1HX7A

Solution structure of the catalytic domain of gamma delta resolvase
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
105
structure length
105
Chain Sequence
MRLFGYARVSTSQQSLDIQVRALKDAGVKANRIFTDKASGSSSDRKGLDLLRMKVEEGDVILVKKLDRLGRDTADMIQLIKEFDAQGVSIRFIDDGISTDGEMGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the catalytic domain of gammadelta resolvase. Implications for the mechanism of catalysis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Dna binding protein
molecule keywords TRANSPOSON GAMMA-DELTA RESOLVASE
total genus 20
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2001-01-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1390 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1hx7A00
5C34B 3LHFA 1GDTA 3UJ3X 5C35A 1ZR2A 3PKZA 2RSLA 3LHKA 2R0QC 2GM5A 3ILXA 1ZR4A 4BQQA 5C31A 3GUVA 2GM4A 3BVPA 2MHCA 3G13A 1HX7A 1GHTA 5C32A
chains in the Genus database with same CATH superfamily
1H1LA 1IBCA 4KE9A 4WGFA 3DE5X 4MUGA 4MR8B 3G23A 3LVFO 1WUYA 5ALWA 1G5HA 2JLXA 3DBRA 4PLFA 3O2JA 3JQFC 1O97D 3GFFA 4LC1A 5F35A 3TB6A 4D99A 3H3FA 1Q57A 3S55A 3LHKA 1ZQ9A 4IDBA 4EA8A 3DLBA 4ONEA 4R2XA 4MS4B 2KWIA 3TEJA 3MK31 1K2WA 5J59A 1E6KA 3ZGYA 4BCCA 5JBNA 3QE0A 1V1MA 4F5EA 2VYVA 4D4IA 4V24A 4BV3A 2FRDC 4AF6A 2IKQA 4R7ZA 2FV8A 2X9NA 3ITEA 2OXIA 5KHOC 1QHGA 1M1UA 3IJEB 3TCKA 4KMSA 1XKXA 4K9LA 4UBIA 2LD4A 2AW3A 3KKEA 2Q9AA 4EW1A 1DEHA 1F2TA 3MWFA 2BGLA 2A1IA 4B7CA 3PKIA 3TZBA 3KXLA 4X8LA 4N0DA 2NSHA 5IVDA 3Q11A 2BE9A 5TF4A 1TKAA 4ASUA 1VL1A 4EAQA 4J6FA 2DPYA 2WI8A 2ORWA 3IRUA 2B4TO 4M37A 4R8VA 4OB8A 4ER6A 3U4IA 2XMDA 2ZBGA 1LW7A 3KS9A 2PUJA 4OHWA 1EZZA 1PZXA 4MKZA 1T0UA 2QRMA 4UFPA 1K3UB 3O3CA 2HQBA 3NEAA 3K5IA 1Y8QB 4JJGA 5A7GA 2CT8A 2X0DA 3WZLA 1PWEA 3AG5A 2DLNA 1IC6A 4KTVE 5F12A 4EMBA 4YRMA 1WCWA 3FHJA 3KAPA 4MUBA 1C8BA 3GROA 2JFHA 4FEAA 4Q6BA 5TMDA 2XUDA 4I4NA 4PYNA 4V03A 1TAGA 2YH2A 4MI6A 1RACA 1X2EA 3PHLA 3I01M 5EZ5A 2C4HA 4Q19A 3D6VA 3QQPA 4X64B 5LR6A 3JWJA 1FYEA 3ES9A 4I8XA 1RLIA 3LL7A 4EJSA 1EGQA 5KC9A 2GT1A 3CYFA 1H22A 4NNOA 3ZIUA 1N2CA 3WGYA 2ZJ3A 4NENB 1YZFA 4JB2A 4Z4HA 4MUFA 2G71A 4QOIA 1J0BA 3WRWA 3DKRA 1SB8A 4YUXA 1WSWA 4G0OA 2BZ0A 3OM0A 3VHRA 3QJGA 1H4VB 1ZK2A 3RJTA 4QFDA 2PO5A 5AVYA 5CPFA 3F3MA 4O2BB 1EXVA 1YMQA 1CS4C 1JSLA 5FTWA 5MFZA 1Y5RA 2JBWA 1XNHA 3LECA 5LXTB 3C6ZA 1E1YA 1SIBE 1L2TA 1NBIA 1UMDB 2X9QA 4TUYA 4WXHA 5CVJA 3RFFA 1JIQA 2IS4A 1X1EA 1EDEA 1RR6A 3A3KA 1U4OA 3EA4A 2HHCA 3W8FA 4F21A 2ODTX 2YFKA 4TWIA 1YJCA 5JNUA 4EO7A 3CUVA 3R9XB 1XJCA 3PWSA 4JL6A 1L5SA 2JG3A 1NULA 4AK9A 2O1XA 1D8AA 4OTZA 2W98A 3ETGA 1MX3A 3IEUA 2BFEB 2GM9A 4NR0A 1JHPA 3HXOA 4NP6A 3N5KA 5BUQA 5LQKA 1RZRD 2C5SA 1E3EA 3KSUA 2VJMB 5I7UA 2VT3A 1G5IA 2D5BA 2X3UA 1SBTA 1YB7A 1Z5WA 4RD4A 5JVDB 5K2OA 2GF9A 3KXIA 2WOOA 5ARCA 4DCSA 4EHKA 1RWBA 1J8DA 1KORA 2ZVDA 2NMVA 1YQ9A 2R6DA 4MCIA 1WS6A 4Q3BA 3TIGA 1N34B 2YICA 4FOOA 4JUAA 1KEKA 2UUAB 2JGDA 2OR3A 4CKCA 1C1YA 3CVWA 1DEOA 4QVGA 2QRUA 1V1RB 3BHIA 1AZSC 3AR9A 3LQFA 4RIEA 3TSOA 1PL6A 2C1EA 5KTOA 1XZIA 2Z95A 3LK6A 1KJZA 3GARA 5CA1A 1GCOA 3CW2A 3WLAA 1R0KA 6LDHA 4K87A 3OURA 4C4RA 4MDHA 4TM8A 3CQ9A 4R83A 4ZI7B 2H07A 5K8LA 1T2EA 4W1RA 1XJ0A 3W9UA 3BGSA 1HDOA 2P40A 4JJFA 1JSCA 1R6TA 2GAIA 4JVLA 1WM1A 3TJRA 3ED5A 4HEQA 3DT9A 2VDPB 3PHCA 2R6R1 1QYWA 2VOEA 2BCJQ 1N8NA 1I51A 2W2XA 3KCNA 3KL4A 4M22A 1P72A 3BMCB 4NESA 4M54A 2AEJA 3VU1A 4C7XA 4F93B 1VSBA 5JDIC 5C46F 2RI1A 2ACWA 4EFDA 3WI7A 4O8ZA 2OD9A 3NRCA 3TXYA 4EG8A 4TT3A 5CLHA 4KUGA 1PVOA 1A2BA 4ND5A 1MVOA 2AG1A 3ZZMA 2XUPA 3JQ8A 1HNXB 4KN9S 1L5QA 1RI4A 3UAWA 4DCUA 2G9QA 2VJNA 4PHHA 1L3IA 4GOKA 2MCFA 5FLEX 3IQWA 4PFQA 1IXRC 4Q9NA 1G6KA 5AHRA 3TNYA 1N2EA 2XB4A 3RRYA 1FW6A 2FMXA 3IT0A 4Z8YA 4CCYA 3CV3A 2A57A 4FKMA 3ETJA 3PEVA 1R5OA 3D7LA 3WMXA 5LYJB 5C5EA 1D1QA 1QGOA 1UBJS 4E13A 3OKFA 1L4NA 3FKSD 4PBSA 4RVSA 2P0EA 5LXTF 3RBXA 1LX7A 1SVNA 2OHFA 2QMOA 3OFNA 4YUAA 4Z4QA 4X9XA 1S2GA 1UT8A 2NUTB 3KKMA 5FWDA 4QPNA 5KJCA 4ODIA 3AH8A 4BQFA 3OKAA 5BWOA 4ZVUA 4B4VA 1NHWA 1UODA 3CLRD 2HCJB 3H1PA 2QTNA 5BVGA 4Y2PA 2O7RA 3RRJA 4ENWA 5LNK6 1NKVA 2VR1A 3K0FB 5E4FA 1XMQB 4EZEA 1J5EB 3W1VA 3C3MA 1GKYA 1JQLB 2FZLA 3COVA 2X19A 1U9IC 4LCEA 3PVSA 4C30A 1A9RA 2AFHE 4BQIA 1N2HA 4IIJB 3AKZA 5GOZA 3HKBA 1U2RA 1T8PA 3CZCA 1A97A 4TL7A 4F5YA 3NIDB 3R7FA 4PE5B 2J6HA 1D7OA 2GEBA 1JG3A 2H4HA 2A84A 1LBTA 3V4FA 3ILXA 1F12A 1YJQA 2I66A 2I3GA 2P4SA 1UMKA 3LPAA 2BM0A 2Y71A 5DP1A 4J7CA 2DM6A 3N8NA 3J7TA 1UXIA 3WZ2A 2HV9A 5ICMA 1HRKA 1NUHA 3WP0A 3RW9A 4TTQA 1VL0A 4ARBA 4ZOLB 4XRRA 4G5RA 4PS0A 1E59A 2VYQA 2DFDA 3TGWA 1T13A 1RWQA 4AP6A 1KETA 3EUFA 1YS7A 1JQAA 1E18A 4H31A 3NHMA 1E9DA 4NCJA 1UKEA 1J0DA 2ZQZA 3EGIA 3MA0A 3PC3A 2BH2A 5EIOA 1RHUA 3WGTA 4DG9A 2CHUA 4OBXA 5IHPA 3GELA 3OU2A 1PJCA 5E6UA 4DY6A 1IN4A 1GZHB 2FPMA 4M1OA 5KMGA 1J7KA 3EH1A 2O0KA 4KLNA 1G5FA 4RCYA 2Q7DA 4KYUA 4NK4A 3SIRA 1RZRA 1JEQA 3QV1A 1FYWA 4YFYA 2FPIB 3OJFA 3SSMA 1KHHA 4YJ3B 4R3WA 1AGPA 3RROA 3TBFA 3WBJA 5M7EA 2OECA 2OQ2A 1CQPA 4DJ5X 1D4AA 1E1CA 2GTIA 4DRXB 4DMCA 3IXMA 1B6SA 2EKPA 2OMEA 2OHVA 1CDEA 5DHFA 3HRHA 4BNWA 1N1DA 3W8EA 3WJ1A 1Y3DE 3H84A 1QYIA 2ERCA 5B58T 3X1DA 4N65A 1JMVA 3J81A 3GJZA 4Q82A 3I92A 2W6ID 3EBLA 4FS8A 3I6BA 1E5TA 2XUAA 1BDJA 3UT5A 2FX3A 3FVQA 4EO4A 4HNQA 5IZCA 1O0CA 2DR0A 4L1KA 2V6FA 4B3TB 3KFLA 1T0IA 2Z9CA 3T1HB 2QVLA 1KI6B 2WD7A 1R6VA 1YB5A 2XMSA 3R2JA 3AUYA 3LSYA 3TM5A 4BMOB 4XFDA 5CCDA 2BMJA 2ECFA 2EJWA 3CXRA 4LWZA 3QHAA 3I2GA 3FPGA 2F62A 1JDJA 3HJAA 3IOBA 4ZMBA 2I80A 1FVOA 1QG2A 4C7VA 3BWCA 2QLBA 2H52A 4LNAA 1ETHA 4AL4A 1Z4NA 4HFNA 3JAMA 2AIRA 3NMUF 2HLHA 3LIPA 3WLFA 2ATIA 3LYUA 5CNMA 2PA0A 1FLNA 1XRRA 3TTUA 4FFRA 4RDIA 3KYCB 1LI5A 2UZ1B 4EAAA 1WPXA 3JTEA 2OWEA 2M6KA 3W5IA 2JAHA 3DM5A 1HI9A 1ZM7A 3U4HA 5A4DA 3VTKA 3ZDYB 3ME5A 3REQA 3KZ1E 1VG9B 1KHTA 4UVGA 4UXIA 1D6JA 3ZW8A 2OXCA 2WFAA 3G79A 1H5NA 5IUKC 1WE2A 3AR5A 1P6QA 3AT1A 4CU2A 4RQTA 3SC6A 4BNKA 2XE7A 4PN3A 1G20E 2N42A 2QAGA 1Q1GA 1YHNA 2PUBA 2ZRIA 4R6WA 2VG8A 4HDSB 1LRLA 3CEHA 1TCVA 1T0BA 3W9BA 1O96A 1PJ2A 3I83A 2FCAA 3TB4A 3ZE9A 5JAIA 1ODIA 4NYJR 1DXYA 1PNRA 3SPXA 1A9SA 2GKGA 3MOGA 5HJ5A 3QA3E 4R31A 1P4RA 1NBOA 1N2CE 2C7QA 1HV8A 4FVTA 4HHEA 4X1KB 3U0VA 5CB4F 4QPDA 3FDJA 3FFXA 1EFTA 4JL5A 4LYDA 3FWNA 4A8TA 4DDMA 3RVDA 1IFXA 1ADBA 4IX1A 1JDVA 1JECA 4PRLA 1G18A 1US8A 1QC5B 1P1RA 4YWJA 2DZDA 2I7XA 5BRAA 1WUKS 1NJ8A 3I53A 3BMNB 4IJQA 2VPZA 2W00A 2Z2JA 3QELB 3W1EA 4AY5A 1KRHA 3FPBA 3RS7A 1JZSA 5CHEA 4OI1A 1APBA 1JR4A 4Q47A 2GLTA 5E1DA 4B3HA 2HDHA 3KAQA 3GHYA 5TT0A 3UJHA 7MHTA 2QLTA 1ZMXA 4PFSA 2PGNA 4MLCA 4OL9A 2FN3A 5HUJA 5JY1A 3GUYA 5A5DA 5FO0A 2PLRA 1HYBA 3ZY2A 2O3SA 1DHTA 2H92A 4OATA 3ZH9B 3DLTA 1XMSA 3E1SA 1II8A 4CLOB 1RXWA 1H2HA 3I8XA 4YRRA 3WWPA 3HM9A 2X1LA 3GO4A 3AVWA 5C1IA 3WNCA 3A1VA 5HR5A 2A59A 4UFNA 4YRQA 1VBFA 3UM9A 4B4WA 2NVUA 1WCV1 2YWCA 3ROTA 3VOBA 2H11A 4WY5A 3ZI4A 3BQNB 1PSZA 3RUEA 3SE0A 2PQ2A 3QJ5A 5ERYA 1VDMA 4BV9A 1T1IA 3ICPA 3NH9A 5ERXA 1QTNA 1Q3HA 3AZOA 1AQJA 3B82A 5BQOA 5E6SA 3V1TC 3PBKA 3IUMA 2HO5A 2O8EB 1UKZA 2NO6A 2R8ZA 3CTPA 4M9CA 4YAKA 5IT0A 5IFLA 3WYNA 1S2IA 3EIUA 4UTZA 1I01A 4LGCA 3AVOA 3KLMX 4OMUA 4EUNA 4ZCTA 5GINE 4DZTA 1S2OA 3NORA 1CZLA 4G8DA 1EUQA 1AZTA 2TYSB 1EWQA 2P90A 2PAFA 3WQSB 2G36A 1XWFA 1M74A 3PLRA 2AXEA 2IYNA 3BFVA 2WM3A 4OX9Y 4X3CA 5IH7A 3FGPA 4HGZA 2Q1TA 3OFND 5DWQA 4RKRA 4DWOA 2EX1A 4BKOA 2C4UA 5JQGA 2FP3A 2QUKA 2Q4BA 3LZDA 1PZMA 4P84A 4LNUB 1PS8A 2NADA 3D59A 1ZN7A 3H9UA 4XD7A 4O4LA 1G5PA 1G21B 2ZSUA 4PYOA 4CEJA 4ANFA 4KHPB 3QYAA 1PNTA 3BK7A 2NV6A 3H99A 1SWVA 1WF6A 2OILA 2PXXA 3PNSA 4Y6PA 1A88A 3ZNOA 4EPYA 4ND8A 3ZQ4A 3WL4A 5BSEA 4P6VF 2C29D 4URZR 1DBWA 3OZIA 3U6BA 3C8MA 2CNWD 4QYXA 3RG2A 1E96A 3ZS8A 1E98A 4JJZA 1N6LA 3UOGA 5BYKA 3EEBA 1VG8A 5FBVB 1ZC3A 4XUDA 5MHTA 1HORA 1TD9A 1U2DA 1BXKA 2DTEA 3K72B 1CC1S 2C1XA 2H0AA 3OESA 3LZ6A 3P52A 4DIEA 3FHLA 4K1XA 5I01A 3GVCA 5KZMB 3ROPA 4CLRB 3SWWA 2WYIA 4G6ZA 2G9VA 5LCXA 3JZIA 3TOSA 4RYDA 1ZUHA 4DDUA 1BROA 3IBTA 3U3DA 3QKSA 4Q3EA 3DWIA 4G4JA 1JAIA 2IV7A 1RM4A 4NCHA 4UVHA 5C34B 1QM5A 3HN2A 5IDYA 1P61B 5DFAA 3VZBA 4CG3A 4WASA 1E3LA 1UQRA 1S1MA 4DG5A 1Z38A 3PJEA 5AM2A 4MJ7A 3IVCA 5GZ6A 1KJ8A 1TO6A 2DBVO 1ISSA 3HWRA 5WRFA 3VTFA 1ICIA 4DQKA 4R1MA 4EYSA 4R6XA 2CVHA 3FDFA 4BE9A 3S8YA 4XVHA 3P94A 2XE6A 1FU7A 1N2IA 1BCSB 1VHQA 3FYSA 3FCEA 5AW5A 3ZS9A 1BG6A 1RRGA 3VHXB 2MINB 3GMTA 2QSUA 1OZHA 2DWOA 1K86A 2ERYA 1U1FA 2FWPA 2L82A 3NBFA 3IE2A 1XWWA 3QOWA 2ZE5A 4DTIA 2J3KA 4IF4A 4IRXA 1OFGA 5CPBA 1Z9BA 2YV5A 5CR9A 3T5DA 2UZ0A 4KK4A 4PRKA 2WF9A 4Y8VA 3GDOA 4PU0A 1OWNA 4BY9E 1UBLS 3AUFA 3EUWA 1QE5A 1VMDA 1XRNA 4TL9A 1G3UA 3JRXA 2OHIA 4H1TA 2TSYB 1UFRA 4NJEA 3GIDA 3DE3X 5GJCA 3DMFA 1VFNA 5IVIA 1PRYA 3QEJA 1U5AA 4TSFD 3ZIAA 3ESZA 3F73A 4KVAA 1U0NA 2JDID 3L0DA 3WIBA 5B1YA 1I3OA 2A5LA 4D9FA 3HJGA 3EOBI 2RHWA 2G9UA 3B9BA 2B1RA 4MVJE 4B3RB 4L4UA 4WXMA 1VM6A 5D3KA 5G41A 4K6FA 4AMGA 3MT7A 4G07A 5IC6A 2I1WA 2ZAYA 3PUKA 3MBKA 1K7EB 1K7XB 3UMRA 2VXCA 4X41A 4EARA 3VVLA 2PRSA 2YC2C 3SX2A 2MIIA 2ZSKA 3HEBA 1E2PA 4ARAA 1UQTA 4XH9B 4DT1B 3B6MA 2BF7A 4ZIRA 4MVJD 5DXFA 2DR3A 2Z8XA 3ACBA 1RP7A 1Y1QA 4ED9A 3G0DA 4L9AA 1NFFA 4RJ2A 4F3TA 1YVRA 2QQ0A 1N6KA 4UU8A 1AVTA 2H4XA 2L42A 4ENTA 3GFQA 1EUDB 1E0KA 1ML3A 4PCUA 5DI3A 3KQNA 1YHYA 2JIZD 2ZJ8A 4HXGA 1GEGA 3OJ0A 3QOXA 2FU5C 4W8GA 3RFCA 4BN0A 2ZT5A 2A78A 4V02A 3REOA 4AJ2A 1Z4LA 4M0MA 3NDBB 1AHNA 1M2JA 2J6BA 2PS9A 4GP6A 2P6UA 5T41A 1WCXA 5CFQA 4L08A 5JPDA 4ZVNA 4Y7DA 5JRDS 4MR9A 3O91A 4RGQA 2NTNA 4IJKA 2LP4Y 3A27A 3LUAA 3BX1A 2B6NA 3MS7A 5K99A 1JFFB 1X6VA 5E9AA 4ZI2A 4NAUA 4RM2A 4UMEA 4WBXC 3N74A 2YY7A 4IXWA 4I4TA 5HF9A 4WY2A 3K35A 1CUEA 5D3MA 5FPQA 1ZGHA 1CETA 1LRKA 4JCOA 5JVDA 4E21A 1OY1A 1D2RA 2CB0A 3TOZA 3ZY3A 3IH5A 2AFHB 3MYRA 3KR1A 1CRLA 2JASA 4A7PA 3QPCA 3QW4B 2X23A 1N0UA 1U81A 3MT0A 2I6XA 3DAOA 4ALMA 1ZWKA 3D4LA 2B5OA 2IEGA 4BE4A 4COOA 5J3JA 4J0IA 5A3QA 2I91A 1B26A 1TVKB 3WNBA 3DUWA 3FYTA 1EBBA 1NW8A 3OHMA 5K1ZA 4NAVA 2VK2A 4ZJYA 3QPWA 2OV8A 4J1NA 4WESA 2SCUB 1EKXA 4X7BA 2V9ZA 3FSGA 1F7UA 3K9QO 1XRLA 2XH8A 1RYZA 3WWEA 4A2CA 4HI0E 3PSAA 4WNAB 1C81A 3KSZO 4HGPA 3AQ4A 3ZD9A 2IT1A 5DK6A 1JG1A 4Z5XA 2ZSIA 3LUDA 2F1RA 4FE7A 3KJQA 4U0KA 5UKDA 1YK0A 3C8HA 4CL0A 1WP9A 4HQNA 4CMEC 3LGXA 4M7WA 5D51S 2ZB4A 3OCYA 1R27A 3D7SA 3CMCO 2E4ZA 3AU9A 4H1HA 3WLJA 4AYXA 5BN4A 5DASA 1QG4A 3BUSA 3C5WP 3GJQA 3TW8A 1V7CA 3WR5A 2PEZA 2ZIWB 1GNVA 3BFJA 3FPLA 3Q6IA 3P0JA 4DV2B 3GLHB 4II3A 1IBKB 1DQPA 2OT3B 2ZS9A 2BP7A 4D8VA 2CFTA 1E99A 1SCNE 3B8HA 3G9QA 2ZGVA 2EQBA 3LO5A 1DAIA 4BB5A 4V0SA 2FF5A 2C2HA 1BS9A 2FW1A 2I4NA 3BEDA 4M0EA 4MUYA 4AMUA 1YUBA 3IP3A 1TQ2A 2AC4A 4MEJA 5FULA 3RRFA 2PR2A 3MWDA 1U0TA 3M1AA 1DFIA 4B1FA 1YZLA 3DOUA 3N39C 1X74A 4I66A 3SXJA 2XMRA 3V7YA 1Y89A 1FDWA 3AETA 3E70C 2PKRA 1XCJA 2C92A 3CZMA 1MGPA 4HRXA 2I76A 2VP5A 4KFTA 1KS2A 3QEBZ 2FYTA 1FRZA 3NV7A 3RWOA 3DYBA 1AO3A 1GPBA 3OECA 2XYRA 1I3MA 2I6QA 2XB9A 3LX8A 3S4YA 3KQKA 4FWBA 16PKA 4TLMB 4J29A 4O4IF 4US0R 1USUA 3W7VA 1HFKA 2X7XA 2IYZA 4MYSA 1XKLA 4XYMA 5B1DA 5P21A 5BY2A 4KR2A 4PYKA 2VSQA 3H1FA 4L6CA 4BTEA 1OYOA 3AR4A 5AMXA 3L1JA 4RADA 2WWRA 2WZDA 1FRNA 2PSSA 1Q0SA 4O4LF 1Y42X 2M2IA 2H1WA 1JKMA 2X77A 4EDFA 2I7TA 1GKKA 1PGJA 3GC6A 3P0EA 1QMGA 2HBZA 3WGZA 5CUQA 2J9ZB 3X44A 1NVVR 2XHEA 1SU7A 5CLLA 4CODB 1QSGA 1IAVA 3QLUA 1SCQA 3TG8A 2BSAA 2MSKA 3PVCA 4AYWA 4MVJI 3IP8A 1F38A 1ZW6A 1WZIA 5AKKA 4EGCB 3NI2A 3EQZA 4I36A 1QCZA 5A7FA 2WMNB 3FJOA 1A95A 1ZN8A 3DA8A 4MWOA 1GNLA 4UNIA 4GBED 2OBFA 5HKBA 2BGTA 3GUUA 3HTXA 2GSWA 3DVAA 4BATA 2R6GA 1ADJA 4C29A 5TX7A 1F0YA 3MMPA 5C8VA 3C87A 3H4MA 4YH1A 3DW1X 2EWWA 5T4HA 2W6OA 4PGAA 3ZWDA 1NRXA 3HEMA 4IDHA 2LNDA 3GU3A 4A6PA 4S1OA 4WN9B 2AKEA 3TPFA 3EXFB 4FSDA 1XDBA 1SHUX 3I9LA 2GM4A 3E35A 1N2SA 3OSZA 3CINA 1ZW1A 3F6BX 1JN0A 4LRXA 1QDLB 4A1OA 4PPQA 1ABEA 2QE7D 4M0PA 5B6JA 4CF7A 2R85A 3H11B 2OFPA 4UQPA 1KVTA 1DRVA 1CY8A 1E7YA 1VE3A 2NO7A 2Q1XA 3L4BA 4K6GA 4WDRA 2G1PA 1N3IA 1VMIA 2NZJA 5AI6A 4DCCA 1XYVA 4DLSA 4PY2A 5C4GB 3FBGA 4P08A 1O5IA 1GG9A 1FLAA 3QU7A 4F5DA 4TTVA 3RABA 1A96A 3MINB 3NKVA 3UFXA 5A9SB 3F67A 5EQFA 3ADCA 2A58A 2PH1A 1RBZA 1TZJA 3FR7A 4O0LA 4FYMA 4IJMA 4Y6QA 3RG8A 1N77A 2GCNA 2W6PA 3R5XA 3RASA 2O8FB 2W70A 2RHRA 4LHWA 5AHXA 4AW9A 4BCBA 3D9QX 1XTTA 3R7BA 2J3EA 5EIBD 4TM7A 1X7XA 4QYIA 1LBSA 2QMQA 2D00A 3V8PA 1UBFA 4ZCMA 2F8TA 4MK4A 1UFKA 3OJEA 2LR0A 4BFXA 3WQRA 3F8TA 4EGQA 4RKWA 2QBYA 4EUFA 2Q2OA 5IX8A 1E2LA 1U11A 3FF4A 4HMOA 1VCHA 5IBCA 2PH7A 1M33A 2WSSA 3KDAA 4QXMA 4Y6OA 3BXFA 3SJAA 3OIUA 3V2IA 2VP3A 2AOVA 2NSJA 4KGDA 1ISFA 2NG1A 3ID6C 1DQSA 3W5VA 1XLTA 4L3OA 5AVKA 3WKBA 4EJ6A 1HOXA 1Y8CA 2W2MA 4ZT3A 2O2CA 2B7BA 1S8NA 4DFDA 2Y4OA 3TUZC 3DGEC 3PE3A 4G8JA 1Y9DA 2AK3A 3QYJA 4DT1A 1F6WA 1T9BA 1RXVA 4B5LA 3HMKA 1H8HA 1ZUNB 1GU7A 3VYVA 4F0JA 5J47A 3MFQA 4J9VA 1N92A 3N2ZB 3PGKA 4TVKA 4PEVA 1T3TA 2QYSA 3O3OB 4TPKA 2ZAGA 1EK5A 3Q7TA 5K3AA 2IV2X 4IHJA 3EGDB 4TMFA 2DH6A 1V1JA 3B5EA 3Q8WA 5YASA 3ZZ1A 3LWNA 3NHRA 4MR8A 4NBKA 3NNSA 4LGYA 3L40A 5DVZA 4BO1A 5HRCA 4HNSA 1RM0A 4K9OA 2JFVA 2XNSA 5CX4A 4D3XA 2QK4A 3OE7D 4FSHA 5PNTA 4GPIB 3G8DA 1S2MA 3H2IA 1ADYA 2Q3BA 2MR6A 4QUDA 5J40A 4RV5A 5JOQA 2JJYA 1MLDA 4KMRA 5LLDA 1FLVA 2HLNA 4H0FA 1C7RA 2NQ8A 3H7IA 3LDAA 5DSXA 1RD4A 3LWBA 2OA0A 3TFQA 1KYZA 3FF1A 3HUFA 4DE5A 1TJ3A 4E12A 3KPWA 4ETWA 1VJ1A 2ZB7A 4JVNA 3L6OO 4PAWA 2CYAA 4NYIQ 4XA8A 4QVIA 1UFVA 1BYUA 2W2QA 2A7QA 2C78A 1NJ2A 2JFPA 2RIPA 3PGJA 3FM9A 2AEMA 1TT5B 2RB5A 2E4UA 2MMCA 3TIXB 1RW4A 1K88A 3FNHA 3OQ6A 3N5CA 1XTRA 3WL3A 1RLJA 3MBIA 2PKCA 3AJRA 3QBJA 5AW6A 2JLZA 3H9EO 3PEFA 1WL8A 4QDUA 1MCZA 2YMMA 5EP3A 3TSYA 1XWIA 1O0BA 1PD0A 3GT4A 5DHTA 3RIHA 3ND8A 5BV2P 3E4DA 3ZLBA 2PSHA 1RI1A 1Y5NA 3NBXX 4FGUA 1TCCA 1D4FA 3VAAA 4QUHA 3IT1A 3WIEA 1AK1A 4Y6LA 3T0FA 3P1JA 4P5EA 2HBYA 1G8JA 1LGYA 1FUYB 1P5ZB 2ECPA 3B7GA 2E3JA 3EF1A 5EIHA 1I5RA 3FIUA 4CMIB 4Q16A 4OSOA 4EELA 5AVWA 5G02A 5K8VA 4W5QA 3WGQA 1ECCA 3NBAA 4FHCA 4MJ3A 2FPGA 3EPPA 3LOPA 3QKUA 1DDOA 2I62A 1NURA 4FE3A 1NNUA 1T5BA 2HJRA 3AM5A 4BE7B 4UFOA 3WHIA 4A6XA 3UMGA 1RVV1 3KKPA 1PO7A 1RYHA 3LT5A 1WXQA 3TQFA 3T7IA 2QE7A 3EEYA 4L9WA 5JUWA 4RH0A 1AIPA 1OWLA 4CGZA 4LOHA 1BAPA 5DBIA 4B80A 1L8LA 1JNXX 3HWWA 4YMSA 3ZDBA 1D2EA 2UYQA 3TBKA 1SH7A 2Y6UA 3ZE0B 5KTKA 4HB3A 2YRWA 4IDQA 1X3SA 4ALNA 1P0PA 3KAJA 3IAUA 1ISPA 1H2XA 1EB8A 1XROA 2WP8J 4GW3A 3K9WA 4M2LA 4MW7A 1LD3A 1G7SA 2IHUA 3UIEA 2QAGC 2GESA 4MAMA 2I8AA 4FJ1A 4CHGA 1OROA 4Q4AB 1MG5A 2IXFA 3FOFC 4B8WA 1WDTA 4R0MA 5K0NA 3HDYA 4IXDA 3M1LA 4PS1A 3HVHA 4ZGGA 4C06A 4QEKA 3VI3B 3WRYA 3NEYA 1HTWA 3IX7A 2FPOA 4QL3A 3TINA 3KE8A 2C82A 3TF5A 5KQRA 3OF2A 2ZULA 1LK0A 4CEJB 2GZ3A 2VWPA 2JLVA 1EIZA 1WOMA 1FQKA 3RSFA 1J2EA 2DRIA 2BGNA 3UHAA 3ZXYA 1YDEA 2DKOA 3JYQA 4IZOA 1Z28A 1ZHHA 1LA2A 1ZM4A 3C0KA 4DTCA 2GYVA 4FGSA 3IDQA 3PCTA 2VDJA 2Y77A 5K3OA 2CVFA 1Q7RA 2H16A 1Z13A 2IIPA 3IIEA 4Z7JA 3S2YA 1DV1A 1JR2A 1RPTA 4MRSA 5DEOA 3WE7A 4KJXA 1OZAA 4BFUA 5LUAA 1TO2E 1O54A 1UXOA 2ZIZA 1KRXA 1Q6ZA 2ZAIA 5CIWA 1JLLA 2BGMA 1RYYA 4WZAE 3ND5A 1N33B 4CF3A 1KIAA 1A5SB 1JPVA 1D6MA 3K5HA 5EKUA 3FYUB 2XBMA 1P4SA 1U9CA 2Z43A 3FWZA 1QR2A 4B71A 4RQAA 3SHWA 1W47A 3QU9A 2V7EA 1FVFA 4QBGB 1C7IA 1DAPA 4N0MA 1EUYA 4TRNA 1SVSA 3EK2A 5BNZA 1IDOA 2QHXA 5JDCA 5B6IA 3LQRA 4O4JF 1GTSA 2F90A 3CF6R 4YV1A 4BO4A 1NKSA 1PW7A 2FEKA 1ISJA 3SQWA 4EJSC 4GDFA 2Z6UA 1IY9A 2B9EA 3WLTA 2IPMA 5K6AA 4CHTA 5E2IA 3JZDA 3AIMA 4FFLA 1XP8A 1ZR4A 3O82A 2EDCA 2ZSFA 1YFLA 2ZAOA 3HR4A 3K5PA 1GVNB 2A5YB 3NDIA 1XSEA 2XXJA 1SC9A 4JQZA 2C84A 4L51A 1G6HA 4LGMA 3Q9LA 1KI3A 2IUUA 2W2PA 2CZQA 2GZRA 1IPEA 2J5KA 2QUHA 3JQAB 4S1WA 5JYCA 2R7LA 2VWGA 3CB2A 5HEKA 1RCTE 1RWNA 1RWXA 2F1JA 3LUHA 3DF7A 1IN5A 1JKFA 4A92A 1BHJA 1RRKA 3HDHA 4GMXA 1E6UA 4QUIA 5K3BA 4BLOA 5C53B 5FXMA 1E2HA 3WLMA 1Z26A 3O83A 2WB2A 1E92A 4H6PA 3T3DA 1UOQA 2IUSA 2ZRQA 1OX4A 3MUFA 4XW2A 1ODJA 1SQ6A 3N2GA 3JQ9A 1AGRA 2P3QA 5KQMA 2CNLA 2QM7A 3OBIA 2YQZA 3Q8LA 2DPHA 3FB1A 5F77A 4LOIA 3T9CA 1GQ2A 2VWQA 2WVAA 3A0UA 4ZCLA 4P81A 3LUGA 2XWPA 4J0DA 3O1IC 4DCMA 1O94D 5AXCA 4XIJA 4F84A 4KWEA 2VTBA 1MH1A 4L6AA 4BMPB 1PJRA 2YIMA 4ZVRA 2OAGA 1DAFA 5PGMA 5AK5A 3HPQA 3OX2A 2V8OA 3UMBA 2IZ1A 3DFKA 4UBLA 4YP1A 1OKKA 5KNLA 3RSGA 3THYB 4C22A 2PBLA 1XL0A 4XJXA 2GTPA 1LTHR 1KO4A 2HGZA 2WWFA 4K81B 4Q9JA 5A2GA 2DP4E 3PEUA 1GCGA 1IB0A 4BKQA 3IPAA 2Q5JA 2Z3ZA 3R0IA 3T3GA 4J0KA 2XJ4A 3TAHA 4MRNA 3MELA 1O5OA 2DJ5A 3L07A 1TF5A 4HTFB 2YC4C 4LDPA 4QQKA 3N86A 4RZIA 2JZCA 4F7WA 1OXTA 5L3QB 1YRYE 1AS0A 2VP6A 2X4LA 1DVRA 3H2ZA 2O1WA 3DCJA 1SY7A 3HJHA 4G5FA 4GNKA 3WWOA 1EVYA 2QRLA 2P8SA 1LBIA 3PDIA 3BWDD 4LXTA 3RAGA 4IILA 4X1IA 3VH2A 5DGIA 1VB3A 2JH8A 5H59A 3JYPA 4HRYA 3OIWA 3VPSA 4JKIA 3MILA 2O50A 2BEVA 4MR9B 3R41A 1I1NA 1OTYA 4DEYA 3GLIE 1OHHD 2CLCX 1OI2A 3NAMA 3EVTA 5DXAA 1ZM3A 3T3IA 1C4KA 1TJNA 1EEXB 2F43A 4QAJA 4A2QA 5KJ1A 3JQBC 4UPVA 5AXAA 5TEWA 5JSQA 3E6AA 2XUZA 4EJ2A 5IVPA 4WBSA 3TK1A 3ZHQA 2EF0A 1TF7A 1WDLA 3C6BA 4WCVA 5AK3A 5IXYA 1Y7HA 5I4CA 5TS2A 2X4GA 5GV7A 3GP3A 2QENA 3D0KA 3W7AA 3BXEA 2ZRBA 4RF2A 3I34X 1LSUA 5CYPA 3G9UA 1A4UA 3RIYA 1A69A 1MB4A 1RWKA 3QG1A 1LSSA 2ZJ4A 1TIPA 2XVXA 2FAXA 5KVVA 3L49A 4R2MA 1XFAA 3L0PA 4QPJC 3LBFA 3KXPA 1RAFA 4XGRA 4D26A 1MAVA 2AMVA 3O1LA 3PC6A 4F4IA 1JFLA 1YS9A 1G4AE 1NJ5A 2YBDA 3GVXA 2R1VA 2BSXA 4PZ9A 4OUDB 1HDZA 1Q7BA 1Y80A 4X24A 5J2UB 5L9AA 4ZJUA 2JKVA 2H1CA 3WYCA 4OOFA 1PLKA 1DWQA 4N76A 2RJOA 3CEMA 1Q0PA 5C3MA 3I2IA 2LKDA 4TWAA 3ZU5A 3DBHA 1YZHA 1N9KA 1AKYA 5EPEA 1RP1A 3PDWA 4JS0A 3W2EA 3JQFA 2Q1SA 3KB6A 3IAM6 1E94E 2V5UA 3IBFA 6Q21A 1W0KA 1Z06A 1ZD2P 2VDQB 4DBLC 5ADVA 3FAZA 5CCBA 3R3SA 4FYYA 2P69A 2ROQA 3JYLA 4IH9A 3QKWA 4JSYA 3RVMA 3BGOS 4B3MB 4U7PB 3CLHA 4ZCSA 4V1CA 3V2UA 4ZHQB 3LUJA 3PUVA 1MHTA 4M9SA 2HLDD 2JD2A 3D3NA 4JYMA 1BMFD 3WNQA 5K8IA 3WWYA 3UB3A 2EKDA 3RIGA 4DUPA 1Q11A 3TLKA 4WKBA 3ZZUA 2AJTA 3MPUA 1NSFA 3HU5A 1CRPA 1UBGA 3RS4A 3VRHA 1C1XB 3HCRA 4XARA 5ADUS 3B20A 1G20A 5CDUA 2D5IA 1WMSA 3P9ZA 1OR8A 2QG6A 2FQYA 2VQ3A 4IMPA 2PSFA 4QKQA 3CHYA 4XX1A 1EIWA 3ORFA 2WSIA 1NN1A 3OOEA 5HM8A 5MF6A 3C5CA 1WBJB 3W77A 1AV7A 4LCBA 3HLKA 4R40A 3IMKA 4MA4A 1F2TB 3FJ1A 1NX6A 5AIAA 2WMYA 1Z6YA 4YV7A 3SZUA 3VYWA 3FMPB 2OBXA 4K9MA 2PRYA 3D3WA 3V6MA 3D8NA 1SXJE 1RHQA 4I08A 1NLMA 1G38A 4JBYA 5FUQA 1KZ1A 3BRSA 4BTLA 4BLWA 3OIVA 3BBPA 4EI9A 1SBIA 4F2DA 3SJUA 3JQ9C 2VPWA 1VC2A 3KSBC 4RW0A 3U4CA 5GJBA 2JFGA 1AKTA 1O87A 3NANA 3MM4A 3OJWA 1YCHA 1GFZA 3O8OA 4M9QA 4PXYA 4WVFA 5FT9A 1LPOA 4PQEA 2VAWA 3SJCA 2XMBA 1PQUA 2H1HA 4RZHA 1ST2A 2EEZA 4GLFA 2B92A 1WUHS 2FZGA 1HA3A 4HAUA 2O1SA 1JL3A 2QRNA 2YYYA 4ZREA 5GY7A 3RYCA 3PUWA 4LYAA 2AFIB 1A0OA 1ZHFA 3I04A 4HFMA 2A9FA 4Q3OA 1X86B 1MBZA 4P7FA 2J3DA 2GVDC 4UHJA 1CHNA 5DTQA 5BORA 3BHMA 3UXHA 4KRFA 1XCOA 4NKRA 4J1QA 2PPLA 3AUKA 5JXGA 2C3OA 3ZWYA 3T1OA 4IX9A 3DWEX 1JILA 4AJ9A 3OQOA 2AH5A 3AJ9A 4GI5A 4TZ6A 1NRWA 2B8EA 1PN3A 3I58A 3X2FA 3GUZA 3T99A 3UCXA 3OJXA 2IEBA 2XYPA 1GHTA 1VP3A 5FBLB 3H1BA 4YCSA 1T3GA 4X91A 5IT5A 2IA5A 2RONA 2SKEA 3D8BA 3IUNA 3LUBA 1M6NA 4XLTA 3WDMA 4OQEA 2HFJA 3E9NA 3RJ5A 5KVCA 2GMWA 1IB6A 4KPYA 4J7XA 4MVJP 2Z98A 5HZHA 1SOMA 1NFQA 2YMLA 4YCLA 2B98A 2Z1DA 3PWZA 5B4VA 4QFCA 2RH5A 2Q46A 4D4GA 5A0VA 4IXTA 3KFXA 3PIIA 5HIIA 2EZTA 3OQMA 2YKGA 1SVUA 2JI9A 2FWJA 2QVZX 3OZFA 4NULA 4URYR 2CF6A 2CGEA 3DMGA 4GYYA 4JP5A 5CB0A 2FDXA 4B6RA 3W5SA 2VDOB 1W85A 1WKBA 5LQUA 2FPPB 5C0OE 1EK0A 3CLUD 2QV7A 3LY5A 2ZJ0A 4OXQA 3KIPA 1VDZA 5BQ5A 4AJLA 1GPNA 5IT9A 1YDHA 4J2HA 3VYSB 3F7OA 4GO1A 1JDTA 5B3LA 4LA4A 1VA4A 1N1GA 2B25A 2CXXA 2O23A 2VAMA 1HSOA 3PC7A 1WUTA 2I7DA 5H3CA 1KQNA 4ENSA 4UDNA 2GGSA 3MQ4A 5AI9A 2YCBA 1XF1A 3TMAA 4AY6A 3C7KA 4EY8A 1ZGZA 4A8JA 5DHRA 1PEKE 3KZXA 3BQMB 2H5IA 3R3YA 4Y2VA 3VXKA 4QG3A 4ZC8A 4DYVA 2NQTA 4A3SA 4HS9A 1DQZA 4BNMA 5CEEA 3IBCA 3NNDA 2RGUA 4B48A 1HT3A 3IVAA 5EQJB 4U7WA 3OPXA 3B6ZA 1G8KA 5K3EA 2GN4A 4TYYA 1ZIDA 3AHFA 2GK4A 4NFLA 3MQFA 3V42A 4E08A 2P1ZA 4ZVOA 3H0KA 4HLUA 4LKRA 4Q4JA 5A4FS 2IIVA 2XV1A 1KVQA 5TQJA 3JYNA 1YDWA 1SBQA 3GDGA 3AFOA 5DP2A 2Z8ZA 1UBEA 1VJ5A 4Q9IA 2QTAA 4TRJA 3JQGB 3FCUB 1C29B 4OBEA 1BCRB 1I4EB 1SVWA 1T4CA 1BQ3A 5J9FA 3ABOB 1JVSA 1UK9A 1ZJ6A 4OQ4A 1DJPA 3V9PA 4EY5A 2FFQA 1UDXA 4WXEA 5C8YA 3G0HA 4PQGA 3TVTA 1EX7A 1C1DB 3S29A 1NMQA 2V0CA 5KVAA 4J6EA 1IHXA 4GR9A 1C9YA 4KN8A 4OP1A 1B6TA 1KK1A 5B3AA 4NF2A 2CNNA 2WFLB 2XUFA 3WIVA 4BLUA 2BBSA 2QTGA 3PQ2A 1MX5A 2PZFA 4G3XA 2F3PA 1WV1A 1JJAA 2I2BA 4N54A 2JCGA 3OQBA 3OBBA 3IP1A 4KAFA 3W6OA 4EB0A 5ADHA 1C7EA 5J4KA 4OYLA 3CX3A 4UC0A 3T7CA 1ISRA 1GU1A 3QPAA 1N6HA 3T95A 3WA7A 4CMJA 3FMGA 1YCDA 3GFOA 2PXCA 2ZRHA 2Q5LA 3ZCPA 1J09A 2XVYA 2VZEA 3GAFA 4M6WB 4J75A 1QRDA 5FH9A 1QJ4A 2CDCA 4MDYA 5LPNA 2C7GA 2PRKA 3PA6A 4NARA 4QIHA 1JKIA 2DEUA 3L7MA 4B2YA 5AR1A 1BJKA 1XQ9A 3DP9A 3NG1A 1O3YA 3TFWA 1W7AA 3SC4A 4YAIA 5KBYA 5D3QA 3LGAA 3MLBA 1DBPA 3F1LA 2PX0A 4DVGA 2JLSA 2DSTA 1XGKA 2H1LA 1XPUA 2XIQA 2QLFA 3GP8A 1FBTA 4X8MA 1USGA 4RTKA 4DB2A 5AVZA 2DH5A 1EM8B 2QTBA 5SY6A 3B5IA 4YALA 1Z07A 1M34A 1NU6A 1UUFA 1UWKA 3L4EA 2O2GA 3U4AA 1LPNA 3T7EA 3JPWA 4JI0B 1P45A 2J31A 2VJMA 3TTWA 3LA6A 2XKKA 2FH5B 3EPHA 3IKTA 4KXVA 2FKNA 2I4RA 3E4CA 3K70C 1Y33E 1GA4A 5ED0A 2HRZA 2BFWA 1F0PA 1XPOA 1XRMA 1QO0A 2AMJA 2BAGA 2O05A 3WQHA 4AY2A 3PD7A 4W63A 2P79A 1KL7A 3W4JA 1NQWA 1OBCA 1PBNA 4DV7B 3QFCA 3A37A 3FGNA 5LFAA 5T3YA 2J6IA 4N5MA 3TL3A 2Y0EA 5BPHA 3O6VA 1X80B 5TPZD 2YZ2A 4NE7A 2J3QA 4G36A 4DV5B 4ZTZB 3RSQA 1H2AS 2FDRA 3BIXA 5TQ0A 2R62A 2GVNA 5B30A 3BF8A 1CJTC 3AL3A 3VJMA 5C8ZA 1Z0FA 1W73A 1ZLYA 4UQLA 3TFOA 2IY8A 2XQGA 3KWMA 3GFGA 1G19A 3OIGA 4DMLA 3W2IA 2RSLA 1VZ3A 3VR3D 3IMEA 1BKSB 1H65A 2WD8A 1QORA 3QFFA 4KOAA 2FG5A 3ND9A 4M49A 4MS3A 5DBHX 4OA8A 1Q19A 4I1IA 1S0UA 2HL6A 1DB3A 1TK9A 1QYCA 3RU7A 3HBAA 3WDKA 2A1TS 4JHLA 4DNPA 4Z6KA 1R0RE 1CQZA 2J09A 5JAQA 2X6TA 1OBHA 1IHYA 1KFBB 5AHOA 2X8LA 5EL0A 1S2LA 1U0HC 4ZEVA 3CW9A 3SC3A 3T7DA 4DBZA 2CSXA 1KOFA 2HNAA 2GF2A 2IYVA 1WP4A 3PFIA 3SEZA 1P2FA 2W71A 3I73A 3CVJA 3L6RA 3NR2A 3OQ1A 1DL5A 2CMFA 3EZLA 3F6EX 3O84A 3Q98A 3NVAA 2ZCJA 1IZ8A 2QDXA 3DL4A 5LNK1 2QN8A 4OI4A 5L3SB 1JZTA 3B9QA 3IEXA 5DW3A 1KC1A 1U4NA 3TSZA 1MDBA 4I99A 2KLHA 1J21A 3FJYA 4I1SA 4S35A 2GJ4A 1ZD4A 3MRSA 1B8PA 1PTKA 2V9CA 4ZOEA 2WU4A 3EGEA 5CBPA 2CHGA 2VK4A 1OFIA 3KVVA 4M1SA 4RDCA 4D56A 3W6ZA 2AZXA 5L51A 3KT6A 3AESB 3P9YA 2W9XA 4KO2S 2NUBA 4ND6A 3RREA 1M1YA 1CDDA 4LDZA 3WJ2A 4EFNA 1EGMB 4CN8A 2PWBA 3DOFA 5CP8A 2Y0PA 3HL4A 1U5BB 2C2OA 1E3JA 5D84A 3KJIA 3DOEA 3WYFA 3U7HB 3I2KA 4D02A 4DIDA 1FJ2A 4H27A 1QH8A 1PJBA 2V9PA 2VP4A 5CB8A 2JB9A 2V3WA 4PC6A 4AKGA 2VPPA 1JIUA 2ZRKA 1AGNA 1GAEO 4Y2YA 5D1HA 1YVPA 4MQEA 4LY6A 2FMKA 4NFSA 3U44B 4XFJA 5FQOA 4L0DA 1MNQA 2W2VA 4DWJA 2FFJA 2JFWA 4GVLA 3CZRA 3DPUA 4EYQA 4IKOA 1VYUA 3GLHA 3QV2A 4OQZA 4Z99A 1TXGA 5FBQB 5FJIA 5H9WA 5BN3A 3DBLB 2CDBA 2PO7A 4JT9A 4Q93A 1Z4IA 1P33A 4QUKA 2EC5A 3RKSA 3EDRA 1G59A 1EA7A 1QJCA 1GG2A 2D2XA 5J1TB 3BE6A 3ZZNA 1WZUA 2JHFA 1U1DA 3PUYA 1TYAE 5JCPA 4ESOA 4WRRA 5BO5A 2PMFA 3V1KA 5JC1A 3CH4B 2D7DA 1Q7CA 3BJIC 1U6JA 4QJ5A 2YDXA 5IARA 5F5LA 1RHRA 1GNSA 1YU9A 2H4ZA 2RHCA 3I6IA 3OIYA 4L3WA 4P7GA 5DU2A 4B6SA 1L5HA 3VHLB 1PG5A 1YDGA 3D6MA 1OXKB 4NRDA 2AVDA 1G8SA 1IHPA 1TKBA 2FJ0A 3WP1B 1HNZB 4GZLA 4WADA 1KGSA 3CXUA 3AINA 2OO3A 2R8BA 2XZTA 1Z63A 1CR1A 3IBSA 3OG9A 3BD9A 4M7RA 2WTBA 1E3SA 1GZUA 1H2WA 2W6NA 3L8DA 1PJLA 1S3GA 4TMKA 5EWLB 3D1VA 4DW8A 3K16A 3WGJA 4G01B 4KQEA 3ZGVA 3GCDA 1GPAA 1VKZA 1B6RA 1Y3FE 2RAUA 3ZHOA 2FRDA 4YYZA 4FFMA 3WB9A 4BX0A 2WWYA 1C5KA 1JEQB 4TV8F 3C43A 3ESBA 1VJRA 4PQYA 1XQXA 3O94A 5HCUA 5FPPA 3TZKA 1M5UA 1ZCJA 3D4PA 1WLYA 2ATVA 2FUG6 4DS3A 4EBFA 4HXEB 1OA0A 1QK4A 2DLDA 4QREA 3DKIA 2CHEA 3F1KA 5DNAA 3ZKAA 4BGEA 1CUJA 1KMMA 1HGXA 1SJ9A 2X9GA 2ZIUB 4TS1A 3EAGA 4MYTA 3SR4A 3G0IA 4GR5A 5D85A 2I67A 5LD2B 4JYPA 1L7BA 1T8SA 1T5SA 4I2NA 4KVZA 3U3ZA 2JK0A 3EGXB 3GZTB 3FZNA 3BKXA 1DAEA 3NFRA 4QUBA 4XUGB 1BO6A 1JQKA 1MG0A 1XALA 3FRIA 3L46A 4H77A 4U0JA 1HC7A 4YMGA 1ZEMA 4NOKA 3T5PA 3CWQA 4EGAA 2OBLA 3VZRA 3T06B 4KFRA 1Z2OX 1DJQA 1KI6A 2CUZA 2WD7B 2XMCA 2XVZA 2ZXFA 2QMEA 1FP4A 3LDFA 1KI7A 3GZ4A 3CLTD 4UZFA 1IJKA 4ALKA 3VZSA 3O7WA 1N0IA 4L8FA 1U3TA 5E6SB 1FE8A 4CQJA 4F1KA 4C0BA 2CD9A 3T3PB 1RLTA 4HBGA 1PR3A 1OXXK 3QX7A 1PT6A 4XQ0A 1YJAA 4ENVA 2BM1A 4ZQCB 4MKGA 5AKHA 2VBIA 3PHHA 3TMYA 2WJ4A 2YWGA 3JQEA 4QD3A 5H9VA 2NO5A 3COWA 4YCNA 3GRZA 4AKHA 2VSXA 1GTRA 4DC1A 4QGFA 4U2FA 5AM3A 2C5HA 3L01A 4S0ZA 5BT8A 4BU0A 3MN1A 5E1MA 1FX0B 1EINA 4KGXA 3ZKWB 1EFVA 1RM3A 4O4LB 1K4MA 3HXQA 2FKAA 4IFBA 4O33A 4UCWA 1HE1C 1Z37A 4FYJA 4DCNA 4YJFB 1E2BA 4F4DA 4OJYA 5F33A 1KEPA 3JS5A 2G9RA 3NTOA 4O3FA 1YZUA 4AN0A 2NNLD 1J99A 1E7QA 1V7QA 1WXEA 2WYUA 1HXHA 4HXFB 1ACLA 2ST1A 1I13A 3FZYA 4HDMA 3DFMA 4ZRMA 1SEPA 2Y27A 2JW5A 3R3ZA 2GBIA 1TTQB 3H1GA 3T6KA 1BMQA 1RQNA 1Q1NA 2NU8A 3GRKA 2JI7A 1DX4A 1QAQA 1Z0JA 1ODSA 5TEVA 3ER9A 4PIVA 2QMHA 4DPMA 4K9RA 1WDKA 2AD1A 3QKSB 2OO5A 1Y8RB 3G5TA 4X92A 4LJ7A 4Z51A 2YWJA 1M75A 2YJGA 3TR5A 1BYIA 4OB6A 1ZJWA 1QZ3A 1Z2AA 1NTOA 1OHHA 2WYHA 1EDOA 1OAKA 1P2UA 3CT4A 4HDRB 4L4SA 4LOLA 1CVLA 1XTIA 1ZUNA 1C2TA 4LY0A 4XIFA 1GPJA 3FWKA 1FNNA 4CCWA 3AEUA 2REXB 3JZFA 4BQQA 1S2NA 3PYLA 3GEDA 4C0AC 2GZ2A 2JKZA 3B53X 4I50B 2P2SA 1HG0A 4OHMA 5IG2A 1EZ4A 1WKVA 4Y67A 3OY7A 4LFAB 4QLOA 4C1BA 1C9EA 3W2GA 2B1IA 3KPYA 1XDWA 4C0WA 2B1JA 2O8BB 2YHSA 1KOJA 2IXEA 2Q3CA 2WJZB 3R3VA 4IIUA 4PYLA 4UOQA 5L4LA 1CSEE 1RYNA 4GOOD 1T0PA 1NMSA 4CUKA 1KPIA 1NJ6A 3QYPA 1AA9A 2WWHA 5BMVB 1XHEA 4Y18A 1DKQA 1MT0A 1O6ZA 4JLJA 2FFAA 2CLDX 4H6VA 5TF0A 1YF3A 2D1QA 4Y98A 3W6NA 1RXEA 2J3IA 4L73A 1FXUA 3BORA 5TJHA 3O21A 3DJYA 3ENKA 4RULA 2HWKA 2JA1A 1WW2A 3BERA 3EIFA 2I7CA 5EKDA 4X1YB 3VI4B 4R51A 1V7ZA 3IQXA 1QIKA 1U4SA 2DX7A 5JNLA 1LTQA 3P9KA 4GQAA 3GJ4A 4H17A 3QE3A 1JA1A 1YR7A 3AOGA 3ORSA 3RDPA 1UBUS 5BYBA 4WKOA 1JTFA 2QU7A 4BUJA 2XA1A 2I7VA 4S04A 5EIXA 3CH7A 3EXAA 3U60B 4JENA 3RGWS 5B4UA 5JXIA 4M0FA 5JIBA 3EZYA 4MMXB 2R86A 1QHHB 4CLXA 3ESDA 1LTKA 4PZUA 1LVUA 3EEIA 2EIHA 1HQDA 1G3IA 3KLPX 4QGHA 1G2QA 4WJZA 3SU8A 4AG6A 1FQJA 4Q1DA 4R54A 1F2VA 1PQWA 2R79A 4JFRA 4D44A 1U3UA 4XTCS 2B21A 1M1NB 2D7CA 5GV8A 3GEGA 4PVCA 5IKXA 3PPXA 5KOYA 3GRYA 3VR5D 1YOBA 4Q05A 4DCJA 3U4QB 2ECQA 4F1WA 2OQVA 3L2OB 1JDZA 3K9BA 4OL0A 3SGLA 1JF8A 4HB0A 1JTEA 4D0LB 1T9AA 1OTXA 4I3HA 4RENA 1GZ3A 4UUQA 2F55A 4TX1A 1ITZA 1TVMA 4B3IA 4P58A 5HKLA 1E61A 2OK8A 3TQOA 4ETNA 1GL7A 3LZCA 3CRW1 4PYMA 5KTYA 1D2HA 4J76A 2VDRB 3H7AA 5FUYA 1MU0A 2BLNA 3JQCA 5HJEA 1LFDB 2CXQA 4OHCA 2GEFA 2HOQA 4LWQA 4RFVA 4DR6B 4NEGA 2G1JA 3GAMA 4OAOA 3PTAA 5IJ0A 2W2NA 2V3CC 4PZAA 1G2PA 4CETA 3W2HA 1OVMA 3K0AB 1H85A 4FGJA 5DYNA 2VDNB 2VUHB 4HPXB 4JP2A 5B1IA 3INYA 3STUA 4XQ9A 3RQIA 2ZS8A 1JKJB 4A27A 2WMOB 3DOIA 4LTMA 1YA6A 4HQOA 1Y9JA 3MUNA 2V6BA 3IIMA 3LK7A 2VRWA 2X0KA 1UJ6A 4I3FA 5DX8A 4EKIA 5KAPA 5LQDA 1I7NA 2WF6A 3O5AA 4D3YA 2A9JA 5A3SA 4EI8A 4LF6B 2UDPA 4O3MA 5IBPA 4QGBA 5EESA 3NP7A 2QP3A 5F73A 1SXJC 1F0NA 3AW8A 2WU3A 2MSLA 4JBIA 4UAJA 2IYYA 4PX2A 1XQVA 4XYLA 2QJFA 1OLOA 1YQGA 3LXXA 3OM8A 4MYDA 4GPTA 3LBHA 2ACEA 3B48A 3EXHA 4C0LA 3EX7C 2WKSA 2ZJFA 2A9OA 4YJGB 4EBBA 2GXAA 3OQPA 3V46A 2EYUA 2O0HA 2PTGA 3EPJA 1Q0QA 1JWLA 2MR5A 4QUGA 1IBLB 3B85A 2I4MA 1ODLA 3VZDA 4LHXA 3MIZA 3JQPA 5G0UA 2CY0A 4NOJA 3GJ5A 2VOJA 3OAAA 4KSYA 2JIBA 1GXSA 3FNIA 1Y7PA 4H7KA 4W7SA 1DZIA 4KJZA 1DX6A 1HK7A 2FUKA 1YV9A 1Z36A 3MJTA 4I3GA 4BWGA 1REQA 4FLEA 1TEHA 3LJKA 2P4EA 1AXGA 1W4RA 1ISGA 1KAGA 1N8KA 1TL7C 1U0EA 3LRPA 1D3AA 3L06A 5JZOA 4MRRA 5LZ9A 4INZA 3CKLA 1R0BA 6AT1A 5CJPA 1M8JA 3VR0A 2QT1A 1G3MA 3KD2A 1P5HA 2W93A 3GA0A 5BYJA 3KT3A 3EXHC 1JFVA 1GLGA 1U80A 1Q0RA 1M5TA 4P93A 3HXLA 3UWSA 2PX2A 3O9ZA 4WLUA 5FPYA 3RVNA 3S0JA 5BWCA 3UPTA 1LI7A 2G80A 3TKLA 4D9BA 4IV5A 2BY4A 4M46A 5JSHA 2DOKA 1DEAA 5I47A 3Q2OA 1GRVA 4F96A 3GI1A 4CBVA 2Y0DA 3B89A 3OT5A 1RE0A 4NE9A 5JJCA 1K2VN 1U0GA 1HUQA 5CDFE 1N5RA 1RM5A 4D9GA 1E1DA 3D0OA 3IURA 2DUUA 2XAAA 2YIJA 2W43A 4RPHA 3SDSA 1QQTA 2EBHX 1ZU5A 1UBHS 4X60A 2J5XA 4FWIB 2WIDA 4CM4B 2X5JO 1QPGA 2OUKA 2O57A 4RPCA 4AU1A 1DRJA 4TXJA 4YP5A 2QZJA 4O2BF 3RYIB 3D6AA 3R0JA 2AOUB 4H1WA 1K8XB 2PN1A 3F9CA 1Y5LA 2V96A 2NV2B 4DLBA 4UU7A 5AVXA 5E7JA 1X80A 3DCIA 4C7OB 5E6RA 3RUAA 2XZPA 1ZM9A 4HATA 3DVAB 3N2YA 3F98A 2WJPA 3LQQA 4ND1A 4RVGA 5EHZA 3QE9Y 4B32A 3MGCA 4GL4A 2G3YA 4CEHA 4EWLA 4W5TA 1P0QA 1QTQA 2R6FA 2O07A 3LD9A 4QSHA 1AS3A 3DKPA 2Z0MA 3Q7SA 2EU8A 4C7BA 4CQLB 1UJ2A 1UF9A 3WLIA 1J1IA 3CUUA 3HR8A 2ZQYA 3IALA 1DNPA 3FOWA 3T54A 4ER3A 1OTHA 1WQ3A 4MUAA 3L1IA 1R1DA 2DFNA 2I55A 3Q9NA 4GI2A 3U3MA 4BMZA 5AJXA 3PC2A 3A4VA 3U7QB 4KQ1A 2C8VA 3NJ4A 4EHJA 4BZQA 1Q0ZA 2J9FB 5DBGA 1NRIA 3T5TA 1ZMRA 3GPBA 2IXGA 1VHWA 4DSUA 2JAWA 1R0SA 4YLGA 4D3DA 3OPYA 1JDNA 5A9SA 1QHIA 1NR1A 1Z5ZA 2DHCA 2EFCB 2P41A 2QRJA 2OCBA 2YZGA 3QXJA 4QVKA 2IEIA 4X3PA 1YR2A 3BH0A 3H04A 3BRWA 3KQPA 4HOYA 2FPSA 4IIDA 3DLCA 4RVOA 4WE3A 4XYEA 5FOXA 1IG0A 5ALZA 3NBUA 1OX5A 4KQGA 4FYKA 1M0TA 3NBYC 2Z8YA 4W8OA 4RD6A 5BWBA 2QL5A 5LJIA 3GLTA 3HCFA 5L7YA 1CFJA 3EXIB 4CTNA 2B8WA 2OAEA 1SXIA 3SZGA 4D8UA 3A8TA 3N0VA 4C20A 5KYYA 2AK2A 2CCJA 1KQPA 2MYUA 4QM7A 3DVLA 4JITA 4US2R 1R0ZA 4IOJA 1P0FA 3L02A 1P3Y1 4KQ9A 4B4DA 4NZOA 5JC8A 4L02A 2Q5CA 1J2TA 4FU0A 2VQDA 1BWPA 2JFQA 1P74A 2A7XA 4N3AA 1JR3D 3LLCA 1AD2A 1SPBS 1T9KA 3LWDA 4FFVA 5KUTA 9ATCA 4DA8A 3N2NA 3URKA 1GQYA 1A76A 2WUDA 3HRKA 3CVXA 3OE5A 2FQXA 1MAAA 1UJ5A 5HF8A 3RK0A 4PICA 4ARZB 1E9AA 1QAOA 4IJ6A 4FQ7A 5BV8A 3BH7A 2WAMA 1RJFA 2LW7A 5IDVA 1DJMA 3GLVA 1JZQA 5EJ2A 3CZAA 1EDDA 3GQBB 5T4EA 2XT9A 4ZYTA 4CEIA 2B34A 2MSCB 2PS3A 4BFYA 1CJBA 3HFJA 1HM5A 1YQTA 1WD7A 3R23A 4A16A 3T7RA 4ZV4A 3O8NA 4J16C 4PYIA 5DCUA 4ZDKA 1XMJA 4E2FA 4Q0MA 5AVVA 2WHRA 3I01A 2XJ9A 3CLKA 2XTZA 1DQYA 3VR2D 1RMTA 1O0SA 3VU0A 4TS3A 4K9NA 2KYRA 5JCXA 5SYAA 2YOHA 1EEHA 5HTKA 3JU3A 3KOMA 4GGOA 4H9GA 4CKYA 2XCIA 3PZBA 1T6NA 1YRBA 4NECA 4CQMD 3ZU4A 1YU6A 5EWMB 2AN4A 2F1KA 3AFGA 4H4EA 4IOLA 3ZCUA 3QY9A 4HK4A 1GRNA 2ZWAA 5A4KA 3DL0A 5KKNB 3KYBA 3H0CA 4TWJA 3PI6A 3UMJA 4AIRA 3KTAB 3FOAA 2NSDA 3H97A 4C4PA 4G5HA 2BJHA 5P8WA 4C14A 3KVOA 4HLNA 1H2ZA 2C3PA 4PLGA 1WHSA 1OD6A 2ANBA 3VV3A 4WK0B 2PLFA 4ESEA 5FR1A 4DC0A 4V0MA 2MMGA 4BCDA 4F04A 1BDIA 3O8OB 3WX0A 2ZKLA 1JR6A 1T2VA 4YI5A 5TQ2B 1BDBA 3I1JA 1GV0A 1TQ8A 3OD5A 3PI7A 4DJEC 5CG1A 2XD4A 4IHKA 4DDWA 1YB4A 4YQZA 2C4TA 2CKDA 3ASZA 5E8RA 3UICA 2FHSA 2QD4A 2VAPA 4C7KA 4GMGA 4RA9B 4QXAA 1DAKA 2FP4B 2DHDA 3A6ZA 5DYGA 5JS7A 1EVJA 1KI2A 2O6HA 1UCFA 2H31A 1WXHA 4G5YA 4D9KA 1EM6A 2EGUA 4E09A 1KWGA 1JT9A 4B82A 1QQ6A 4IGEA 5EYPA 1Z15A 4FOLA 1NWCA 1PCXA 4ECEA 1TB4A 4YPOA 3ECAA 1ODTC 3KUXA 4UM7A 2OKCA 3WYGA 1TADA 4MICA 1SBYA 5DCWA 1B1AA 5GMOA 5B64A 1E5QA 5COQA 5H7XA 2P5YA 3SHTA 3BWBA 1JSXA 2ZXEA 3IXQA 4MCAA 5KQPA 4M8SA 2QVYX 1GAXA 1JJFA 1OYYA 3DPSA 1E9FA 2G40A 4MHSA 3OOYA 4OQMA 1M0EA 3MWEB 4ZJPA 1QV6A 2IHVA 1K63A 5DLDA 1HT1E 1JV2B 1NE7A 3E8MA 1GADO 3WRYC 3CN7A 4HVCA 3K92A 3THWB 2AUNA 5FPKA 3I12A 5FCDA 5FNVF 1QO7A 2C5EA 3PHJA 4HMPA 5KNDD 4KK3A 2QN2A 4U7TB 2GCPA 2HEIA 3K3PA 1QVRA 1G5QA 1JIIA 1WMBA 2Q5EA 1WOYA 3KQWA 4Q18A 3ONEA 3URMA 1N6NA 2LCIA 3QEMA 4NHEA 3IA2A 4V3CA 1DRUA 3LWZA 3MTJA 4FX2A 4YEDA 1A9ZA 2X8AA 5JI3E 1H2BA 3CE6A 1KQOA 4PHGA 2ZI7A 4B7XA 2EDAA 2K2QB 2D2IA 2PIAA 3V00A 1EHIA 4HQ6A 4MQ4A 5HMLA 4A23A 3NM4A 3SJBA 1Z08A 3LH5A 1TJYA 1I6LA 3ZW9A 4ASUD 1SXHA 5B2FA 1OV6A 1QLJA 2VAVA 1S3SA 4BKMA 4KVGA 4WK4B 3I64A 4QZVA 3GG2A 4MROA 2XCRB 4QOFA 5DMHA 3R4CA 1MEOA 4NXNB 5SV2A 3UTCA 1EG2A 2BFBB 4OLHA 3A6EA 1E4OA 2ETXA 3NHKA 3DO5A 2WA2A 4XJSA 4YTEA 3ZWQA 2A9QA 2ISQA 4JLKA 1EM8A 1WXGA 3OEHA 3R9IA 3DDHA 1KIMA 3HNRA 3PQ5A 2QNBA 1DKPA 5CJJA 4HAZA 2GBGA 1MIHA 1GPMA 3LI2A 4JMPA 4K1LA 4UAUA 3SG0A 4II7A 4KQJA 1FL9A 3EIWA 4B6OA 1WX1A 3BVPA 4ND3A 4W7HA 1KI4A 2O52A 5ADWA 3ETNA 1DEXA 1DIOB 3MAGA 4LJLA 4R1LA 4ZVSA 3FZGA 1KVSA 2VYND 1LS1A 4UVEA 1J25A 2ACVA 5EVCA 1LDYA 5D7BA 3HUUA 1YCGA 4XYBA 5IRCD 4RHYA 1N2CB 1IY8A 5KKCA 4YDRA 4LK2A 2RD2A 1XU7A 3EW7A 3K0CC 2WJJA 3K2BA 3HUTA 1N5JA 1VE9A 2OCGA 4BAUA 6ABPA 4LJRA 4NU0A 1FU8A 1W5AA 5L4NA 4ILKA 1MFPA 4MW6A 1S8FA 1X13A 1Z6AA 5FOWA 1O95C 4C6HA 5KHAA 3HKEA 2QM0A 1UDBA 1J00A 2XTAA 3OWXA 1DBRA 3C45A 3OZSA 4GICA 3KR2A 1MOPA 1XNJA 2LDBA 2J4CA 4JLOA 5CAEB 4AM8A 3R6GA 4XE5A 4BMYA 4IIGA 5JADA 1B23P 1J06A 2NU6B 3LHFA 4DEXA 4P31A 5ILQA 1RIFA 1X7ZA 3EQ6A 1AGYA 5FA6A 4M0DA 2O5RA 1UOEA 1P9LA 1PFGA 2FFRA 3CNBA 4P82A 3TIVA 3KSRA 2DWCA 2WJAA 3HUEA 4GI1A 4XXHA 1SKMA 1KP2A 4FI3F 4BNUA 1KO5A 3AM4A 1HLPA 1R74A 4NEQA 3D5TA 2VQFB 1D09A 1Y1KE 2G08A 3A11A 4HLDA 4DAEA 1KAEA 1E63A 1YDMA 1D4OA 2HJGA 3OF5A 2NP7A 3JATA 4QNRA 3FGOA 3HA7A 5FWAA 2R1TA 5BT9A 4G9BA 2VJCA 3KVRA 3MWKA 3ZW7A 3CBGA 1E9EA 2IX9A 2QLNA 1RRMA 4ZKEA 1L4HA 3E9DA 3LOQA 4OYRA 4QDJA 1ESZA 1B6GA 3L7NA 2XLBA 1GYPA 4KEAA 1BE6A 2EP5A 1JTVA 3D6NB 2CVZA 3QVOA 2QTHA 5AK4A 4CQMB 4KXFB 2DKFA 3ZNPA 4A0RA 1U28A 3UANA 3G5UA 4GLJA 3B5JA 4WI1A 1IJBA 5CA0F 3O92A 1HDGO 2CD7A 2OFXA 2VCEA 3BMXA 4K05A 3RF7A 1E3DA 2X6RA 3I9NA 5CT4A 4GEGA 2PUVA 3UC5A 4DA9A 1IJFA 2Q99A 4OQDA 1SHJA 2YFHA 2ODNA 4YIKA 1ES9A 1SVLA 5BXQC 1NNEA 4KV9A 4KODA 3M5DA 3UF0A 1YZQA 1SKYB 1LS6A 1LY1A 1CB7A 2IUTA 4LYJA 4GBJA 3EEFA 3IAS1 4UDOA 3GP5A 4JOSA 1KK0A 1TRKA 2HCRA 1DS6A 3KHUA 1BDHA 3LX4A 4I9GA 4KFSA 2QS9A 4G1FA 2F9LA 4RK4A 1NTRA 3A1CA 5CFOA 3L04A 2PDAA 4IMRA 1DJOA 1XD8A 2RH4A 4IVQA 4CWAA 5BNIA 1NNI1 3PFCA 5H5JA 3FA2A 1XIVA 1TGVA 1D5CA 2ENUA 1IK6A 2Q3JA 3DD1A 3G2IA 4LOKA 3VISA 1GRCA 1X1TA 4CKWB 4E2XA 2G6TA 1KAHA 1M2OA 1V2GA 3DBLA 4LBZA 1E2JA 1PGOA 2ZJAA 4LF9B 1UBRS 4N9QA 1GL6A 1IQ0A 4M8IA 4L2IA 4YPFA 1L3CA 2GUGA 1E5DA 3DEHA 5LMNB 1VMAA 1UINA 2HNBA 1FPMA 3K09A 1G2OA 4IWXA 4TKMA 5JBIA 4EUHA 3PGVA 4QU9A 3FAKA 1ESEA 1YAJA 4MRMB 4UASA 1TYEB 4DAOA 4D97A 1VCOA 2DT8A 1GITA 5C37A 1JFSA 3Q7IA 3WV4A 7YASA 2QTMA 3FTQA 1TTHA 3OKPA 2ZRLA 1U0SY 3QLJA 3R5KA 1MB2A 4NSNA 4R0NA 3Q8KA 2HMAA 4OB7A 1QYRA 3EXHB 5TGZA 1ZSYA 1OVGA 1W93A 1G8PA 1HE5A 2HJWA 4YJGA 4WK2B 2ZYSA 2XZOA 4HX9A 3SYMA 1B4DA 1ZIPA 3CX7A 3HSYA 3JX9A 4B09A 5BWMA 1RC8A 4OHRA 1CNFA 4QBFA 3R74A 1YI1A 4F46A 5HMMA 1GWNA 2AYZA 3GK3A 4XEUA 3AESA 3EZNA 1ZI6A 3A4MA 1M6EX 1QX3A 1TYCA 3BS4A 5DNVA 4DQDA 1P62B 1C30A 2GDZA 1BH2A 5FBHA 2BE7A 3L43A 4DB4A 2EW1A 3UH0A 3HKBB 5ECDA 2CMKA 2QROA 3USCS 5DPMA 4DNOA 4AX8A 2RI6A 3BAZA 5KNDA 4B3CA 2OZLB 4X1OA 2Y2UA 1USKA 3AF0A 1N3YA 2X2FA 5FEMA 2ZJOA 3ZN2A 2JANA 3M4ZA 3U44A 4UHCA 2JZOA 3RS5A 2NO4A 4YMTA 2FZVA 4FYXA 1P29A 4LHSA 3GUVA 5E38A 3VC2A 8GPBA 3U9SA 2PNFA 3KFVA 1E3WB 3A6PC 1P1IA 3FZEA 3KZVA 4O4JA 3GVPA 5DN9A 4NIMA 3IPRA 4BV8A 2PK3A 3EHEA 4L74A 3HWSA 4LJYA 4FDMA 5C3UA 4NCXA 5CGZA 3JD1A 4GGMX 2ZE7A 1JR3A 4IO1A 1CPYA 1CJSA 2Q07A 2R8RA 2VATA 2ZRDA 4INAA 4MCHA 5GOTA 4DUZB 3K7EA 4K5QA 2P11A 3RC7A 3K1YA 3CJRA 5JZ9A 3DFIA 3HDTA 3KJXA 3OQIA 2XUIA 4MYCA 4PZLA 2AN5A 2BDEA 3Q9UA 2XSZD 4JZYA 4WFKA 4HJXA 1MKYA 1XXLA 1XXHA 2C2YA 4XPIA 1KEVA 1JU4A 2V7XA 5EWLA 4OX9B 2Q5HA 2BGUA 1TOAA 2HK7A 2I33A 2J5QA 3H2HA 4YJ3F 7ADHA 2FUCA 1PT5A 2L18A 2E87A 3G2MA 1R15A 2HMTA 1TU3A 4MB0A 3UMSA 3P27A 5D5PA 1JQDA 4URVR 3VPGA 1QGAA 3COJA 4Q7MB 3BZWA 1IONA 1T9ZA 3ETCA 1G66A 3GCWA 1T4MA 4W5OA 4P92A 5E7MA 4RKEA 1ECFA 3MOSA 1D2AA 2ZUBA 2ZYUX 4FMCB 4G1UC 4MW0A 4A8HA 4EO9A 4KLAA 1EXDA 3WFZA 4E2ZA 1SUWA 2Q62A 4KMOA 3UT5B 4N8EA 4A0FA 4IYRA 1L8OA 3NHZA 2FEPA 3ZYZA 2VP0A 2BHTA 2WEKA 5FOQA 2NVWA 1TKCA 3D31A 4X0EA 4ARIA 1ZK3A 2A0WA 3GFRA 3K1AB 4RE6A 4JQYA 3HO1A 4MDFA 1NDHA 2H1VA 3FLBA 4ZHQA 1N78A 1I4TD 3M4NA 4HYYA 4Q3NA 3C7CB 3T7AA 3SXPA 5LWHA 4DSTA 3UB4A 3OEED 3KT8A 1Q7EA 1V5GA 3NTVA 3U3OA 1W9HA 5IDQA 1U90A 2JAPA 1XZCA 5F78A 1Q0TA 2NZ2A 2WLTA 2IPNA 2HQ1A 3IQGX 2UZ1A 3KYCA 3LP5A 3K0KA 3QIAA 3QFTA 4P33A 3PUHA 4AO6A 3H19A 3G5AA 1T0JB 2P4HX 2FPXA 1K08A 3FSRA 3K31A 3M2TA 4PX9A 5KYTA 5ITSA 3ZWNA 4E2WA 2YVQA 3RV4A 3PDJA 1UJNA 2BKAA 3VBEA 4CM8A 3EE6A 1V7PC 1X7WB 3A2MA 4BJHB 1YR9A 5G1NA 5D87A 3T9EA 2C42A 5CIYA 3I0NA 1QUFA 3DL7A 4LBYA 1M2NA 3CIOA 1FDOA 1L7OA 1VXOA 2NU9B 1Z34A 3FDZA 1GKUB 1PWYE 1W30A 3T52A 3UHOA 1MB0A 2X22A 3HJCA 3RU9A 1PTJC 2H8GA 5U1PA 4E46A 2WZCA 4LRTB 4R01A 4E3WA 1HFWA 1RHKA 4PCVA 1P9WA 1Y6ZA 1L4MA 4Q9HA 4B7UA 5I3ZA 3KLOA 5A5VA 3DAYA 2OLEA 3D8TA 1ZD8A 2XECA 1E7SA 4JGBA 3PCRB 1AUOA 3TKYA 1PQYA 2FOXA 1MC8A 1AQUA 2HQOA 3BMNA 2XI4A 4D8WA 1UP6A 4D8TA 1EX9A 3UJPA 3PNYA 2WYWA 4NENA 4LYGA 5JSZB 1F1JA 3MAJA 2GZHA 3AI3A 3IP6A 4YMWA 5I9BA 4WNYA 3OETA 4DJAA 2CV1A 4MIOA 1T9DA 3F5SA 5J23A 4JKYA 2ZT7A 1FU4A 2HT6A 1CQJB 1D1SA 4GC9A 4KR9A 1VGVA 5BUCA 5CX1B 3DLHA 1CKEA 1SUIA 3OP1A 2Q0QA 1FTNA 1BRTA 5C1DA 3GUCA 3L6DA 1GGHA 1PDOA 4MARA 4MV5A 4ZCQA 3RIMA 4OREX 2YYSA 5KWSA 1ZK4A 5EZYF 4M8LA 2X15A 3EVGA 4KC0A 3DTNA 1G5RA 4QDKA 1V9CA 1F8GA 1DTWA 3ZV6A 2BI8A 4EEKA 4FGZA 4Y9RA 2W2LA 4A10A 3SP1A 2YFYA 1Z68A 3OT1B 4YP9A 1I3LA 1ZJJA 5EUBA 1T5DX 2LWIA 5KTPA 1H2EA 3M9LA 1T8TA 5COBA 2GYWA 3RS9A 4RWEA 3COPA 4PNPA 5JAOA 4ISCA 4DQUA 2HKIA 4KLCA 4EB6B 1KYIA 4FXPA 4UJ3A 5FI0B 3I4CA 2ET6A 3TZLA 1GDDA 2BFEA 3I9FA 2WW8A 3D3JA 3PHGA 4NICA 4P4TA 1P1BA 2V0NA 3RIEA 3HUDA 1C1HA 3GFPA 3OTGA 3I5AA 2CYBA 1R8SA 4HCJA 1W19A 2RJ3A 3T38A 2I6SA 3PXAA 3WKEA 5DIZA 1H3EA 1V8FA 1WA5A 3FOBA 3L93A 3V32A 4XCQA 4HWGA 3RIXA 3WB2A 2E9SA 4U6SA 4L9RA 1D03A 1QGDA 2ZJ5A 4PZCA 4BNIA 3QBVA 5I7SA 2VCHA 1IZYA 1K92A 1JHVA 1IU9A 1PGPA 4ZGWA 2D1RA 3PWTA 1YACA 2GN8A 2ZI3A 2WUGA 2DG2A 3L8FA 1NY5A 3M6FA 4GFDA 1AKNA 1NAIA 1NZFA 2FEMA 4FNMA 4JUBA 4OHUA 4UJ5A 3ZZ0A 1ILWA 1T15A 3E7PA 1WNFA 2B4RO 3A05A 1A82A 2X41A 3MC1A 4YCBA 3VR4H 3D6HA 4ZT7A 3OVMA 5AW4A 2O59A 2ON6A 1JQBA 3DV2A 1TUIA 3N2KA 3TS1A 1KY3A 1W4LA 4CM5A 4Q4JB 1FXWF 1W581 4ZI7A 3WA6A 4L5AA 2ZTVA 2IHZA 4WKGA 2C7RA 4E4RA 1E9RA 1CB0A 5BUZA 5CXQA 2FB9A 2W7TA 5JNSA 3HO6A 5BURA 3WISA 3ROKA 1KSGA 1FCJA 5KNBD 2QT9A 2ZUFA 1WXDA 3C3PA 4L16A 2HD4A 4C9BA 1RPAA 1J9ZA 3MLAA 3UYLA 3UMMA 1IZ9A 2FI1A 4CLRA 1YJ5A 1WW3A 1QIIA 1OUMA 1ZVQA 4U2CA 5G0VA 3ZDFA 3U7GA 4F11A 2BDUA 5ABPA 4P4UA 2JIZA 4PCAA 2O0MA 1QF9A 5M34A 1A9XA 3K4PA 4CF6A 5CFMA 3CCBA 1W1IA 4BFWA 1KYYA 2FR8A 2OXEA 3PV0A 3E9YA 3P9NA 1ZMBA 5THXA 4KFCA 4DPKA 3V34A 5AIBA 2GNOA 4IIXA 2DGDA 1QQ5A 4L4ZA 3WLSA 3IVXA 3IUJA 3RM3A 1H8HD 5E9QA 4AC9A 4MWDA 4O2AF 1FFSA 2VBCA 3SIXA 3C1UA 4ZXPA 2INGX 3BM5A 3K9HA 1TK3A 2ONCA 3UENA 1ZFNA 2A5DA 5AUOB 3ONNA 4Q66C 5BR8B 1AUQA 1J2YA 3OZVA 4FUTA 3TZCA 7GPBA 2PUDA 4DV3B 4FNAA 3G5LA 3Q3EA 2EFHB 2IYXA 3O8QA 1XNQB 2AMYA 2CMHA 3G2QA 1EGHA 2QZSA 1NWHA 1BXGB 2Z4TA 1HX7A 2D1SA 4M83A 3WIUA 3ZU2A 4RD3A 5EJ8A 4CL8A 1QPBA 2FN4A 4DMGA 2JJ8A 1V1RA 2CSUA 1DXOA 1HDEA 4Z1MA 4I1UA 1Y6FA 3AM1A 3DFZA 3IR6A 2Z1NA 4Z3OA 3H5OA 3DZIA 3W78A 4A0HA 3WDSA 2P62A 5TQVA 5IC4A 2VHJA 2Y0BA 1QVVA 3V1NA 2XTNA 4B45A 2Y66A 3TVYA 2GA8A 4IH1A 4C3ZA 2C5BA 4BLTA 2VPXA 3JR7A 2AOUA 1XTVA 2Z2XA 4BNNA 3D02A 2XF2A 1FFXB 1TQ4A 2JBAA 3TTXA 2WVJA 5KOHB 3N6VA 3OPMA 2CEAA 2A35A 4M98A 4X66B 4OIFA 4JLPA 4WKPA 2A4MA 4TUYF 1ECGA 3RJZA 1AG9A 4NCKA 5G0TA 4C4YA 4KXMA 4JT4A 4HAOA 4OIMA 5DXJA 3ESCA 1WDWB 1YR8A 4I55A 4RIFA 5EHNA 5LKRA 3T3OA 2CK3D 1P7PA 3K9NA 1YS4A 4AZSA 5JS1A 1C8VB 1KMCA 5F23A 2JLRA 2VF4X 4ITVA 4BZZA 1OZ0A 1IZ0A 1SN7A 2GXQA 2VHZA 2FXVA 4TV8A 4AJEA 3RUIA 1YWGO 2GAFA 5KSYA 3L5OA 3NC1C 3GLRA 3FPCA 1JX6A 3T5GA 3VO2A 4DUYB 3F5DA 4WLVA 4JI2B 5KMGB 3KRTA 4G5SA 1K6IA 1FXSA 1L6IA 3KUCA 3PENA 4L4RA 5BWNA 1FFGA 4ENPA 4NEHB 5CB6A 1ESDA 2ODWA 3D4BA 4EHNA 4B34A 1MOZA 4TV9B 5CFNA 3II6X 4QTTB 3D7KA 3H05A 2VUSA 4PRYA 4ZEOA 3ZEIA 2GUWA 3C98A 1NW4A 4ENUA 1GUZA 4YJ3A 3BTVA 3SBEA 4LW8A 3GLSA 2I03A 3PHBE 1DIAA 3EF3A 1JPUA 3ET4A 4GS5A 4NZYA 4EG5A 4GBGA 2A9PA 2YW9A 1ZJ5A 5CLIA 1OOEA 1SC6A 3VBCA 1VL2A 1FDSA 4DIOA 4DA4A 4TS9A 4QDZA 5F2OA 3SF8A 3PFGA 1GDHA 3L8EA 3EJ6A 5J4LA 3PDHA 4CM9D 5H82A 2OBMA 4H4DA 4TQAA 4HH3C 2VRNA 3K2QA 3GD7A 2C61A 4KWIA 2ZCVA 3LMKA 3MRVA 1HY3A 1X9IA 2JH3A 4RL6A 5AT1A 4DLVA 3QXHA 4EY7A 2QJRA 4EVRA 3L0OA 3DE4X 3G7SA 1IBRA 4I5DA 3EMDA 2D74A 2B5VA 1X9HA 1MO3A 3A2LA 4WNAA 1N0WA 2Q3FA 2EKQA 1EGAA 2IXTA 2X6QA 1U8EA 2GKOA 3DHWC 1W87A 3ZY4A 1P2GA 1AXRA 3VU3A 3KQTA 5DTRA 4BRSA 3GVHA 3RS8A 1WQ4A 4IIJA 1OJ7A 4QXPA 3W1WA 2QLLA 1G9TA 4JY7A 4UNSA 4KIUA 1PV1A 4Z9XA 3UXEA 4ALLA 5LDDC 3SKXA 2IW3A 5CMLA 3IP9A 1GGMA 5JMWA 5DTIA 3ZXXA 3GQBA 1E2EA 2P30A 3L7CA 3N7TA 3P9CA 2BGIA 3IP5A 1UJBA 4UULA 5LA6F 1RBQA 5A5GA 5MN6A 1QRSA 4YT4A 1T2CA 2WHEA 5ALVA 3KSMA 1PT8A 3SJZA 4QC2A 4K9QA 4HDNA 2LIPA 3WMWA 1T24A 2IPAB 4BC1A 3VC3A 1NVTA 4A2PA 1WBDA 4CUZA 3HNPA 1OI3A 1DKUA 2WUWE 3I8SA 5FYQA 1N2JA 2JIDA 4UBJA 4BJ3A 3UPUA 2C7PA 1PL8A 1QQAA 4Z1MD 1EK2A 3A36A 1JHAA 3OJOA 1I8TA 4PR0A 5KWJA 2BTQA 2PFSA 5KYGA 3L18A 2VK1A 4AUNA 1QB8A 2XT6A 1K7SN 3G8CA 4FCWA 1RJEA 2RK4A 1TX4B 3A4IA 2J59A 3GJXC 1AXEA 2UU9B 2VPTA 3S1AA 1KYVA 1FW8A 2ADMA 2RHGB 2YYZA 4HFRA 3O31A 4YJFA 1ZCBA 3R3JA 4A0QA 1QC5A 3T4EA 3ECSA 2ZWIA 3EYWA 1DT3A 2IU4A 4E1AA 4JQSA 2QORA 2OHOA 5GGXA 1ACJA 2IEZA 4H7EA 2CF5A 1E6CA 4Y7CA 5J58A 1J9EA 2BKVA 5IABA 1E2GA 1R9JA 3DV0B 3VPXA 3TAUA 2JNWA 5CM2Z 2X58A 3UA4A 1KMNA 1RLOA 3DDOA 3N8HA 3CLRC 4JJ7A 1W25A 4P2BA 2WPDD 1M2GA 3FNBA 1MABA 3O0TA 3C5EA 3DGFC 4D42A 5AOCA 3OQNA 2QD5A 1NQUA 1IWOA 4GOND 1N1EA 4KH1A 4N5IX 4NAHA 1POWA 3W5UA 4D9IA 1ZRNA 4F6RA 3EHDA 1FTSA 1FP7A 1RYMA 5EJMA 3CY6A 2JVJA 3BIJA 2SKDA 2XYQA 3CLSC 4B35A 3FE2A 5EJFA 4Z53A 3RF6A 3TECE 5ALYA 2ZUCA 1YE5A 1PZNA 1SXJB 1RLUA 2BFNA 2P6MA 4I0WB 3ISJA 1I9GA 1E2FA 1E69A 4JVOA 3L7AA 4IJVA