1HVFA

Structural and electrophysiological analysis of annexin v mutants. mutagenesis of human annexin v, an in vitro voltage-gated calcium channel, provides information about the structural features of the ion pathway, the voltage sensor and the ion selectivity filter
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
313
structure length
313
Chain Sequence
VLRGTVTDFPGFDGRADAETLRKAMKGLGTDEESILTLLTSRSNAQRQEISAAFKTLFGRDLLDDLKSELTGKFQKLIVALMKPSRLYDAYELKHALKGAGTNEKVLTEIIASRTPEELRAIKQVYEEEYGSSLEDDVVGDTSGYYQRMLVVLLQANRDPDAGIDEAQVEQDAQALFQAGELKWGTDEEKFITIFGTRSVSHLRKVFDKYMTISGFQIEETIDRETSGNLEQLLLAVVKSIRSIPAYLAETLYYAMKGAGTDDHTLIRVMVSRSEIDLFNIRKEFRKNFATSLYSMIKGDTSGDYKKALLLLC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANNEXIN V
publication title Structural and electrophysiological analysis of annexin V mutants. Mutagenesis of human annexin V, an in vitro voltage-gated calcium channel, provides information about the structural features of the ion pathway, the voltage sensor and the ion selectivity filter
pubmed doi rcsb
source organism Homo sapiens
molecule tags Calcium/phospholipid binding
total genus 127
structure length 313
sequence length 313
ec nomenclature
pdb deposition date 1994-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00191 Annexin Annexin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.220.10 Mainly Alpha Orthogonal Bundle Annexin V; domain 1 Annexin 1hvfA02
1.10.220.10 Mainly Alpha Orthogonal Bundle Annexin V; domain 1 Annexin 1hvfA04
1.10.220.10 Mainly Alpha Orthogonal Bundle Annexin V; domain 1 Annexin 1hvfA01
1.10.220.10 Mainly Alpha Orthogonal Bundle Annexin V; domain 1 Annexin 1hvfA03
1AIIA 3BRXA 1N44A 2ZHJA 1AVCA 1HVDA 1A8BA 1HM6A 4MDVA 1HVEA 1BO9A 2H0MA 2IICA 1BC1A 1N42A 1ANNA 1AOWA 2H0LA 2HYWA 2IE7A 2ZHIA 1N00A 2IE6A 2H0KA 1DM5A 1BC3A 2HYVA 2HYUA 1YCNA 4EVHA 1ANXA 1AVRA 1DK5A 1XJLA 2II2A 1A8AA 1AXNA 1W45A 1SAVA 4MDUA 4X9PA 4HREA 4EVFA 1BCWA 1HVFA 1BCZA 1I4AA 1AVHA 1HAKA 1YJ0A 1BC0A 1N41A 1ANWA 1W7BA 1BCYA 1W3WA 1ALAA 2Q4CA 1G5NA 1AEIA 1YIIA 1M9IA 1HVGA 2XO2A 2ZOCA 2RANA 1MCXA 2XO3A
chains in the Genus database with same CATH superfamily
3BRXA 2HSNA 4C7PA 4FHRB 3SWVA 1R8ME 4D7QA 1AOWA 2H0KA 3HJLA 3L8NA 1BC3A 2HYUA 1AVRA 1YGMA 3SOHB 1W45A 1PBVA 1R8SE 1AVHA 1HAKA 4C0AA 1N41A 4Z21A 1W3WA 3ABQA 1AEIA 4OIYA 2VXGA 1R8QE 1MCXA 4JXHA 1AIIA 1HVDA 1HM6A 4MDVA 4Q2SA 2H0MA 2IICA 3ABOA 1BC1A 3TW5A 3AO0A 1N00A 1ANXA 2II2A 1XJLA 2R09A 1A8AA 2K6XA 4JK1X 4KMUX 1BCZA 1R4AE 1C1KA 1G5NA 1LKVX 4L5MA 4JMOA 4KN4X 1XSZA 3USWA 2XO2A 1N44A 2ZHJA 1AVCA 1BO9A 1A8BA 1HVEA 1BC9A 2H0LA 1Q8DA 2IE7A 2ZHIA 1DM5A 1YCNA 2QEZA 1DK5A 3ABSA 1AXNA 3ANYA 1SAVA 4D7RA 4EVFA 1BCWA 1I4AA 1YJ0A 1BC0A 1UPTB 1ANWA 1RE0B 1W7BA 1S9DE 3USYA 3LTLA 1ALAA 1YIIA 4JWLA 1M9IA 1XT0B 2R0DA 4HREA 2ZOCA 2XO3A 4JMIA 1QC7A 1N42A 1ANNA 2HYWA 2IE6A 2HYVA 4EVHA 1KU1A 4MDUA 4X9PA 3AJCA 1HVFA 3ABRA 4A4PA 4FQ0C 1BCYA 2Q4CA 2OY9A 1HVGA 2RANA 4KN7X
chains in the Genus database with same CATH topology
1AIIA 3BRXA 1N44A 2ZHJA 1AVCA 1HVDA 1A8BA 1HM6A 4MDVA 1HVEA 1BO9A 2H0MA 2IICA 1BC1A 1N42A 1ANNA 1AOWA 2H0LA 2HYWA 2IE7A 2ZHIA 1N00A 2IE6A 2H0KA 1DM5A 1BC3A 2HYVA 2HYUA 1YCNA 4EVHA 1ANXA 1AVRA 1DK5A 1XJLA 2II2A 1A8AA 1AXNA 1W45A 1SAVA 4MDUA 4X9PA 4HREA 4EVFA 1BCWA 1HVFA 1BCZA 1I4AA 1AVHA 1HAKA 1YJ0A 1BC0A 1N41A 1ANWA 1W7BA 1BCYA 1W3WA 1ALAA 2Q4CA 1G5NA 1AEIA 1YIIA 1M9IA 1HVGA 2XO2A 2ZOCA 2RANA 1MCXA 2XO3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AII A;  3BRX A;  1N44 A;  2ZHJ A;  1AVC A;  1HVD A;  1A8B A;  1HM6 A;  4MDV A;  1HVE A;  1BO9 A;  2H0M A;  2IIC A;  1BC1 A;  1N42 A;  1ANN A;  1AOW A;  2H0L A;  2HYW A;  2IE7 A;  2ZHI A;  1N00 A;  2IE6 A;  2H0K A;  1DM5 A;  1BC3 A;  2HYV A;  2HYU A;  1YCN A;  4EVH A;  1ANX A;  1AVR A;  1DK5 A;  1XJL A;  2II2 A;  1A8A A;  1AXN A;  1W45 A;  1SAV A;  4MDU A;  4X9P A;  4HRE A;  4EVF A;  1BCW A;  1HVF A;  1BCZ A;  1I4A A;  1AVH A;  1HAK A;  1YJ0 A;  1BC0 A;  1N41 A;  1ANW A;  1W7B A;  1BCY A;  1W3W A;  1ALA A;  2Q4C A;  1G5N A;  1AEI A;  1YII A;  1M9I A;  1HVG A;  2XO2 A;  2ZOC A;  2RAN A;  1MCX A;  2XO3 A; 
#chains in the Genus database with same CATH topology
 3BRX A;  2HSN A;  4C7P A;  4FHR B;  3SWV A;  1R8M E;  4D7Q A;  1AOW A;  2H0K A;  3HJL A;  3L8N A;  1BC3 A;  2HYU A;  1AVR A;  1YGM A;  3SOH B;  1W45 A;  1PBV A;  1R8S E;  1AVH A;  1HAK A;  4C0A A;  1N41 A;  4Z21 A;  1W3W A;  3ABQ A;  1AEI A;  4OIY A;  2VXG A;  1R8Q E;  1MCX A;  4JXH A;  1AII A;  1HVD A;  1HM6 A;  4MDV A;  4Q2S A;  2H0M A;  2IIC A;  3ABO A;  1BC1 A;  3TW5 A;  3AO0 A;  1N00 A;  1ANX A;  2II2 A;  1XJL A;  2R09 A;  1A8A A;  2K6X A;  4JK1 X;  4KMU X;  1BCZ A;  1R4A E;  1C1K A;  1G5N A;  1LKV X;  4L5M A;  4JMO A;  4KN4 X;  1XSZ A;  3USW A;  2XO2 A;  1N44 A;  2ZHJ A;  1AVC A;  1BO9 A;  1A8B A;  1HVE A;  1BC9 A;  2H0L A;  1Q8D A;  2IE7 A;  2ZHI A;  1DM5 A;  1YCN A;  2QEZ A;  1DK5 A;  3ABS A;  1AXN A;  3ANY A;  1SAV A;  4D7R A;  4EVF A;  1BCW A;  1I4A A;  1YJ0 A;  1BC0 A;  1UPT B;  1ANW A;  1RE0 B;  1W7B A;  1S9D E;  3USY A;  3LTL A;  1ALA A;  1YII A;  4JWL A;  1M9I A;  1XT0 B;  2R0D A;  4HRE A;  2ZOC A;  2XO3 A;  4JMI A;  1QC7 A;  1N42 A;  1ANN A;  2HYW A;  2IE6 A;  2HYV A;  4EVH A;  1KU1 A;  4MDU A;  4X9P A;  3AJC A;  1HVF A;  3ABR A;  4A4P A;  4FQ0 C;  1BCY A;  2Q4C A;  2OY9 A;  1HVG A;  2RAN A;  4KN7 X; 
#chains in the Genus database with same CATH homology
 1AII A;  3BRX A;  1N44 A;  2ZHJ A;  1AVC A;  1HVD A;  1A8B A;  1HM6 A;  4MDV A;  1HVE A;  1BO9 A;  2H0M A;  2IIC A;  1BC1 A;  1N42 A;  1ANN A;  1AOW A;  2H0L A;  2HYW A;  2IE7 A;  2ZHI A;  1N00 A;  2IE6 A;  2H0K A;  1DM5 A;  1BC3 A;  2HYV A;  2HYU A;  1YCN A;  4EVH A;  1ANX A;  1AVR A;  1DK5 A;  1XJL A;  2II2 A;  1A8A A;  1AXN A;  1W45 A;  1SAV A;  4MDU A;  4X9P A;  4HRE A;  4EVF A;  1BCW A;  1HVF A;  1BCZ A;  1I4A A;  1AVH A;  1HAK A;  1YJ0 A;  1BC0 A;  1N41 A;  1ANW A;  1W7B A;  1BCY A;  1W3W A;  1ALA A;  2Q4C A;  1G5N A;  1AEI A;  1YII A;  1M9I A;  1HVG A;  2XO2 A;  2ZOC A;  2RAN A;  1MCX A;  2XO3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...