA 1QB9A 4TWYA 1O31A 1LHEH 2A2XH 3SNDA 1ZYOA 2B7DH 2ZGBH 1NESE 1P8VC 4OGYA 1EXFA 4NSVA 2FOCA 1W13U 4YO9A 1ZR0A 5FX6A 1YPLH 1GI0A 3T62A 1SGCA 2GDDA 3CS7A 5A0AE 1AE8H 2VU8E 1O3DA 1TNKA 1C1RA 2ZQ1A 3ZVGA 1UVTH 1YC0A 1T8OA 2XWBI 6ESTA 1P9UA 1DXPA 2SGFE 3BTME 5J4QA 1V6DA 2C90B 3GYMA 2CF9H 1P2OA 1DFPA 5E2OA 1C5VA 1VCWA 1V2ST 4AGKA 5LPRA 1E38B 1EAXA 3S9AA 2ZZUH 1P05A 2OLGA 1D4PB 3LPRA 5EODA 5AVDA 4IBLH 3LOXA 5T6GA 2P94A 3N7OA 2ZA5A 2BYAX 3UNQA 3C27B 2WPMS 1Z8IB 1EZXC 1SOTA 1GHZA 1YGCH 2RCEA 1DITH 2PWXA 1BZXE 2QY0B 1CA0C 8LPRA 1WCZA 3BV9B 1UVUH 4RSPA 1UTKA 1NPMA 1TGCA 3SU2A 3DD2H 2Y80A 5FX5A 6CHAC 5DJ7A 1IHTH 3MNSA 4A1VA 2B5TB 2CV3A 5F8TA 1GI7B 2F83A 5EU8A 3K2UA 3LH3A 3A7TA 1EUFA 4Y8ZA 1C5UA 3TJUA 4F4OC 5E2PA 4WWYA 2VIVA 4FVDA 1TWXB 2BY6X 1N8OC 3A84A 1RD3B 3ZV8A 2PHBA 1F5KU 1BMNH 3A89A 1P03A 2J95A 5L30H 3PWCA 4LK4A 1A0HB 2CN0H 1GGDB 4U01A 1S0QA 3KEEA 1SC8U 1TX6A 4FUBA 4JCNA 2ZWLH 3RDZA 2ZU5A 1O3HA 1ANBA 4KKDA 4B2CA 5GDSH 2GCHG 3SJIA 1JMOH 2ZFRH 3M36A 1BB0B 2Y5HA 3ODDA 1IQFA 1CHOG 2LPRA 3P70B 1BMMH 1O2IA 1BBRE 1WU1A 4Q7XA 1ANCA 1TNLA 1FV9A 1GI2A 3F9EA 4JZ1A 3SNEA 4D7GA 2BB4A 1A5HA 4Y6DA 1O2LA 1GJAB 1DSUA 3TJVA 2Y5GA 3M5OA 2TGTA 4ZKSU 3RXIA 4AFQA 1KDQA 3EE0B 1A7SA 3T26A 5HXFA 1O2RA 1GJDB 1T32A 1TALA 2J92A 2CHAC 1GI9B 5HGGA 1C1TA 2A4OA 2H1UA 4JMYA 3SBKA 4CRBA 4I8JA 4OS5A 4X8VH 1QJ6B 3B8JA 4VGCC 1O3LA 5FHTA 3ATIA 3RC5A 1WV7H 1J16A 3UNRA 1W8BH 1C5RA 1L0ZA 1TRNA 1SSXA 4WH6A 1FJSA 3KQDA 1G32B 1HAOH 1W3CA 5EG4A 4INHA 4YZUA 2O8TA 3DHKH 2AS9A 4FXGH 2H9EH 3TNSA 4Y8XA 4AZ2B 2NU4E 3Q76A 1VCQA 1KLTA 1XVMA 1AFQC 2DE8A 3ZZAA 1PPZA 2ZIQH 1HNEE 3VFEA 3QK1A 1BTHH 3T28A 3RXFA 1C2FA 1W7XH 3SHAH 2BD9A 3Q00A 1DS2E 5LGOA 1EP6A 2WUBA 1GI3A 2FI3E 1LO6A 1QL8A 4WF8A 2Z3DA 3F9FA 3ZZ9A 2GTBA 3FZDA 3URDA 3ATWA 3V0XA 2Z3EA 2JH6D 2ZDLA 4ZUHA 5DKMA 1C2DA 3U8RH 2G00A 3RP2A 4RN6A 4XBCA 5EXLA 1W11U 5A0CA 4IS5A 5JBBS 4NCYA 1QRZA 1CT4E 1XUHA 4BOHA 1FY1A 1AHTH 1VZQH 2Y5FA 1SOZA 1V2PT 3ZVDA 2ZTXA 1GVKB 1SGRE 3B23B 4ZH8A 3RC4A 1FY5A 3QGNB 5JB8S 3A7ZA 1V2QT 4MLFB 2A31A 2BY9X 3G01A 4X6NA 2ZFTA 1BTXA 1ELDE 3RUOA 5GXPA 1CHOF 1SI5H 4CR5A 3RXMA 3QO6A 2OBQA 4Y0ZE 2P93A 3H7TA 1SG8B 1BHXF 1WSSH 1BITA 3LONA 2ZO3H 1GHAG 4MNWA 2TIOA 1VITH 2Z6BD 3UREA 1GHXH 5AFYH 1C1QA 2Z9KA 3SNBA 4GUXA 3LGVA 4DG4A 2OC8A 1ZRKA 1MTNC 4ABHA 2FTMA 5HM2A 3SZNA 1UCYK 4CH8B 1H9IE 1JWTA 2AIQA 4BAMB 3UR6A 2ILNA 1BMLA 1GMDF 1CA0B 4UONA 4UFFH 4H4FA 3FVFB 1IAUA 5E8EH 4ZROA 1AO5A 2WYGA 3V12A 1VCPA 3QX5H 1BRCE 4UFGH 1AN1E 1P0SH 2BZAA 2G4TA 2CMYA 1ELFA 1EASA 1B7XB 1UTLM 3PTBA 1MU6B 3F9HA 2ZCHP 2LNCA 4DOQA 2H5CA 2WPHS 1WTHD 2J9NA 2QGRA 1MKXK 2SGPE 1KXAA 1W14U 1CGIE 2G81E 3PROA 4XBDA 1VJAU 3KQCA 2YOLA 1SB1H 3SORA 4K60A 1BRUP 3B9FH 3M5MA 4BAKB 3TIUA 3LGIA 1YLCA 2VIWA 2ZKSA 3A7VA 4A5TS 3RU4E 4NA9H 3D23A 1E0FD 6GCHG 5HYOA 2PW8H 3SV8A 3MO3A 1C9TA 1GI6A 1T4VH 1WUNH 2BLWA 2EI7A 2NWNA 4CH2B 4AYVB 1BTYA 3RXCA 1MBMA 1ANEA 3IITA 3NPSA 1SHYA 4Y10E 2F9NA 3SGQE 3GICB 1YCPK 1C5XB 2SNWA 3W94A 3LH1A 5TCAA 1T8LA 3M37A 3ZZ4A 2V3OH 1QA7A 3MTYA 4YOJA 3NCLA 1MQ6A 2BX4A 1EB2A 3GOVB 1Z1JA 2BD7A 3RXGA 3A8DA 4VGCB 2ANKH 1P12E 3PB1E 2F9VA 4ABGA 2EI8A 3BEUA 1J17T 4FUGA 2CGAA 1PFXC 3NK8A 2P3FH 1LTOA 2OBOA 4GCHG 5L6NH 4Z0KA 2PUQH 2PGBB 1OYTH 1A61H 1UCYH 2QA9E 1W12U 3O8BA 4D9QA 3ZZ8A 1A46H 4YLQH 1O35A 3UPEA 1AY6H 1FY4A 1NU9A 1MD8A 1LPKB 4R0IA 4I8KA 4JZFH 4DJZB 1AFQB 1HB0B 3BG8A 1YKTA 1EB1H 2GT8A 5PTPA 3SU4A 1BBRK 3LU9B 3SW2B 1QRWA 1DT2A 1ABJH 1O3IA 1EOLA 2HLCA 5A2MH 3CENA 1YPHE 1EAWA 2OQ5A 3SQHE 5CMXH 1XX9A 1QIXB 1GBKA 4NIWA 4CR9A 2C8WB 1HAIH 1SGYE 4KGAA 3KGPA 1OWJA 1D3TB 2O8LA 1DUEA 5DPAA 3RXKA 4GPGA 2R3YA 3QZQA 3U1IB 4O03A 1S6FA 2R9PA 1C5OH 2Z9IA 4X2VA 2C93B 3JZ1B 3KF2A 2ZU1A 1P2QA 2FX4A 2PLXA 1DUAA 1RJXB 1CO7E 1HFDA 9ESTA 2UUJB 2A4RA 1O3PB 3A8CA 3E0NB 1Y59T 1GL0E 4JYVH 3S0NA 3O8DA 3RM0H 4IN2A 1F0UA 1TQ7B 1PQ5A 4Y7AA 2PV9B 2XTTB 1GBMA 2FEQH 3TGJE 4ZXXH 1HAYB 1S6HA 1ZJDA 4CRGA 4AFZA 1AVGH 1HAHH 2XC5A 4K8YA 4E7NA 4IMQA 2B9LA 4WY3A 1O3OA 1AE5A 4KELA 1V2KT 3EQ0H 2OP9A 2BMGB 1KY9A 3FP8E 2FI5E 4KTSA 2JH5D 1JRTA 4SGAE 2A4QA 3HPTB 2HPPH 3BTGE 1E36B 4TPIZ 3SHCH 1SGEE 1MBQA 2FLBH 3IWMA 3MU5A 4ABJA 5FXLA 1CBWC 4GCHF 1FAKH 1W10U 2QXIA 3TU7H 4UD9H 4DGJA 2BD8A 3QTOH 1A5IA 4NZQA 2P95A 3K6ZA 1AZZA 4AFUA 1P3CA 5T6DA 1DVAH 1C4V2 4WH8A 3NKKA 1YPEH 1IQNA 1TFXA 1Y3YA 3D49H 1P10A 1WBGB 2G52A 4ZMAH 3RMLH 1FY3A 3EYDA 1EZUC 2WPJS 1BIOA 1LCYA 4Y7BA 2XW9A 2PUXB 3MI4A 4NA7A 1PQAA 3GY7A 4DCDA 1ESAA 3RXVA 2ZCLP 4GHTA 2ZTZA 4AYYB 1GI5A 1IQKA 4E05H 1GMCG 3V13A 1FPHH 3ZVCA 1TRMA 3M5LA 3LJOA 3QLPH 2HNTE 1TBQH 3OSYA 2AMPA 2BDHA 5EOKA 1UTQA 3ZZ5A 3VB6A 1DWBH 2P3TB 2ZTYA 1NRRH 2J38A 4ABDA 1YCPM 1E35B 1ZMLA 2QC2A 3PLKA 2J34A 1O3KA 3TK5A 1LPZB 1HGTH 4D76A 1F92A 1GMHG 4CHAC 4MTBA 4GLYA 1QBOA 2ZDNA 3UUZA 2R2WU 1Y5BT 2ZECA 5C3NA 1P06A 2ANYA 1KXFA 1FZZA 2WPLS 2PR3A 4B71A 1KIGH 1EP5A 1ELCA 4UE7H 3ZYEA 1MTWA 3RXLA 5G4BA 1DXWA 1IHSH 1Y3UA 1BTWA 3K9XB 1JIRA 2BD3A 3Q77A 1DY9A 3QN7A 4NIXA 4YM9A 2AERH 1P02A 1H1BA 3MO6A 2PGQB 1OWHA 4D7FA 1XUFA 2ULLA 3M7QA 1ID5H 4TY6A 1QA0A 1MAXA 2AMQA 2GCTB 3F1SB 1P04A 2VH0A 4NIYA 1YLDA 3LIWA 5HMAA 1KXDA 1DWDH 1HCGA 3L6PA 1YP9A 4LZ4B 1GDNA 3SJKA 1D3DB 4ABIA 1YPHC 2BD4A 3U98H 1TMUH 3RXEA 1UTOA 3PLPA 2AGGX 1C5MD 1GVLA 3RXTA 3UR9A 1C1PA 1TBZH 3E16B 1TBRH 7LPRA 3AW1A 4MQAA 1IQLA 3ZZ3A 1V2OT 1O30A 1G3BA 5BPEA 2UWOA 5C5OA 4YOIA 2NU1E 4Y0YE 1OWDA 1O3BA 1QHRB 1O5EH 1D3PB 1GMCF 3PWBA 1YPKH 2FTLE 2F9UA 1JRSA 2Y7XA 1NFWA 1DICA 1SR5C 1UVPA 5GCHG 3O8CA 1A3BH 2XWAA 1ZZZA 4NFEA 5DGJA 1PJPA 4ZHMU 4JYTA 5JBCS 2V3HH 4CREA 1O3EA 3T27A 1DE7H 3ATLA 3KN2A 1DLKB 2ZHQH 3SI3H 1PPHE 1QR3E 4K2YA 1VGCC 1NROH 4D8NA 3MU8A 1EAUA 1C4U2 4K1EA 1HJ8A 2ESTE 4K69A 1RS0A 2D1JA 1P2MA 3RXQA 4FU9A 4GAWA 1FIWA 3SJ8A 2BM2A 2SGAA 1S5SA 1V2VT 3A88A 3SUFA 2HWLB 3PO1C 3GCHC 4UDWH 5EXNA 5F8XA 3MMGA 4FUCA 4I7YH 1P09A 2JETB 3S7HB 1GBIA 5A8ZA 1C4Y2 1O3MA 2Z7FE 5IDKA 1EZSC 1AU8A 3UQVA 3E6PH 2BVSH 2J2UA 1H8IH 1NRPH 5T3HA 1NN6A 2STAE 3ITIA 2FODA 1LQEA 2Q6FA 4NFFA 2F91A 1CGHA 1GJ9B 4CBOA 4H6TA 1LPGB 2BVXH 3U69H 1TRYA 5DP5A 2A5KA 1HJAC 1E37B 1ZMNA 1L4ZA 3HGPA 4Q80A 1O2MA 2Y6TA 1GBFA 4UEHH 1LVOA 2VGCC 1SGPE 1NC6A 5AHGH 3ZZ6A 3BTFE 4MVNA 1Q3XA 1HPGA 5EQSA 3MNBA 5FBIA 5C5NA 1AMHA 1K21H 1O34A 5A0BA 2OC0A 1RTKA 2G51A 4YLUA 1QTFA 1TIOA 2HNTC 3AASA 1C2HA 2WV5A 1BMAA 1O2GH 1SGNE 1FONA 1OKXA 2ZFPH 2THFB 5E0HA 1C5NH 1Y5AT 2M5TA 4H6SB 2GMTC 1TNJA 1SHHB 1ELGA 2P59A 2BD2A 4ZXYH 3RLYH 2JKHA 1LKAA 3KQBA 3QGJA 3A85A 4I33A 3A7XA 2Z94A 1GDQA 1GBCA 1ZTLA 3V3MA 2W7SA 4AB9A 1AD8H 2AEIH 2WINI 1CSOE 4FUEA 3JZ2B 3KCGH 2F9OA 2ZDKA 1ETTH 1BTPA 2WYJA 3KL6A 5FCRA 1FIZA 4WMFA 1MZDA 2NU2E 4BANB 5A8XA 1ELAA 3RXSA 4FU8A 3LDXH 2GKVE 1D6WA 2FS9A 3BIUH 1QCPA 2RG3A 2AMDA 3TPIZ 1FLEE 1O37A 2H5DA 2HGTH 3L3TA 1GHWH 1XXDA 3P8OA 1ELTA 1UK4A 1GJ5H 4ISOA 3STJA 1KSNA 1XM1A 3TK6A 1DY8A 3RM2H 1SL3A 3SU6A 1O3AA 1EZQA 2PKAA 3V7TA 3RMNH 1C5SA 4X8UH 4HGCA 1L1GA 3SGBE 3HATH 4B76A 1EATA 1P2JA 3SU5A 1O39A 5A8YA 3RXAA 2FI4E 4E7RG 2SNVA 1EKBB 4O3TA 1C2IA 1BA8B 1L4DA 1HXFH 2BD5A 1ZTJA 4BNRA 4U2WA 2BQ7B 4WJG2 4INKA 2GCHF 1C5YB 1SFIA 2ZNKH 2PKAB 1O5BB 1Z8RA 3M61U 1O3FA 2ZU2A 1BJVA 5LH8A 3NUMA 1TYNA 1AGJA 1FY8E 3DT0H 3ESTA 1YPMH 2GZ7A 3LGUA 4D9RA 2ZGCA 4KP0A 4Y79A 3LC5A 2BDGA 2ZQ2A 2NU0E 2ZGHA 3QDZB 3CP7A 3MH6A 3P8FA 1J9CH 1K1OA 3M3TA 4YESB 1DWCH 1PQ7A 2QCYA 2XC4A 1RIWC 4THNH 4ZHAA 3OTJE 3PMJA 3PV4A 1GJBB 3MFJA 2OTVA 1ETRH 3RLWH 3TH3H 1SBWA 1TX8A 1AUTC 1OYQA 1GCTC 4Y76A 1V2TT 1TPAE 2ZCKP 1KTTB 1K1IA 2HALA 1GI1A 6CHAB 1XKBC 4ZKOU 2CJIA 2VNTA 3GCHB 1W0ZU 1UTMA 2FDAA 1ARCA 2C3SA 3HKJB 1TGSZ 3MOCA 3SNAA 2BQ6B 2O8MA 3AAUA 4DT7B 1N8OB 1MCTA 5T6FA 3TJNA 3ATMA 1UVOA 2A32A 1TMBH 1OSSA 1XVOA 4X6OA 2EI6A 3A8BA 3LC3A 5C20A 5E0GA 1TE0A 5F03A 1W2KH 4AX9H 1V2UT 1HJAB 3SGAE 3TJOA 1NRSH 3ZZDA 3M3SA 2FMJA 2C8ZB 2EA3A 1K22H 4NIVA 2D8WA 1ETSH 3F68H 1HRTH 1EPTC 4X8TH 4B73A 4A6LA 3UY9A 4OS7A 2K1QA 1HAPH 2A2QH 2IOTA 1AZ8A 1ELEE 5SGAE 1GHBG 1UMAH 1TGBA 1Y3VA 1CQQA 1SQOA 2ZGXH 1K28D 2H2ZA 2P8OC 3ZVAA 2OINA 1FN8A 1TX7A 5DG6A 2J94A 1GWAA 2FLRH 3VB5A 1MU8B 2OXSA 4IC6A 2PFEA 4IC5A 2OC7A 4U30A 2A7HA 3DUXH 1C2MA 4IGDA 2GMTB 1KXEA 4CRDA 5FCKA 2G55A 1IQHA 4K1TA 4CRAA 2CHAB 1T8NA 2ZFQH 3ODFA 5CHAC 5EQQA 3SNCA 3VXEH 2EEKA 4GHQA 1D3QB 3LGWA 1GHAF 4Q7YA 3LJJA 1CU1A 2A1DB 2J4IA 1P11E 1TNIA 3AVZA 1O38A 1S0RA 5L2YH 3PMHB 1SVPA 1QB6A 1TA2A 1Z8GA 2VWNA 4AG1A 1WOFA 1O2SA 4MNXA 2BLQA 1Y3WA 2GV6A 5C67A 1O2HA 1GBLA 1SPJA 1GBHA 1TOMH 1AI8H 1EQ9A 1C1MA 3TK9A 2FXRA 3CS0A 1K1LA 4INLA 5GIBA 3K65B 5TJXA 5I46H 5IYTA 2PSYA 2PKSC 1P2KA 3RXPA 1O2JA 2FYQA 2BLOA 3GY8A 5CE1A 3FZZA 4CBNA 1CT0E 2GX4A 3PMAB 1EJNA 1T4UH 2ZDVH 3RXHA 4JZIA 3BSQA 1KTSB 3A86A 1TLDA 5DK1A 3O8RA 3BG4C 1Z7KA 2QAAA 4ABBA 3VXFH 3U1JB 1YPJH 1QL7A 1OP0A 3BTHE 4TWWA 4WXIA 4BXSA 1SLVB 5BRRE 1INCA 1PPBH 1GDUA 2A4GA 2XYAA 6GCHF 1HXEH 1O2TA 4XOJA 1B0FA 1MH0A 1MKWK 3A87A 1PPEE 1GHBF 1BTZA 2R2MB 2F9BH 1A2CH 1KXCA 2Y81A 1C5LH 1O2WA 1IOEA 3SV6A 1QQUA 2ANMH 2RA3A 2A0QB 2TGPZ 5EPNA 4MG3A 1OS8A 1VITG 1AKSB 1TOCB 2VH6A 1SLXB 2OCVB 5C1UA 3S9BA 1IQIA 1SGTA 1MTNB 2VINA 1RIWB 4X8SH 4IN1A 8GCHG 3HGNA 1L1JA 4YT6H 2ANWA 4IW4E 2ZC9H 2QV1A 3SQEE 1SLWB 1QRXA 2OQUA 3DA9B 1GJ6A 1ESTA 2HVXA 1NZQH 4JK6A 1K1JA 3A8AA 5LPEA 2R0LA 3PLBA 2AYWA 2FOFA 1SFQB 2XRCA 1EPTA 5ABWA 4MDSA 1AB9C 2VWMA 3HK3B 3ZZBA 3EAJA 1ORFA 1JOUB 2QF0A 8ESTE 3S9CA 3Q3KA 1TPSA 4BXWA 2P16A 2TGAA 1O3NA 1ZGVA 3BTDE 1A1RA 2C8XB 4FUFA 4BTTB 5GJ4B 1ZHRA 2DE9A 1G2LA 3K6YA 3TITA 4X0WU 3MNCA 5EW2H 2VJ1A 4FUDA 3UWIA 1FI8A 2F3CE 1C2EA 2VIOA 1MTSA 3BIVH 1MQ5A 4A7IB 1FUJA 1EPTB 2BTCE 1C5PA 1DSTA 2QIQA 1QQ4A 3MH7A 3VB4A 1O2YA 1DOJA 1SGIB 2OUAA 4NZLA 1TNHA 1PYTD 1ZPBA 3M3VA 5C1YA 5DO4H 1QGFA 2P8OB 1ZLRA 1O5CB 1Y3XA 5ESBA 4NA8A 4J2YB 4K8BA 2UWPA 1WQVH 2BZ6H 1C2KA 3U8OH 1MKWH 1GBDA 3ZVEA 5LPFA 3A82A 3SU1A 1OP8A 4ABFA 5CHAB 2C4FH 1ESBA 1C1UH 2IJOB 1GBEA 3MWIU 1VITF 3A7WA 3SN8A 5JDUB 4A1XA 3TNTA 4KTCA 1XKAC 1BUIA 3RXBA 1THSH 2H9HA 3OU0A 2QXGA 3RXRA 3U8TH 1MUEB 8GCHF 1H9HE 2DUCA 3VGCC 2V6NA 5JBAS 1LHDH 2ZDMA 1G37A 3GCTG 1O3CA 3FP7E 4QT8C 2BX3A 4MNVA 3RMMH 1DPOA 2BXTH 2CF8H 1KLIH 3HK6B 4Z6AH 4AG2A 4K1SA 1A5GH 2BOHB 3E8LA 1HUTH 2PKSB 2BLVA 1TA6A 1PPGE 2FOEA 2GVFA 2Y7ZA 2FO9A 1DDJA 2FP7B 1YM0A 3D62A 2GD4B 1LHGH 3FANA 1IQEA 3T25A 3VPKA 2O8UA 2YNAA 1ZRBA 2BXUH 4ISLA 4ZKRU 2AIPA 1C2JA 1S85A 1WYKA 3SU0A 1H8DH 3GDSA 1NM6A 2R0KA 2SGEE 2ALVA 4AGJA 1THRH 4AORA 4I8GA 1GPZA 3BTKE 1DM4B 1O5GH 4NG9H 1C1NA 1VR1H 1P2IA 2O9QA 2QXJA 2GV7A 1O2XA 2W5EA 2Z9LA 2XCFA 4R8TB 1GJ4H 3QUMP 1GI8B 2ZPQA 2FESH 1ZPCA 9LPRA 1DLEA 1W0YH 1YBWA 3EDXB 1A0LA 3H7OA 5I25A 4HFPB 5JYIA 1WAYB 2V35A 2AFQB 1NFXA 4ABAA 1GHYH 2VB0A 1GMHF 1TQ0B 2G8TA 3L33A 5EGMA 5B6OA 4FUJA 2ZI2H 2SFAA 3MHWU 2ZHEH 2BDYA 3EA7A 2CXVA 3NZIA 5EW1H 1C9PA 3Q3XA 5DP9A 1F0RA 3ENSB 1V2WT 4XFQA 4NWLA 1ELVA 1V2MT 4UFEH 1FAXA 1P01A 2XXLA 2ZHFH 1PYTC 1ZTKA 2ZU3A 3D65E 1FMGA 1OP2A 4Q2KA 1RTLA 3ZV9A 1IQMA 1OXGA 1TGNA 1ZOMA 1WQSA 2ALPA 1CBWB 3C1KA 4Y71A 2I6SA 1PPCE 4A92A 3GCTF 3UQOA 1O36A 3TH2H 1AB9B 3EA8A 4ESTE 1OX1A 3MU1A 3PYHA 1RGQA 2XCNA 2QXHA 2FX6A 3P17H 2FOHA 2RDLA 2H6MA 2IPHA 1AVWA 2A5AA 4DW2U 1QB1A 4JZEH 1HV7A 1XUJA 1ZSLA 1DWEH 4TPYA 1QL9A 2W3IA 4NGAH 4OS4A 1XUIA 4X1PU 1U6QA 2WPKS 1SMFE 4AB8A 1GCDA 1NRQH 1TPOA 1UVSH 4ISHH 3P8GA 3OY6U 1SGFA 5DP3A 4X1SU 2V0BA 4XE4A 4AFSA 3GYLB 1O2ZA 1AVXA 4F49A 1ARBA 3BEFB 1S84A 4DVAU 2XBWA 2UUKB 3GY3A 2Q6GA 3H5CB 1W7GH 4U32A 5GCHF 2TPIZ 3UFAA 2SGDE 1F2SE 1P57B 2RA0A 1MMJN 4BAQB 4CHAB 1CA8B 3AAVA 1T8MA 2UUYA 3HKIB 2O8WA 2AGEX 4H42U 1O5DH 3KIDU 1LHFH 3P92A 1Z1IA 1K2I1 1NU7B 1ACBE 4LOYH 1A0JA 1LDTT 2WV4A 3I78A 3RMOH 2BDBA 5GPIB 2D2DA 3SV7A 3M5NA 5C1XA 4YOGA 3RU4T 1ZHPA 1KYNA 2G4UA 1Y5UT 2ZU4A 2BDIA 3MU0A 2EC9H 1MD7A 1HJ9A 3VGCB 1C2GA 1GG6C 5H4IB 2FS8A 2ZPSA 1GMDG 4OGXA 1O3JA 3VB3A 1JBUH 2OD3B 2VIDA 4X6PA 5FPYA 1HAZB 2HPQH 4LXBH 1KDQB 3E90B 1B0EA 2F9PA 3ZZ7A 5EXMA 4ZHLU 2VIPA 1ANDA 1LVBA 2ZF0H 3QTVH 4XSKU 1N6YA 1CVWH 2ZFSA 3ZYDA 3MH4A 4B75A 4WVPE 3SV2H 2XBVA 4O9VA 2BY8X 1K1MA 1G30B 2BDAA 3QZRA 2GP9B 2Z3CA 1JXPA 2A45B 5TCCA 3TVJB 1QURH 2YNBA 2NU3E 1J15A 2C8YB 1GBBA 4UFDH 2BY7X 1ELBA 1J14A 3RXJA 4B2AA 7GCHG 2G5NA 1NO9H 1GHVH 3T29A 2WUCA 2A7CA 1ZSKA 1BTUA 3DFLA 2W26A 1V2JT 4JZDH 1NTPA 4HI3A 3STIA 1N6XA 2XBYA 3UOUA 1ABIH 1GJ8B 1YF4A 3MO9A 2BQWB 2ZHDA 1DX5M 4K3JA 1C1WH 4XDEA 1GBJA 2FPZA 2VVVA 4I8LA 1UTJA 1VGCB 1A4WH 4BTUB 1D6RA 1Z6EA 1MTVA 5L2ZH 1NT1A 3QWCH 5J4SA 1HIAA 3LGTA 4ASHA 4MPUA 4X2XA 3VB7A 4CRCA 1BT7A 3ZZCA 2ZHWH 4IMZA 4MNYA 1V3XA 3GY6A 7KMEH 1WTGH 2ZDAH 1S81A 1F5RA 2Q1JA 3TH4H 4X1NU 4X2WA 3PO1B 4Y8YA 1TNGA 2Z9GA 1DANH 3F9GA 4XBBA 3BTTE 2GDEH 1GBTA 4KTUA 2GGVB 2TRMA 2VWOA 3M7TA 4X1QU 3R0FA 4DY7B 1K9OE 2PSXA 3OX7U 3GCNA 3E0PB 5AF9H 1MZAA 1HIAB 1FXYA 2AGIX 1F0TA 1AUJA 2FM2A 3EA9A 1E34B 3A80A 4AOQA 5A09A 2AH4X 3ZVBA 2XBXA 4CRFA 1F7ZA 1G3CA 1GJCB 3ELAH 3W95A 1O3GA 3A81A 2FYRA 1ZMJA 2VGCB 5ETXA 1RXPA 3PM3A 1TONA 4YT7H 1J8AA 2OC1A 1SGDE 4FUHA 5EQRA 4YTAA 5F6MA 3TGKE 2JH0D 1TPPA 3OYPA 3PMBB 4GVUA 5DP7A 1FPCH 3SUEA 1OOKB 3M35A 1QBVH 1SGFG 3GY2A 1EOJA 3GDUA 1IQJA
chains in the Genus database with same CATH superfamily
1ZHMA 1F0SA 2ODYB 4WXVA 1MCVA 1RRKA 3S7KB 7GCHF 3NWUA 1NBME 3KYFA 5EJ1A 4AN7A 4K5ZA 1RTFB 3T2NA 1FNIA 3FFGA 1L2EA 1SQTA 3PRDA 4FU7A 2ZPRA 1UJ1A 2FOBA 1A3EH 1K1NA 3KNXA 3UWJH 3UTUH 1HYLA 1ZJKA 2GZ9A 4ZAEA 1UK2A 5CDFE 2UUFB 5EPYA 1TABE 5JBTA 2W7UA 1O2PA 4BAHB 4B74A 4B1TA 1BRBE 3FN8A 1OWKA 1QBNA 5JB9S 1RFNA 1UTPA 1CE5A 2TGDA 2BOKA 1Y8TA 3P95A 5E0JA 2FOMB 3UNSA 2BY5X 3LKWA 4HZHA 3SV9A 1GL1A 1QJ7B 2ZGJA 1GG6B 5C0UA 5JPMH 1SGQE 6LPRA 1V2RT 1N1LA 1HBTH 5FPSA 1M9UA 1TAWA 3MU4A 3S69A 4NWKA 2W3KA 4MPVA 2TBSA 5ESTE 2A5IA 1V2LT 1C5QA 2VWLA 1L1NA 1LVMA 1THPB 1XUGA 1SQAA 1B5GH 4ZKNU 2BVRH 3TGIE 4SGBE 3RU4D 2HOBA 2W6JD 1XMNB 1P2NA 3OY5U 1LQDB 3RC6A 3U9AH 2GCTC 1TMTH 2GZ8A 4DIIH 1XXFA 1O2NA 3LT3A 2ZEBA 4X2YA 4DURA 1AKSA 3A83A 4YXWD 2KAIA 2D26C 4BAOB 3GCOA 1AWFH 1AQ7A 3I77A 1O5FH 1OWEA 1H8ED 1KLJH 3F0OA 1Z71A 2HRVA 1QNJA 5DP4A 3RXDA 1MKXH 2PTNA 4JYUH 1QJ1B 1HLTH 1T31A 3ATKA 3SO3A 3GISB 1S83A 3DSGA 4M7GA 1C2LA 2FZZA 1EJMA 4PROA 1C1OA 4BTIB 2KCPA 4J1YA 1FN6A 4E06H 3GY5A 1PPFE 1MTUA 1BCUH 2KAIB 1UTNA 1LVYA 1C1VH 2B0FA 3BF6H 3Q3YA 1NRNH 3MYWA 1BJUA 4AC9A 1HAXB 4TY7A 1D9IA 1GBAA 4MPWA 1BQYA 5DP8A 1CGJE 2FOAA 4ISNA 1G9IE 1TB6H 1YPGH 1NY22 1UHBA 5FAHA 5C2ZA 3KHVA 1YCPH 3WY8A 3M7UA 3A7YA 1GCTB 3MNXA 2Z9JA 1BOQA 2IN2A 1HAGE 3SUGA 1UK3A 3FP6E 1EJAA 4I8HA 5AFZH 2Y82A 4WMEA 1OPHB 2FIRH 1Q2WA 1O2OA 1K1PA 3I29A 4OS2A 2VVUA 4OS6A 1E1RD 3AW0A 1ZGIA 1FX0B 1UHBB 1ZSJA 1EAIA 1FQ3A 5FPTA 2JETC 4ISIH 2ODQA 1VJ9U 4RKOB 3F6UH 3URCA 1EFRD 1FDPA 1KXBA 2P3UB 1SLUB 3E1XB 3P8NA 3GY4A 1GI4A 3IG6B 3BEIB 2BHGA 3BTEE 8KME2 4HTCH 5HM9A 4I32A 1O2QA 4NSYA 1OWIA 4RKJB 5K7RA 1GGDC 4FVBA 2QN5T 2ZP0H 2XNIA 2I6QA 2QYIA 5DP6A 3E3TA 2FWWA 1H9LB 1BBRH 1O32A 1G36A 4GSOA 3BTWE 4ABEA 3SU3A 1G2MA 1MAYA 2STBE 4O3UA 4TYDA 2ODPA 1HAVA 3SJ9A 1GJ7B 1Q31A 2F43B 1CT2E 1HDTH 3R3GB 3SI4H 4DIHH 4MPXA 5K0HA 4Y11E 5T1VA 1AWHB 3SUDA 1O2KA 2ASUB 2ZFFH 1QY6A 2G5VA 3NXPA 3BN9A 1O33A 2HLDD 1NFUA 1H4WA 1IQGA 3RXOA 5F8ZA 3P6ZB 4FUIA 1EX3A 3LGYA 1X7AC 1PQ8A 4X6MA 1S82A 3WWFA 1Z6JH 3SJOA 3MH5A 3UIRA 1LKBA 1QFKH 3E91A 3T5FH 2J97A 1G3EA 1JIMA 1O5AB 5GWZA 3KQEA 1HAVB 3GDVA 3UOPA 1C5ZB 4ACBA 1O2UA 3TLOA 3SOSA 4X1RU 4JK5A 4WMDA 1C1SA 1T7CA 2FOGA 2H9TH 2QF5A 2WPIS 2XC0A 4B2BA 1BHXB 4O97A 3EGKH 2R3UA 4I31A 2GT7A 3PTNA 3ZVFA 1YYY1 3WWBA 2Q6DA 2BDCA 2B8OH 1C5TA 2PTCE 2XOKD 1ZPZA 1BDAA 3DFJA 3RXUA 2SGQE 1BRAA 1XUKA 2ZG0H 4Q63A 1TGTA 1Z8JB 2QF3A 2UWLA 4Q7ZA 1O2VA 3DSOA 1LMWB 2OK5A 1O0DH 2A7JA 1NS3A 1AIXH 1NFYA 1P3EA 1F5LA 2HNTF 1AFEH 1V2NT 4OS1A 1G3DA 1CHGA 4LZ1H 1UO6A 2VIQA 1UCYE 3FAOA 5FBEA 1C5WB 1GVZA 3VEQB 3BG4B 4A1TA 7ESTE 2VVCA 3BTQE 1LHCH 1P9SA 1QB9A 4TWYA 1O31A 2J5UA 1LHEH 2A2XH 3SNDA 1ZYOA 2YMSC 2B7DH 2ZGBH 1NESE 1P8VC 4OGYA 1EXFA 4NSVA 2FOCA 1W13U 4YO9A 1ZR0A 5FX6A 2EQNA 1YPLH 1GI0A 3T62A 1SGCA 2GDDA 3CS7A 5A0AE 1AE8H 2VU8E 1O3DA 1TNKA 1C1RA 2ZQ1A 3ZVGA 1UVTH 1YC0A 1T8OA 2XWBI 6ESTA 1P9UA 1DXPA 1MABB 2SGFE 3BTME 5J4QA 1H8HD 1V6DA 2C90B 3GYMA 2CF9H 1P2OA 1DFPA 5E2OA 1C5VA 1VCWA 1V2ST 4AGKA 5LPRA 1E38B 1EAXA 3S9AA 2ZZUH 1P05A 2OLGA 1D4PB 3LPRA 5EODA 5AVDA 4IBLH 3LOXA 5T6GA 2P94A 3N7OA 2ZA5A 2BYAX 3UNQA 3C27B 2WPMS 1Z8IB 2J98A 1EZXC 1SOTA 1GHZA 1SKYE 1YGCH 1DITH 2PWXA 1BZXE 2RCEA 4P00A 2QY0B 1CA0C 8LPRA 1WCZA 2LP6A 3BV9B 1UVUH 4RSPA 3OTPA 1UTKA 1NPMA 1TGCA 2QE7D 3SU2A 3DD2H 2Y80A 5FX5A 6CHAC 5DJ7A 1IHTH 3MNSA 4A1VA 2B5TB 2CV3A 5F8TA 1GI7B 2F83A 5EU8A 3K2UA 3LH3A 3A7TA 1EUFA 1SQRA 4Y8ZA 4ASUD 1C5UA 3TJUA 4F4OC 5E2PA 4WWYA 2VIVA 4FVDA 1TWXB 2BY6X 1N8OC 3A84A 1RD3B 3ZV8A 2PHBA 1F5KU 1BMNH 3A89A 1P03A 1YWUA 2J95A 3PWCA 5L30H 4LK4A 1A0HB 2CN0H 1GGDB 4U01A 1S0QA 3KEEA 1SC8U 1TX6A 4FUBA 4JCNA 2ZWLH 3RDZA 2ZU5A 1O3HA 5F53A 1ANBA 4KKDA 4B2CA 5GDSH 2GCHG 3SJIA 1JMOH 2ZFRH 3M36A 1BB0B 2Y5HA 3ODDA 1IQFA 1CHOG 2LPRA 3P70B 1BMMH 1O2IA 1BBRE 1WU1A 4Q7XA 1ANCA 1TNLA 1FV9A 1GI2A 3F9EA 4JZ1A 3SNEA 4D7GA 2BB4A 1A5HA 4Y6DA 1O2LA 1GJAB 1DSUA 1VKYA 2KR7A 3TJVA 2Y5GA 3F2HA 3M5OA 2TGTA 4ZKSU 3RXIA 4AFQA 1KDQA 3EE0B 1A7SA 3T26A 5HXFA 1O2RA 1GJDB 1T32A 1TALA 2J92A 2VBCA 2CHAC 1GI9B 5HGGA 1C1TA 2A4OA 2H1UA 4JMYA 3SBKA 3OFND 4CRBA 4I8JA 4OS5A 4X8VH 1QJ6B 3B8JA 4VGCC 1O3LA 5FHTA 3ATIA 3RC5A 1WV7H 1J16A 2V3MA 3UNRA 1W8BH 1C5RA 1L0ZA 1TRNA 2WPDD 1SSXA 4WH6A 1FJSA 3KQDA 1G32B 1HAOH 1W3CA 5EG4A 4INHA 4YZUA 2O8TA 3DHKH 2AS9A 4FXGH 1S6LA 2H9EH 3TNSA 4Y8XA 4AZ2B 2NU4E 3Q76A 1KMHB 1VCQA 1KLTA 1XVMA 1AFQC 2DE8A 3ZZAA 1PPZA 2ZIQH 1HNEE 3VFEA 5GNDA 3QK1A 1BTHH 3T28A 3RXFA 1C2FA 1W7XH 3SHAH 2BD9A 4M9FA 3Q00A 1DS2E 5LGOA 1EP6A 2WUBA 3W1EA 1GI3A 2FI3E 1LO6A 1QL8A 4WF8A 2Z3DA 3F9FA 3ZZ9A 2GTBA 3FZDA 3URDA 3ATWA 3V0XA 2Z3EA 2JH6D 2ZDLA 4ZUHA 5DKMA 1C2DA 3U8RH 2G00A 3RP2A 4RN6A 4XBCA 5EXLA 1W11U 5A0CA 4IS5A 5JBBS 4NCYA 1QRZA 1CT4E 1XUHA 4BOHA 1FY1A 1AHTH 1VZQH 2Y5FA 2JDID 1SOZA 1V2PT 3ZVDA 2ZTXA 1GVKB 1SGRE 3B23B 4ZH8A 3RC4A 1FY5A 3QGNB 5JB8S 3A7ZA 1V2QT 4MLFB 2A31A 2JJ2D 2BY9X 3G01A 4X6NA 2ZFTA 1BTXA 1ELDE 3RUOA 5GXPA 1CHOF 1SI5H 4CR5A 3RXMA 3QO6A 2OBQA 4Y0ZE 2P93A 3H7TA 1SG8B 1BHXF 1WSSH 1BITA 3LONA 3N99A 2ZO3H 1GHAG 4MNWA 2TIOA 1VITH 2Z6BD 3UREA 1GHXH 5AFYH 1C1QA 2Z9KA 3SNBA 2PP6A 4GUXA 3LGVA 4DG4A 2OC8A 1ZRKA 1MTNC 4ABHA 2FTMA 5HM2A 3SZNA 1UCYK 4CH8B 1H9IE 1JWTA 2AIQA 4BAMB 3UR6A 2ILNA 1BMLA 1GMDF 1CA0B 4UONA 4UFFH 4H4FA 3FVFB 1IAUA 5E8EH 4ZROA 1AO5A 2WYGA 3V12A 1VCPA 3QX5H 1BRCE 4UFGH 1AN1E 1P0SH 2BZAA 1WXRA 2G4TA 2CMYA 1ELFA 1EASA 1B7XB 1UTLM 3PTBA 1MU6B 3GS9A 3F9HA 3KQ5A 2ZCHP 3N7DA 2RFKC 2LNCA 2QF4A 4DOQA 2H5CA 2WPHS 1WTHD 2J9NA 2QGRA 1MKXK 2SGPE 1KXAA 1W14U 1CGIE 2G81E 3PROA 4XBDA 1VJAU 3KQCA 2YOLA 1SB1H 4TSFD 3SORA 4K60A 1BRUP 3B9FH 3SZEA 3M5MA 5FL7D 3TIUA 3LGIA 4BAKB 1YLCA 2VIWA 2WHXA 2ZKSA 5C0TA 3A7VA 4A5TS 4F55A 3RU4E 4NA9H 3D23A 1E0FD 6GCHG 5HYOA 2PW8H 3SV8A 3MO3A 1C9TA 1GI6A 1T4VH 1WUNH 2BLWA 2EI7A 2NWNA 4CH2B 5B6LA 4AYVB 1BTYA 3RXCA 1MBMA 1ANEA 3IITA 3NPSA 1SHYA 4Y10E 2F9NA 3SGQE 3GICB 1YCPK 2V7QD 1C5XB 2SNWA 3W94A 3LH1A 5TCAA 1T8LA 3M37A 3ZZ4A 2V3OH 1QA7A 3MTYA 4YOJA 3NCLA 1MQ6A 2BX4A 1EB2A 3GOVB 1Z1JA 2BD7A 4RT0A 3RXGA 3A8DA 4VGCB 2ANKH 1P12E 3PB1E 4RI0A 2F9VA 4ABGA 2EI8A 3BEUA 1J17T 4FUGA 1OHHD 2CGAA 2L6OA 1PFXC 3NK8A 2P3FH 1LTOA 2OBOA 4GCHG 5L6NH 4Z0KA 2PUQH 1OYTH 2PGBB 1A61H 1UCYH 2QA9E 1W12U 3O8BA 4D9QA 3ZZ8A 1A46H 3N7EA 4YLQH 1O35A 3UPEA 1AY6H 1FY4A 1NU9A 1MD8A 1LPKB 4R0IA 3UAIC 4I8KA 4JZFH 4DJZB 1AFQB 1HB0B 1QZ8A 3BG8A 1YKTA 1EB1H 2GT8A 2F4LA 5PTPA 3SU4A 1BBRK 3LU9B 3SW2B 4Z1MD 1QRWA 1DT2A 1ABJH 1O3IA 1EOLA 2HLCA 5A2MH 3CENA 1YPHE 1EAWA 2OQ5A 3SQHE 5CMXH 1XX9A 3FKSD 1QIXB 1GBKA 4NIWA 4CR9A 2C8WB 1HAIH 1SGYE 4KGAA 3KGPA 1OWJA 1D3TB 2O8LA 1DUEA 5DPAA 3RXKA 4GPGA 2R3YA 3QZQA 3U1IB 4O03A 1S6FA 2R9PA 1C5OH 2Z9IA 4X2VA 2C93B 3JZ1B 3KF2A 2ZU1A 1P2QA 2FX4A 2PLXA 5EJLA 4XD7D 1DUAA 1RJXB 1CO7E 1HFDA 9ESTA 2UUJB 2A4RA 1O3PB 3A8CA 3E0NB 1Y59T 1GL0E 4JYVH 3S0NA 3O8DA 3RM0H 4IN2A 1F0UA 1TQ7B 3UB0A 3U28C 1PQ5A 4Y7AA 2PV9B 2XTTB 1GBMA 2FEQH 3TGJE 1UW7A 4ZXXH 1HAYB 1S6HA 1ZJDA 4CRGA 4AFZA 1AVGH 1HAHH 2XC5A 4K8YA 4E7NA 4IMQA 2B9LA 2M2AA 4WY3A 1O3OA 1AE5A 4KELA 1V2KT 3EQ0H 2OP9A 2BMGB 1KY9A 3FP8E 4DT4A 2FI5E 4KTSA 2JH5D 1JRTA 4SGAE 2A4QA 3HPTB 2HPPH 3BTGE 1E36B 4TPIZ 3SHCH 1SGEE 1MBQA 3F3BA 2FLBH 3IWMA 3MU5A 5IK2D 4ABJA 5FXLA 1CBWC 4GCHF 1FAKH 1W10U 2QXIA 3TU7H 4UD9H 3SYJA 4DGJA 2BD8A 3QTOH 1A5IA 4NZQA 2P95A 3K6ZA 1AZZA 4AFUA 1P3CA 5T6DA 1DVAH 2K0QA 1C4V2 4WH8A 3NKKA 1YPEH 1IQNA 1TFXA 1Y3YA 3D49H 1P10A 1WBGB 2G52A 4ZMAH 3RMLH 1FY3A 3EYDA 1EZUC 2WPJS 1BIOA 1LCYA 4Y7BA 2XW9A 2PUXB 3MI4A 4NA7A 1PQAA 3GY7A 4DCDA 1ESAA 3RXVA 2ZCLP 4GHTA 2ZTZA 4AYYB 1GI5A 1IQKA 4E05H 1GMCG 3V13A 1FPHH 3ZVCA 1TRMA 3M5LA 3LJOA 3QLPH 2HNTE 1TBQH 3OSYA 2AMPA 2BDHA 5EOKA 1UTQA 3ZZ5A 3VB6A 1DWBH 2P3TB 2ZTYA 1NRRH 2J38A 4ABDA 1YCPM 1E35B 1ZMLA 2QC2A 3PLKA 2J34A 1O3KA 3TK5A 1LPZB 1HGTH 4D76A 1F92A 1GMHG 4CHAC 2RDEA 4MTBA 4GLYA 1QBOA 2ZDNA 3UUZA 2R2WU 1Y5BT 2ZECA 5C3NA 1P06A 2ANYA 3KYGA 1KXFA 1FZZA 2WPLS 2PR3A 4B71A 1KIGH 1EP5A 1ELCA 4UE7H 3ZYEA 1MTWA 3RXLA 5G4BA 1DXWA 1IHSH 1Y3UA 1BTWA 3K9XB 1JIRA 2BD3A 3Q77A 1DY9A 3QN7A 4NIXA 4YM9A 2AERH 1P02A 1H1BA 3MO6A 2PGQB 1OWHA 4D7FA 1XUFA 2ULLA 3M7QA 1ID5H 4TY6A 1QA0A 1MAXA 2AMQA 2GCTB 3F1SB 1P04A 2VH0A 4NIYA 1YLDA 3LIWA 5HMAA 1KXDA 1DWDH 1HCGA 3L6PA 1YP9A 4LZ4B 1GDNA 3SJKA 1D3DB 4ABIA 1YPHC 2BD4A 3U98H 1TMUH 3RXEA 4HG6A 1UTOA 3PLPA 2AGGX 1C5MD 1GVLA 3RXTA 3UR9A 1C1PA 1TBZH 3E16B 1TBRH 7LPRA 1COWD 3AW1A 4MQAA 1IQLA 3ZZ3A 1V2OT 1O30A 1G3BA 5BPEA 2UWOA 5C5OA 4YOIA 2NU1E 4Y0YE 1OWDA 1O3BA 1QHRB 1O5EH 1D3PB 1GMCF 3PWBA 1YPKH 2FTLE 2F9UA 1JRSA 2Y7XA 1NFWA 1DICA 1SR5C 1UVPA 5GCHG 3O8CA 1A3BH 2XWAA 1ZZZA 4NFEA 5DGJA 1PJPA 4ZHMU 4JYTA 5JBCS 2V3HH 4CREA 1O3EA 2XNDD 3T27A 1DE7H 3ATLA 3KN2A 1DLKB 2ZHQH 3SI3H 1PPHE 2IJD1 1QR3E 4K2YA 1VGCC 1NROH 4D8NA 3MU8A 1EAUA 1C4U2 4K1EA 1HJ8A 2ESTE 4K69A 1RS0A 2D1JA 1P2MA 3RXQA 4FU9A 4GAWA 1FIWA 3SJ8A 4I86A 2BM2A 2SGAA 1S5SA 1V2VT 3A88A 3SUFA 2HWLB 3PO1C 3GCHC 4UDWH 5EXNA 5F8XA 3MMGA 4FUCA 4I7YH 1P09A 2JETB 5KECA 1GBIA 3S7HB 4F48B 5A8ZA 1C4Y2 1O3MA 2Z7FE 5IDKA 1EZSC 1AU8A 3UQVA 3E6PH 3AK5A 2BVSH 2J2UA 1H8IH 1NRPH 5T3HA 1NN6A 2EY4C 2STAE 3ITIA 2FODA 1LQEA 2Q6FA 4NFFA 2F91A 1CGHA 1GJ9B 4CBOA 4H6TA 1LPGB 1W0KD 2BVXH 1TRYA 3U69H 5DP5A 2A5KA 1HJAC 1E37B 1ZMNA 1L4ZA 3HGPA 4Q80A 1O2MA 2Y6TA 1GBFA 4UEHH 2KM0A 1LVOA 1W0JD 2VGCC 1SGPE 1NC6A 5AHGH 3ZZ6A 3BTFE 4MVNA 1Q3XA 1HPGA 5EQSA 3MNBA 5FBIA 5C5NA 1AMHA 1K21H 1O34A 5A0BA 2OC0A 1RTKA 2G51A 4YLUA 1QTFA 1TIOA 2HNTC 3AASA 1C2HA 4Q4LA 2WV5A 1BMAA 4ACAA 5C94A 1O2GH 1SGNE 1FONA 1OKXA 2ZFPH 4FOUC 2THFB 5E0HA 1C5NH 1Y5AT 2M5TA 4H6SB 2GMTC 1TNJA 1SHHB 1BMFD 1ELGA 5DSFA 2BD2A 2P59A 4ZXYH 3RLYH 2JKHA 1LKAA 3KQBA 3QGJA 2KX4A 3A85A 4I33A 3A7XA 2Z94A 1GDQA 1GBCA 1ZTLA 3V3MA 2W7SA 4AB9A 1AD8H 2AEIH 2WINI 1CSOE 4FUEA 3JZ2B 3KCGH 4ZCNA 2F9OA 2ZDKA 1ETTH 1BTPA 2WYJA 3KL6A 5FCRA 1FIZA 4WMFA 1MZDA 2NU2E 3NRLA 4BANB 5A8XA 1ELAA 3RXSA 4FU8A 3LDXH 2GKVE 1D6WA 2FS9A 3BIUH 1QCPA 2RG3A 2AMDA 3TPIZ 1FLEE 2HVYB 1O37A 2H5DA 2HGTH 3L3TA 1GHWH 1XXDA 3P8OA 1ELTA 1UK4A 3FO8D 1GJ5H 4ISOA 2KFWA 3STJA 1KSNA 1XM1A 3TK6A 1DY8A 3RM2H 1SL3A 3SU6A 1O3AA 3FOAA 1EZQA 2PKAA 3V7TA 3RMNH 1C5SA 4X8UH 4HGCA 1L1GA 4FETA 3SGBE 3HATH 4B76A 2YMSB 1EATA 1P2JA 3SU5A 1O39A 5A8YA 3F2GA 3RXAA 2FI4E 4E7RG 2SNVA 1EKBB 4O3TA 1C2IA 1BA8B 1L4DA 1HXFH 2BD5A 1ZTJA 4BNRA 4U2WA 2BQ7B 4WJG2 4INKA 2GCHF 1C5YB 1SFIA 2ZNKH 2PKAB 1O5BB 1Z8RA 3M61U 1O3FA 2ZU2A 1BJVA 5LH8A 3NUMA 1TYNA 1AGJA 1FY8E 3DT0H 3ESTA 1YPMH 2GZ7A 3LGUA 4D9RA 2ZGCA 4KP0A 4Y79A 3LC5A 2BDGA 2ZQ2A 2NU0E 2ZGHA 4B6EA 3QDZB 3CP7A 3MH6A 3P8FA 1J9CH 1K1OA 3M3TA 4YESB 1DWCH 1PQ7A 5EIYA 2QCYA 2XC4A 1RIWC 4THNH 3CNRA 4ZHAA 3OTJE 3PMJA 3PV4A 1E1QD 1GJBB 3MFJA 2OTVA 1ETRH 3RLWH 3TH3H 1SBWA 1TX8A 1AUTC 1OYQA 1GCTC 4Y76A 3PV5A 1V2TT 1TPAE 2ZCKP 1KTTB 1K1IA 2HALA 1GI1A 6CHAB 1XKBC 4ZKOU 2CJIA 2VNTA 3GCHB 1W0ZU 1UTMA 2FDAA 1ARCA 2C3SA 3HKJB 1TGSZ 3MOCA 3SNAA 2BQ6B 3ZIAD 2O8MA 3AAUA 2K8IA 4DT7B 1N8OB 1MCTA 5T6FA 3TJNA 3ATMA 1UVOA 2A32A 1TMBH 1OSSA 1XVOA 4X6OA 2EI6A 3A8BA 3LC3A 5C20A 5E0GA 1TE0A 5F03A 1W2KH 4AX9H 1V2UT 1HJAB 4RT1A 3SGAE 3TJOA 1NRSH 3ZZDA 3M3SA 2GJGA 2FMJA 2C8ZB 2EA3A 1K22H 4NIVA 2D8WA 1ETSH 3F68H 1HRTH 1EPTC 4X8TH 3WW7A 4B73A 4A6LA 3UY9A 4OS7A 2K1QA 1HAPH 2A2QH 2IOTA 1AZ8A 1ELEE 5SGAE 1GHBG 1UMAH 1TGBA 1Y3VA 1CQQA 1SQOA 2ZGXH 1K28D 1E79D 2H2ZA 1WDIA 2P8OC 3ZVAA 2OINA 1FN8A 1TX7A 5DG6A 2J94A 1GWAA 2FLRH 3VB5A 1MU8B 2OXSA 4IC6A 2PFEA 4IC5A 2OC7A 5HIYA 4U30A 2A7HA 3DUXH 1C2MA 4IGDA 2GMTB 1KXEA 4CRDA 5FCKA 2KCYA 2G55A 1IQHA 4K1TA 4CRAA 2CHAB 1T8NA 2ZFQH 3ODFA 5CHAC 5EQQA 3SNCA 3VXEH 2EEKA 4GHQA 1D3QB 3LGWA 1GHAF 4Q7YA 3LJJA 1CU1A 2A1DB 2J4IA 1P11E 1TNIA 3AVZA 1O38A 1S0RA 5L2YH 3PMHB 1SVPA 1QB6A 1TA2A 1Z8GA 2VWNA 4AG1A 1WOFA 1O2SA 4MNXA 2BLQA 1Y3WA 2GV6A 5C67A 1O2HA 1GBLA 1SPJA 3DCLA 1GBHA 1TOMH 1AI8H 1EQ9A 1C1MA 3TK9A 2FXRA 3CS0A 1K1LA 4INLA 5GIBA 2WZQA 3K65B 5TJXA 5CHBA 5C17A 5I46H 5IYTA 2PSYA 2PKSC 1P2KA 3RXPA 1O2JA 2FYQA 2BLOA 3GY8A 5CE1A 3FZZA 4CBNA 1CT0E 2GX4A 1NBMD 3PMAB 1EJNA 1T4UH 2ZDVH 3RXHA 4JZIA 3BSQA 3OEHD 1KTSB 3A86A 1TLDA 5DK1A 3O8RA 3BG4C 1Z7KA 2QAAA 4ABBA 3VXFH 3U1JB 1YPJH 1QL7A 1OP0A 2W6ID 3BTHE 4TWWA 4WXIA 4BXSA 1SLVB 5BRRE 1INCA 1PPBH 1GDUA 4OM9A 2A4GA 2XYAA 6GCHF 1HXEH 1O2TA 4XOJA 1B0FA 1MH0A 1MKWK 3A87A 1PPEE 1GHBF 1BTZA 2R2MB 2F9BH 1A2CH 1KXCA 3OE7D 2Y81A 1C5LH 1O2WA 1IOEA 3SV6A 1QQUA 2ANMH 2RA3A 2A0QB 2TGPZ 5EPNA 4MG3A 1OS8A 1VITG 1AKSB 5HIZA 1TOCB 2VH6A 1SLXB 2OCVB 5C1UA 3S9BA 1IQIA 1SGTA 1MTNB 2VINA 1RIWB 4X8SH 4IN1A 8GCHG 3HGNA 1L1JA 4YT6H 2ANWA 4IW4E 2WSSD 2ZC9H 2QV1A 3SQEE 1SLWB 1QRXA 2OQUA 3DA9B 1GJ6A 1ESTA 2HVXA 1NZQH 4JK6A 1K1JA 3A8AA 5LPEA 2R0LA 3PLBA 2AYWA 2FOFA 1SFQB 2XRCA 1EPTA 5ABWA 4MDSA 1AB9C 2VWMA 3HK3B 3ZZBA 2YMSD 3EAJA 1ORFA 1JOUB 2QF0A 8ESTE 3S9CA 3Q3KA 1TPSA 4BXWA 2P16A 2TGAA 1O3NA 1ZGVA 3BTDE 1A1RA 2C8XB 4FUFA 4BTTB 5GJ4B 1ZHRA 2DE9A 1G2LA 3K6YA 3TITA 4X0WU 3MNCA 5EW2H 2VJ1A 4FUDA 3UWIA 1FI8A 2F3CE 1C2EA 2VIOA 1MTSA 3BIVH 1MQ5A 4A7IB 1FUJA 1EPTB 2BTCE 1C5PA 1DSTA 2QIQA 1QQ4A 3MH7A 3VB4A 1O2YA 1DOJA 1SGIB 2OUAA 4NZLA 1TNHA 1PYTD 1ZPBA 3M3VA 5C1YA 5DO4H 1QGFA 2P8OB 1ZLRA 1O5CB 1Y3XA 5ESBA 4NA8A 1K0HA 4J2YB 4K8BA 2UWPA 1WQVH 2BZ6H 1C2KA 3U8OH 1MKWH 1GBDA 3ZVEA 5LPFA 3A82A 3SU1A 1OP8A 3OAAD 4ABFA 5CHAB 2C4FH 1ESBA 1C1UH 2IJOB 1GBEA 3MWIU 1VITF 3A7WA 3SN8A 5JDUB 4A1XA 3TNTA 4KTCA 1XKAC 1BUIA 3RXBA 1THSH 2H9HA 3OU0A 2QXGA 3RXRA 3U8TH 1MUEB 8GCHF 1H9HE 2DUCA 3VGCC 2V6NA 5JBAS 1LHDH 2ZDMA 1G37A 3GCTG 1O3CA 3FP7E 4QT8C 2BX3A 4MNVA 3RMMH 1DPOA 2BXTH 2CF8H 1KLIH 3HK6B 4Z6AH 4AG2A 4K1SA 1A5GH 2BOHB 3E8LA 1HUTH 2BLVA 1TA6A 2PKSB 4P02A 1PPGE 2FOEA 2GVFA 2Y7ZA 2FO9A 1DDJA 2CK3D 1YM0A 2FP7B 3D62A 2GD4B 1LHGH 3FANA 1IQEA 3T25A 3VPKA 2O8UA 2YNAA 1ZRBA 2BXUH 4ISLA 4ZKRU 2AIPA 1C2JA 1S85A 1WYKA 3SU0A 1H8DH 3GDSA 1NM6A 3F0PA 2R0KA 2SGEE 2ALVA 4AGJA 1THRH 4AORA 4I8GA 1GPZA 3BTKE 1DM4B 1O5GH 4NG9H 1C1NA 2IPQX 1VR1H 1P2IA 2O9QA 2QXJA 2GV7A 1O2XA 2W5EA 4B6FA 2Z9LA 2XCFA 4R8TB 1GJ4H 3QUMP 1GI8B 1YLNA 2FESH 1ZPCA 2ZPQA 1DLEA 1W0YH 1YBWA 9LPRA 2KZ4A 3EDXB 1A0LA 3H7OA 5I25A 4HFPB 5JYIA 5DN6D 1WAYB 2V35A 2AFQB 1NFXA 4ABAA 1GHYH 2VB0A 1GMHF 1TQ0B 2G8TA 3L33A 5EGMA 2KCAA 3MQKC 5B6OA 4FUJA 2ZI2H 2SFAA 3MHWU 2ZHEH 2BDYA 3EA7A 2CXVA 3NZIA 5EW1H 1C9PA 3Q3XA 5DP9A 1F0RA 3ENSB 1V2WT 4XFQA 5EJZA 4NWLA 1ELVA 1V2MT 4UFEH 1FAXA 1P01A 2XXLA 2ZHFH 1PYTC 1ZTKA 2ZU3A 3F2FA 3D65E 1FMGA 1OP2A 4Q2KA 1RTLA 3ZV9A 3VG8A 1IQMA 1OXGA 1TGNA 1ZOMA 1WQSA 2ALPA 1CBWB 2L74A 3C1KA 4Y71A 2I6SA 1PPCE 4A92A 3GCTF 3UQOA 1O36A 3TH2H 1AB9B 3EA8A 4ESTE 1OX1A 3MU1A 3PYHA 1RGQA 2XCNA 2QXHA 2FX6A 3P17H 2FOHA 2RDLA 2H6MA 2IPHA 1AVWA 2JIZD 3DSPA 2A5AA 4DW2U 1QB1A 4JZEH 1HV7A 2J98B 1XUJA 1ZSLA 1DWEH 4TPYA 1QL9A 2JJ1D 2W3IA 4NGAH 4OS4A 1XUIA 4X1PU 1U6QA 2WPKS 1SMFE 4AB8A 1GCDA 1NRQH 1TPOA 1UVSH 4ISHH 3P8GA 3OY6U 1SGFA 5DP3A 4X1SU 2V0BA 4XE4A 4AFSA 3H09A 3GYLB 1O2ZA 5HKKD 1AVXA 4F49A 1ARBA 3BEFB 1S84A 4DVAU 2XBWA 2UUKB 3GY3A 2Q6GA 2AHME 3H5CB 1W7GH 4U32A 5GCHF 2TPIZ 3UFAA 2SGDE 1F2SE 1P57B 2RA0A 1MMJN 4BAQB 4CHAB 1CA8B 3AAVA 1T8MA 2UUYA 3HKIB 2O8WA 2AGEX 4H42U 1O5DH 3KIDU 1LHFH 3P92A 1Z1IA 1K2I1 1NU7B 1ACBE 4LOYH 1A0JA 1LDTT 2WV4A 3I78A 3RMOH 2BDBA 5GPIB 2D2DA 3SV7A 3M5NA 5C1XA 4YOGA 3RU4T 1ZHPA 1KYNA 2G4UA 1Y5UT 2ZU4A 2BDIA 3MU0A 2EC9H 1MD7A 1HJ9A 3VGCB 1C2GA 1GG6C 5H4IB 2FS8A 2ZPSA 1GMDG 4OGXA 1O3JA 3VB3A 1JBUH 2OD3B 2VIDA 4X6PA 5FPYA 1HAZB 2HPQH 4LXBH 1KDQB 3E90B 1B0EA 2F9PA 3ZZ7A 5EXMA 4ZHLU 2VIPA 1ANDA 1LVBA 2ZF0H 3QTVH 4XSKU 1N6YA 4XRNA 1CVWH 2ZFSA 3ZYDA 3MH4A 4B75A 4WVPE 3SV2H 3EE7A 2XBVA 4O9VA 2BY8X 1K1MA 1G30B 2BDAA 3QZRA 2GP9B 2Z3CA 1JXPA 2A45B 5TCCA 3TVJB 3PV2A 1QURH 2YNBA 2NU3E 1J15A 2C8YB 1GBBA 4UFDH 2BY7X 1ELBA 1J14A 3RXJA 4B2AA 7GCHG 2G5NA 1NO9H 1GHVH 3T29A 2WUCA 2A7CA 1ZSKA 1BTUA 3DFLA 2W26A 1V2JT 4JZDH 1NTPA 4HI3A 3STIA 1N6XA 5KEDA 2XBYA 3UOUA 1ABIH 1GJ8B 1YF4A 3MO9A 2BQWB 2ZHDA 1DX5M 4K3JA 1C1WH 4XDEA 1GBJA 2FPZA 2KCOA 2VVVA 4I8LA 1UTJA 1VGCB 1A4WH 4BTUB 1D6RA 1Z6EA 1MTVA 5L2ZH 1NT1A 3QWCH 5J4SA 1HIAA 3LGTA 4ASHA 4MPUA 4X2XA 3VB7A 4CRCA 1BT7A 3ZZCA 2ZHWH 4IMZA 4MNYA 1V3XA 3GY6A 7KMEH 1WTGH 2LELA 2ZDAH 1S81A 1F5RA 2Q1JA 3TH4H 4X1NU 4X2WA 5KGOA 3PO1B 4Y8YA 1TNGA 2Z9GA 1DANH 3F9GA 4XBBA 4TT3D 3BTTE 2GDEH 1GBTA 4KTUA 2GGVB 2TRMA 2VWOA 3M7TA 4X1QU 3R0FA 4DY7B 1K9OE 2PSXA 3OX7U 3GCNA 3PRBA 3E0PB 5AF9H 1MZAA 1HIAB 1FXYA 2AGIX 1F0TA 1AUJA 2FM2A 3EA9A 1E34B 3A80A 4AOQA 5A09A 2AH4X 3ZVBA 2XBXA 4CRFA 1F7ZA 1G3CA 1GJCB 3ELAH 3W95A 1O3GA 3A81A 3OEED 2FYRA 1ZMJA 2VGCB 5ETXA 1RXPA 3PM3A 1TONA 4YT7H 1J8AA 2OC1A 1SGDE 4FUHA 5EQRA 4YTAA 5F6MA 3TGKE 2JH0D 1TPPA 1YY3A 3OYPA 3PMBB 4GVUA 5DP7A 1FPCH 3SUEA 1OOKB 3M35A 1QBVH 1SGFG 3GY2A 1EOJA 3GDUA 2WV9A 1IQJA
chains in the Genus database with same CATH topology
1ZHMA 1F0SA 2ODYB 4WXVA 1MCVA 1RRKA 3S7KB 7GCHF 3NWUA 4AN7A 4K5ZA 1RTFB 3T2NA 1FNIA 3FFGA 1L2EA 1SQTA 4FU7A 2ZPRA 1UJ1A 2FOBA 1A3EH 1K1NA 3KNXA 3UWJH 3UTUH 1HYLA 1ZJKA 2GZ9A 4ZAEA 1UK2A 2UUFB 5EPYA 1TABE 5JBTA 2W7UA 1O2PA 4BAHB 4B74A 4B1TA 1BRBE 1OWKA 1QBNA 5JB9S 1RFNA 1UTPA 1CE5A 2TGDA 2BOKA 1Y8TA 3P95A 5E0JA 2FOMB 3UNSA 2BY5X 3LKWA 4HZHA 3SV9A 1GL1A 1QJ7B 2ZGJA 1GG6B 5JPMH 1SGQE 6LPRA 1V2RT 1N1LA 1HBTH 5FPSA 1M9UA 1TAWA 3MU4A 3S69A 4NWKA 2W3KA 4MPVA 2TBSA 5ESTE 2A5IA 1V2LT 1C5QA 2VWLA 1L1NA 1LVMA 1THPB 1XUGA 1SQAA 1B5GH 4ZKNU 2BVRH 3TGIE 4SGBE 3RU4D 2HOBA 1XMNB 1P2NA 3OY5U 1LQDB 3RC6A 3U9AH 2GCTC 1TMTH 2GZ8A 4DIIH 1XXFA 1O2NA 3LT3A 2ZEBA 4X2YA 4DURA 1AKSA 3A83A 2KAIA 2D26C 4BAOB 3GCOA 1AWFH 1AQ7A 3I77A 1O5FH 1OWEA 1KLJH 1Z71A 2HRVA 1QNJA 5DP4A 3RXDA 1MKXH 2PTNA 4JYUH 1QJ1B 1HLTH 1T31A 3ATKA 3SO3A 3GISB 1S83A 4M7GA 1C2LA 2FZZA 1EJMA 4PROA 1C1OA 4BTIB 4J1YA 1FN6A 4E06H 3GY5A 1PPFE 1MTUA 1BCUH 2KAIB 1UTNA 1LVYA 1C1VH 2B0FA 3BF6H 3Q3YA 1NRNH 3MYWA 1BJUA 1HAXB 4TY7A 1D9IA 1GBAA 4MPWA 1BQYA 5DP8A 1CGJE 2FOAA 4ISNA 1G9IE 1TB6H 1YPGH 1NY22 1UHBA 5FAHA 5C2ZA 3KHVA 1YCPH 3WY8A 3M7UA 3A7YA 1GCTB 3MNXA 2Z9JA 1BOQA 2IN2A 1HAGE 3SUGA 1UK3A 3FP6E 1EJAA 4I8HA 5AFZH 2Y82A 4WMEA 1OPHB 2FIRH 1Q2WA 1O2OA 1K1PA 3I29A 4OS2A 2VVUA 4OS6A 3AW0A 1ZGIA 1UHBB 1ZSJA 1EAIA 1FQ3A 5FPTA 2JETC 4ISIH 2ODQA 1VJ9U 4RKOB 3F6UH 3URCA 1FDPA 1KXBA 2P3UB 1SLUB 3E1XB 3P8NA 3GY4A 1GI4A 3IG6B 3BEIB 2BHGA 3BTEE 8KME2 4HTCH 5HM9A 4I32A 1O2QA 4NSYA 1OWIA 4RKJB 5K7RA 1GGDC 4FVBA 2QN5T 2ZP0H 2XNIA 2I6QA 2QYIA 5DP6A 3E3TA 1H9LB 2FWWA 1BBRH 1O32A 1G36A 4GSOA 3BTWE 4ABEA 3SU3A 1G2MA 1MAYA 2STBE 4O3UA 4TYDA 2ODPA 1HAVA 3SJ9A 1GJ7B 1Q31A 1CT2E 1HDTH 3R3GB 3SI4H 4DIHH 4MPXA 5K0HA 4Y11E 3SUDA 1AWHB 1O2KA 2ASUB 2ZFFH 1QY6A 2G5VA 3NXPA 3BN9A 1O33A 1NFUA 1H4WA 1IQGA 3RXOA 5F8ZA 3P6ZB 4FUIA 1EX3A 3LGYA 1X7AC 1PQ8A 4X6MA 1S82A 1Z6JH 3SJOA 3MH5A 3UIRA 1LKBA 1QFKH 3E91A 3T5FH 1G3EA 1JIMA 1O5AB 5GWZA 3KQEA 1HAVB 3GDVA 3UOPA 1C5ZB 1O2UA 3TLOA 3SOSA 4X1RU 4JK5A 4WMDA 1C1SA 1T7CA 2FOGA 2H9TH 2WPIS 2XC0A 4B2BA 1BHXB 4O97A 3EGKH 2R3UA 4I31A 2GT7A 3PTNA 3ZVFA 1YYY1 2Q6DA 2BDCA 2B8OH 1C5TA 2PTCE 1ZPZA 1BDAA 3DFJA 3RXUA 2SGQE 1BRAA 1XUKA 2ZG0H 1TGTA 1Z8JB 2QF3A 2UWLA 4Q7ZA 1O2VA 1LMWB 1O0DH 2A7JA 1NS3A 1AIXH 1NFYA 1P3EA 1F5LA 2HNTF 1AFEH 1V2NT 4OS1A 1G3DA 1CHGA 4LZ1H 1UO6A 2VIQA 1UCYE 3FAOA 5FBEA 1C5WB 1GVZA 3VEQB 3BG4B 4A1TA 7ESTE 2VVCA 3BTQE 1LHCH 1P9SA 1QB9A 4TWYA 1O31A 1LHEH 2A2XH 3SNDA 1ZYOA 2B7DH 2ZGBH 1NESE 1P8VC 4OGYA 1EXFA 4NSVA 2FOCA 1W13U 4YO9A 1ZR0A 5FX6A 1YPLH 1GI0A 3T62A 1SGCA 2GDDA 3CS7A 5A0AE 1AE8H 2VU8E 1O3DA 1TNKA 1C1RA 2ZQ1A 3ZVGA 1UVTH 1YC0A 1T8OA 2XWBI 6ESTA 1P9UA 1DXPA 2SGFE 3BTME 5J4QA 1V6DA 2C90B 3GYMA 2CF9H 1P2OA 1DFPA 5E2OA 1C5VA 1VCWA 1V2ST 4AGKA 5LPRA 1E38B 1EAXA 3S9AA 2ZZUH 1P05A 2OLGA 1D4PB 3LPRA 5EODA 5AVDA 4IBLH 3LOXA 5T6GA 2P94A 3N7OA 2ZA5A 2BYAX 3UNQA 3C27B 2WPMS 1Z8IB 1EZXC 1SOTA 1GHZA 1YGCH 2RCEA 1DITH 2PWXA 1BZXE 2QY0B 1CA0C 8LPRA 1WCZA 3BV9B 1UVUH 4RSPA 1UTKA 1NPMA 1TGCA 3SU2A 3DD2H 2Y80A 5FX5A 6CHAC 5DJ7A 1IHTH 3MNSA 4A1VA 2B5TB 2CV3A 5F8TA 1GI7B 2F83A 5EU8A 3K2UA 3LH3A 3A7TA 1EUFA 4Y8ZA 1C5UA 3TJUA 4F4OC 5E2PA 4WWYA 2VIVA 4FVDA 1TWXB 2BY6X 1N8OC 3A84A 1RD3B 3ZV8A 2PHBA 1F5KU 1BMNH 3A89A 1P03A 2J95A 5L30H 3PWCA 4LK4A 1A0HB 2CN0H 1GGDB 4U01A 1S0QA 3KEEA 1SC8U 1TX6A 4FUBA 4JCNA 2ZWLH 3RDZA 2ZU5A 1O3HA 1ANBA 4KKDA 4B2CA 5GDSH 2GCHG 3SJIA 1JMOH 2ZFRH 3M36A 1BB0B 2Y5HA 3ODDA 1IQFA 1CHOG 2LPRA 3P70B 1BMMH 1O2IA 1BBRE 1WU1A 4Q7XA 1ANCA 1TNLA 1FV9A 1GI2A 3F9EA 4JZ1A 3SNEA 4D7GA 2BB4A 1A5HA 4Y6DA 1O2LA 1GJAB 1DSUA 3TJVA 2Y5GA 3M5OA 2TGTA 4ZKSU 3RXIA 4AFQA 1KDQA 3EE0B 1A7SA 3T26A 5HXFA 1O2RA 1GJDB 1T32A 1TALA 2J92A 2CHAC 1GI9B 5HGGA 1C1TA 2A4OA 2H1UA 4JMYA 3SBKA 4CRBA 4I8JA 4OS5A 4X8VH 1QJ6B 3B8JA 4VGCC 1O3LA 5FHTA 3ATIA 3RC5A 1WV7H 1J16A 3UNRA 1W8BH 1C5RA 1L0ZA 1TRNA 1SSXA 4WH6A 1FJSA 3KQDA 1G32B 1HAOH 1W3CA 5EG4A 4INHA 4YZUA 2O8TA 3DHKH 2AS9A 4FXGH 2H9EH 3TNSA 4Y8XA 4AZ2B 2NU4E 3Q76A 1VCQA 1KLTA 1XVMA 1AFQC 2DE8A 3ZZAA 1PPZA 2ZIQH 1HNEE 3VFEA 3QK1A 1BTHH 3T28A 3RXFA 1C2FA 1W7XH 3SHAH 2BD9A 3Q00A 1DS2E 5LGOA 1EP6A 2WUBA 1GI3A 2FI3E 1LO6A 1QL8A 4WF8A 2Z3DA 3F9FA 3ZZ9A 2GTBA 3FZDA 3URDA 3ATWA 3V0XA 2Z3EA 2JH6D 2ZDLA 4ZUHA 5DKMA 1C2DA 3U8RH 2G00A 3RP2A 4RN6A 4XBCA 5EXLA 1W11U 5A0CA 4IS5A 5JBBS 4NCYA 1QRZA 1CT4E 1XUHA 4BOHA 1FY1A 1AHTH 1VZQH 2Y5FA 1SOZA 1V2PT 3ZVDA 2ZTXA 1GVKB 1SGRE 3B23B 4ZH8A 3RC4A 1FY5A 3QGNB 5JB8S 3A7ZA 1V2QT 4MLFB 2A31A 2BY9X 3G01A 4X6NA 2ZFTA 1BTXA 1ELDE 3RUOA 5GXPA 1CHOF 1SI5H 4CR5A 3RXMA 3QO6A 2OBQA 4Y0ZE 2P93A 3H7TA 1SG8B 1BHXF 1WSSH 1BITA 3LONA 2ZO3H 1GHAG 4MNWA 2TIOA 1VITH 2Z6BD 3UREA 1GHXH 5AFYH 1C1QA 2Z9KA 3SNBA 4GUXA 3LGVA 4DG4A 2OC8A 1ZRKA 1MTNC 4ABHA 2FTMA 5HM2A 3SZNA 1UCYK 4CH8B 1H9IE 1JWTA 2AIQA 4BAMB 3UR6A 2ILNA 1BMLA 1GMDF 1CA0B 4UONA 4UFFH 4H4FA 3FVFB 1IAUA 5E8EH 4ZROA 1AO5A 2WYGA 3V12A 1VCPA 3QX5H 1BRCE 4UFGH 1AN1E 1P0SH 2BZAA 2G4TA 2CMYA 1ELFA 1EASA 1B7XB 1UTLM 3PTBA 1MU6B 3F9HA 2ZCHP 2LNCA 4DOQA 2H5CA 2WPHS 1WTHD 2J9NA 2QGRA 1MKXK 2SGPE 1KXAA 1W14U 1CGIE 2G81E 3PROA 4XBDA 1VJAU 3KQCA 2YOLA 1SB1H 3SORA 4K60A 1BRUP 3B9FH 3M5MA 4BAKB 3TIUA 3LGIA 1YLCA 2VIWA 2ZKSA 3A7VA 4A5TS 3RU4E 4NA9H 3D23A 1E0FD 6GCHG 5HYOA 2PW8H 3SV8A 3MO3A 1C9TA 1GI6A 1T4VH 1WUNH 2BLWA 2EI7A 2NWNA 4CH2B 4AYVB 1BTYA 3RXCA 1MBMA 1ANEA 3IITA 3NPSA 1SHYA 4Y10E 2F9NA 3SGQE 3GICB 1YCPK 1C5XB 2SNWA 3W94A 3LH1A 5TCAA 1T8LA 3M37A 3ZZ4A 2V3OH 1QA7A 3MTYA 4YOJA 3NCLA 1MQ6A 2BX4A 1EB2A 3GOVB 1Z1JA 2BD7A 3RXGA 3A8DA 4VGCB 2ANKH 1P12E 3PB1E 2F9VA 4ABGA 2EI8A 3BEUA 1J17T 4FUGA 2CGAA 1PFXC 3NK8A 2P3FH 1LTOA 2OBOA 4GCHG 5L6NH 4Z0KA 2PUQH 2PGBB 1OYTH 1A61H 1UCYH 2QA9E 1W12U 3O8BA 4D9QA 3ZZ8A 1A46H 4YLQH 1O35A 3UPEA 1AY6H 1FY4A 1NU9A 1MD8A 1LPKB 4R0IA 4I8KA 4JZFH 4DJZB 1AFQB 1HB0B 3BG8A 1YKTA 1EB1H 2GT8A 5PTPA 3SU4A 1BBRK 3LU9B 3SW2B 1QRWA 1DT2A 1ABJH 1O3IA 1EOLA 2HLCA 5A2MH 3CENA 1YPHE 1EAWA 2OQ5A 3SQHE 5CMXH 1XX9A 1QIXB 1GBKA 4NIWA 4CR9A 2C8WB 1HAIH 1SGYE 4KGAA 3KGPA 1OWJA 1D3TB 2O8LA 1DUEA 5DPAA 3RXKA 4GPGA 2R3YA 3QZQA 3U1IB 4O03A 1S6FA 2R9PA 1C5OH 2Z9IA 4X2VA 2C93B 3JZ1B 3KF2A 2ZU1A 1P2QA 2FX4A 2PLXA 1DUAA 1RJXB 1CO7E 1HFDA 9ESTA 2UUJB 2A4RA 1O3PB 3A8CA 3E0NB 1Y59T 1GL0E 4JYVH 3S0NA 3O8DA 3RM0H 4IN2A 1F0UA 1TQ7B 1PQ5A 4Y7AA 2PV9B 2XTTB 1GBMA 2FEQH 3TGJE 4ZXXH 1HAYB 1S6HA 1ZJDA 4CRGA 4AFZA 1AVGH 1HAHH 2XC5A 4K8YA 4E7NA 4IMQA 2B9LA 4WY3A 1O3OA 1AE5A 4KELA 1V2KT 3EQ0H 2OP9A 2BMGB 1KY9A 3FP8E 2FI5E 4KTSA 2JH5D 1JRTA 4SGAE 2A4QA 3HPTB 2HPPH 3BTGE 1E36B 4TPIZ 3SHCH 1SGEE 1MBQA 2FLBH 3IWMA 3MU5A 4ABJA 5FXLA 1CBWC 4GCHF 1FAKH 1W10U 2QXIA 3TU7H 4UD9H 4DGJA 2BD8A 3QTOH 1A5IA 4NZQA 2P95A 3K6ZA 1AZZA 4AFUA 1P3CA 5T6DA 1DVAH 1C4V2 4WH8A 3NKKA 1YPEH 1IQNA 1TFXA 1Y3YA 3D49H 1P10A 1WBGB 2G52A 4ZMAH 3RMLH 1FY3A 3EYDA 1EZUC 2WPJS 1BIOA 1LCYA 4Y7BA 2XW9A 2PUXB 3MI4A 4NA7A 1PQAA 3GY7A 4DCDA 1ESAA 3RXVA 2ZCLP 4GHTA 2ZTZA 4AYYB 1GI5A 1IQKA 4E05H 1GMCG 3V13A 1FPHH 3ZVCA 1TRMA 3M5LA 3LJOA 3QLPH 2HNTE 1TBQH 3OSYA 2AMPA 2BDHA 5EOKA 1UTQA 3ZZ5A 3VB6A 1DWBH 2P3TB 2ZTYA 1NRRH 2J38A 4ABDA 1YCPM 1E35B 1ZMLA 2QC2A 3PLKA 2J34A 1O3KA 3TK5A 1LPZB 1HGTH 4D76A 1F92A 1GMHG 4CHAC 4MTBA 4GLYA 1QBOA 2ZDNA 3UUZA 2R2WU 1Y5BT 2ZECA 5C3NA 1P06A 2ANYA 1KXFA 1FZZA 2WPLS 2PR3A 4B71A 1KIGH 1EP5A 1ELCA 4UE7H 3ZYEA 1MTWA 3RXLA 5G4BA 1DXWA 1IHSH 1Y3UA 1BTWA 3K9XB 1JIRA 2BD3A 3Q77A 1DY9A 3QN7A 4NIXA 4YM9A 2AERH 1P02A 1H1BA 3MO6A 2PGQB 1OWHA 4D7FA 1XUFA 2ULLA 3M7QA 1ID5H 4TY6A 1QA0A 1MAXA 2AMQA 2GCTB 3F1SB 1P04A 2VH0A 4NIYA 1YLDA 3LIWA 5HMAA 1KXDA 1DWDH 1HCGA 3L6PA 1YP9A 4LZ4B 1GDNA 3SJKA 1D3DB 4ABIA 1YPHC 2BD4A 3U98H 1TMUH 3RXEA 1UTOA 3PLPA 2AGGX 1C5MD 1GVLA 3RXTA 3UR9A 1C1PA 1TBZH 3E16B 1TBRH 7LPRA 3AW1A 4MQAA 1IQLA 3ZZ3A 1V2OT 1O30A 1G3BA 5BPEA 2UWOA 5C5OA 4YOIA 2NU1E 4Y0YE 1OWDA 1O3BA 1QHRB 1O5EH 1D3PB 1GMCF 3PWBA 1YPKH 2FTLE 2F9UA 1JRSA 2Y7XA 1NFWA 1DICA 1SR5C