1HX7A

Solution structure of the catalytic domain of gamma delta resolvase
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
105
structure length
105
Chain Sequence
MRLFGYARVSTSQQSLDIQVRALKDAGVKANRIFTDKASGSSSDRKGLDLLRMKVEEGDVILVKKLDRLGRDTADMIQLIKEFDAQGVSIRFIDDGISTDGEMGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSPOSON GAMMA-DELTA RESOLVASE
publication title Solution structure of the catalytic domain of gammadelta resolvase. Implications for the mechanism of catalysis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Dna binding protein
total genus 20
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2001-01-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1390 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1hx7A00
5C31A 3LHFA 2R0QC 2GM5A 2MHCA 1HX7A 1ZR2A 1GDTA 5C34B 1GHTA 3GUVA 1ZR4A 3LHKA 5C35A 4BQQA 3PKZA 5C32A 3UJ3X 3G13A 2GM4A 3ILXA 2RSLA 3BVPA
chains in the Genus database with same CATH superfamily
3M5DA 3UV3A 1T8WA 5FD8A 2VT7A 1ZHHA 2JRCA 1L4LA 4KQXA 2A3RA 2IX9A 5CDSA 4O4HF 2P3LA 3MC1A 3N2YA 4D74A 2AQHA 3DZCA 4BN5A 2OKGA 1BXRA 1G21E 4P0QB 1VG8A 1HG1A 2JHPA 2Y76A 2FX3A 3PQDA 5B7GA 5KC9A 4O2BB 1M1ZA 1TQ8A 2DHCA 3PUJA 3M5PA 2YNMC 2HW8A 5CYGA 1F7VA 4D57A 4AY2A 4MWTA 2YV5A 3I3SR 1RXIA 1NI5A 3W8FA 2AXNA 4NJEB 2VWHA 4F71A 3AINA 2R65A 4KNYA 4GIBA 1FFGA 3TINA 5CVJA 1K8RA 4O2BA 4EHLA 1MB3A 4Q1BA 2HUNA 4YQZA 2BCGY 3Q15C 4HQ0A 1YR7A 3GCGA 4NOLA 4KCGA 5KYYB 2W90A 3GQVA 3NZEA 1LBEA 2JHFA 3RVMA 4DRZA 5C1DA 4L51A 5IH7A 2CVPA 4AS2A 3GJ8A 3OEHA 3RC7A 4UBNA 1H6DA 4A8HA 2NPIA 3OOEA 4RACA 3HVRA 4UATA 3G9ZA 2Z3VA 3CNLA 3N5CA 3WQBA 3D81A 1VDZA 3B7PA 1XWFA 2JD2A 4PICA 1RWNA 3EDMA 4EH1A 9LDTA 5TS3A 5KYYA 3WGTA 2PUEA 5HCUA 1E0KA 2ZDGA 1G98A 3AGPA 1TJ4A 1Z25A 2CN1A 1HO3A 2EAUA 3DGEC 3HXTA 3K92A 4Y2RA 1NFFA 3HPQA 4N7JA 3DMHA 1R0BA 3KHKA 3GARA 3DE2X 4JYMA 3AQIA 4HS9A 4FDLA 2XVZA 3DXZA 3N76A 3STUA 4JHXA 1VDMA 4ITRC 4EB8A 1E0AA 2DLDA 3SHTA 5AW2A 2ENWA 1P1HA 2EP5A 2PT5A 4RKFA 1Z17A 2L42A 4O4IF 2Q4EA 4RAQA 3MTJA 4AL4A 4G5HA 3E0XA 3LO5A 3D6NB 3QLJA 1NQXA 4RPLA 2I87A 1ORVA 3UJ9A 1TM1E 4M1WA 2WF5A 4YCBA 2CL6X 4YMLA 1M5RA 2CHEA 1XRNA 2QN2A 1GYPA 2FQXA 3FPGA 4FOPA 4EG5A 3G0BA 1M9NA 2A84A 3IB3A 3CRVA 2MSWA 3NTRA 3IIEA 5FPHA 1E9CA 3G9XA 3IXLA 5FPQA 3HCPA 2X2PA 4E7PA 1N0HA 2H4HA 4US1R 4Z7JA 3GVXA 2HRCA 4UNRA 1PR9A 2FKNA 5C37A 5MF6A 2VDPB 4LJ7A 3I23A 2DERA 1DBIA 1U6JA 3FZEA 3QXXA 5D7NA 2JCYA 4F5ZA 1ABBA 1UKAA 4FFWA 3IOYA 4AN1A 1VECA 4N3CA 5IC4A 4G23A 1L1QA 1N78A 3B51X 5DO9A 1PI3A 2FR0A 4O4JA 5KX5B 2VH5R 3DNFA 2IEIA 3HJHA 1U2TA 3TVTA 5BW4A 3IBGA 1JJIA 1NP3A 2AJLI 2CL0X 3GLKA 3MWGA 4R1QA 3RIHA 4BMOB 5L3QB 3WKBA 2P0EA 1S2NA 1F0PA 2JAXA 1RCFA 2PH1A 2W8BB 1K5DA 3B8HA 3E22A 4KYUA 4KE6A 3WOHA 3WK8A 3NNNA 2R6ZA 4ARSA 1X7HA 2VAWA 3IOBA 2G9QA 4J3FA 1GV1A 1G63A 3EAFA 2RGGA 1RI4A 4QOSA 5J4HA 2ZSIA 2WHYA 4MLDA 3ANTA 1LDMA 2R8EA 1I2DA 3B6ZA 3K2EA 4INAA 5L3QA 4K0KB 4BZQA 5ABPA 2RAFA 4W7IA 2Y77A 1E5XA 1Q3HA 3ETJA 4NPCA 3GJ5A 3G1UA 3T9EA 5CEJA 1QE0A 4NZPA 4R5HA 4IZHA 3UK2A 3FDFA 5T57A 5DCWA 1RXWA 2Z5VA 1V5IA 1WOMA 3LBAA 4FKZA 3JARB 4HS4A 1DC6A 1MC4A 1Z7YA 1CWUA 1O5IA 4TMXA 4LISA 4LJKA 1Z6TA 4N5NA 4XUEA 5IJ9A 3QLUC 3OZRA 3W9YA 2W37A 2ZUDA 2A3NA 2AUMA 4OFXA 4WXYB 3PHGA 2H1SA 3RSFA 3WL5A 5UKDA 4BVBA 4E33A 4D79A 4P3XA 1TPYA 2ZVPX 3FYDA 1NLYA 1E8DA 4XIJA 5A5FA 3T5CA 1F3LA 3JARA 3ZH2A 4MB2A 2C9CA 3A1SA 3MT0A 5FF9A 4NENB 3A9TA 3I3OA 3IIMA 3RWBA 1C3JA 1IVYA 1UBRS 1XDWA 3JQ7A 5H02A 4I6GA 2OHVA 1E96A 1PJAA 2ZRGA 3D59A 2P9HA 2PWBA 3L41A 4L4XA 2CEAA 4OHKA 2C1XA 2QT1A 3HXLA 5K0JA 4BYMA 4NMHA 4WEQA 4C20A 3HFRA 3E2IA 3LXUX 1C29B 3WYDA 4IGEA 4O2RA 4NFHA 2R7NA 4RFSB 4S04A 2TECE 4NENA 5KUTA 3KQPA 1JIIA 2DYKA 3AF1A 2A58A 1H5NA 1V43A 2CE7A 3OX3A 3L8FA 2C4KA 2QMUA 1FSSA 4DM4A 4P83A 1JHXA 4Z1OA 3OLVA 3E9NA 5J23A 4MPTA 4N7BA 4ETWA 1P18A 3O8RA 5JFOA 2O2ZA 1A72A 3DFUA 4MIOA 4JP1A 2C9MA 4MCHA 1X87A 2QE7D 3VYTB 2NTNA 2IVZA 5HZHA 1E6UA 4UM9B 1OYYA 1R6UA 5MN6A 2I62A 3KKEA 1JG2A 1KGSA 2XQKA 1EVQA 4GRIA 1LFDB 5TV2A 5JMWA 1CEEA 3DS8A 3ZDCA 5BV7A 2G7MC 2YW2A 1NRJB 1NAHA 3CGWA 1V8FA 3RSZA 2PZBA 1CK4A 2C7QA 3LE8A 1NOIA 4YDHB 2YS6A 4CIDA 2Q1WA 3GLUA 3AILA 1G8HA 4PO1A 2E5LB 4MVJM 4OHUA 4EJ2A 4EO9A 2KE5A 3L5OA 5HKKD 1M2KA 2H4YA 1IPHA 1E3WB 2VXYA 3D4IA 3GFBA 4KAJA 5B7QA 5KYNA 2CLDX 5BPHA 1F8YA 1QHIA 5BT9A 2JFUA 1OF1A 4GI3A 1R6AA 2L82A 2QJFA 1Y7PA 3AHIA 1LQ2A 1RMTA 1KIFA 1X14A 2KS6A 2WUFA 3JZIA 1BRTA 3RM3A 3VPBA 2VJKA 5C3UA 2YNMA 1IHUA 3MT8A 1V7ZA 3ABRB 3ST7A 1OFTA 1ZMBA 2OECA 2EJCA 1E3WA 4PQRA 1UADA 3E6AA 3WKAA 2KMLA 3RC1A 3UAZA 3WJ2A 1Y5IA 3VC2A 3LIIA 4YQYA 2O8EA 1II9A 5TJHA 4V0LA 3BXGA 5A7FA 1UT8A 7REQB 4W5HA 2RJOA 4PZPA 5JSQA 4KTVE 4DDMA 4FEEA 4R8LA 4G09A 1UBJS 4DQUA 3ICVA 4QOIA 5AK4A 5DT9A 3N8DA 1Q7CA 4W8GA 3OESA 3LY9A 2ACKA 1ICIA 4YJ2B 2KSQA 4H3SA 4PYNA 4HB2A 5CR9A 7REQA 1EP1B 1RQXA 2XYHA 1SG9A 2TYSB 3HUTA 4IJVA 4UHDA 4XDYA 1OFVA 3PDIB 2Y4OA 1KMQA 3PZRA 3RSGA 3EF1A 3SXUA 2JGRA 3RIMA 1PJTA 3AF0A 4FI3C 4L16A 3ZHSA 3E7FA 4U4AA 2M1ZA 2QE7A 3ASUA 4DC0A 2ZYVX 4RANA 4YJ2A 1BDBA 3GEDA 2VUHB 1XFAA 1YZLA 3I5AA 5SV2A 1QRDA 2QAGC 3DL0A 5EE5B 5F64A 1F3OA 4TS3A 3O4IA 5G3YA 1VMIA 4J6FA 2FUEA 5AVYA 1TVEA 4L3WA 1FTNA 1S3FA 3RS0A 3TDKA 4YP0A 1SZPA 5IF3A 3G23A 3V6MA 1DKLA 1M5UA 2ZSEA 2YTZA 2XKBA 4XAQA 4BNIA 1JQKA 2QUAA 1CHDA 1UZMA 2PU5A 2WZBA 1M2GA 2JH9A 1E1MA 3NTLA 3VSDA 3JYOA 3FCAA 2GM9A 4U2BA 4XUCA 3VJKA 4DA0A 4P8RA 3M4JA 5HKKA 2FP4B 3IP8A 3Q2IA 2V74B 2JD1A 3HMKA 3UUFA 3K96A 3KEFA 3SJBA 1XRMA 1LV8A 1T9KA 1E2BA 2WJ4A 3NO4A 4Y98A 3CZMA 3ZWNA 3AIMA 1TXGA 1IZYA 3QF4B 4LJAA 4P6VF 4Q47A 2FP4A 3KOZA 3PIRA 1ML3A 4UM8B 5JCJD 3KTAA 3RFUA 1GZSA 2ZYWX 3FJOA 3QXSA 4UJ3A 2W2MA 3BOSA 4PZYA 1HGXA 4EGQA 1VLMA 3FSJX 3BDVA 1UMCB 1KBQA 4WECA 2OV1A 1BMFD 3S1SA 1DO2A 1ZUD1 3RYHB 2REXB 2DPGA 1CRWG 1WXWA 1I24A 1RLJA 4R1OA 4FX5A 5EQFA 1JBQA 2Q3DA 3VU3A 2AZ4A 2WPNA 1F9AA 1PWHA 1U7UA 5FTNA 1JJAA 3BB3A 5L7WA 2PUDA 3QFHA 1V9CA 3HB1A 4TYNA 1VSTA 5LMCA 1PWYE 4KZKA 3G7UA 3B48A 3IPRA 1BG6A 3LQKA 3NUGA 4HDNB 4JENA 3SX4A 4AMGA 5BVGA 4HLNA 4HYYA 1Z4NA 5EFZA 3RYHA 3Q98A 4Z4CA 4X97A 1WLYA 2DE0X 3QF7A 4KK4A 1E6MA 3UJBA 2LCFA 2GA8A 1YK1A 3D4NA 1XTIA 3CWCA 1CUZA 2ZTUA 3MM4A 1FYEA 1RZRD 3PXCX 2GN2A 4F97A 4LG1A 3M7IA 2F9LA 3O21A 3QLUA 5DASA 1PP4A 3TF5A 1LH0A 3L40A 4TROA 3WLIA 2XVMA 1GUBA 5LP6C 1LLDA 1PV1A 2CSUA 2XYQA 4MGEA 4XGQA 4F04A 2M1XA 2GHIA 2ZCJA 5EWLB 4DA6A 4ZDIA 2IYUA 4MVJA 3JU3A 4PE5B 5E2IA 2C95A 4DFDA 1QIMA 5JADA 1TZBA 1XQVA 3CLSC 5ERYA 3OLXA 4X94A 3F7OA 3GCWA 5C81A 4KQIA 3UJCA 4LDQA 2VWPA 1S7GA 3JVEA 2EGHA 4BFTA 4XWOA 1V8ZA 5E4TA 1MJGM 2F67A 4XQEA 1E4EA 1V95A 1R8QA 1RWOA 2VNKA 5HZKA 2C2HA 3N05A 3OMWA 5IT9A 3EZ2A 1VKNA 2H1VA 2GM3A 2XNDD 4K2HA 2HSDA 3OKFA 4Q3CA 4Q12A 5JRZA 5JZOA 1WBDA 1ATZA 3P9IA 2FGKA 3MLAA 4L1KA 2HRQA 5DFAA 1A5ZA 1EUQA 3W2HA 4NAVA 4RH1A 1I51A 5JECA 4MV3A 3ME5A 1YONA 2XTZA 3EG9A 1SCIA 3FWKA 3KYBA 5B4UA 1V4BA 5EG5A 3LFTA 1N5MA 4QSHA 1UDAA 4FMBB 1Y5MA 3A1TA 4E5PA 1QFJA 3O3MB 4GGPA 3DFZA 4U8GA 2VHQA 4GECA 2JFQA 3FFTA 2G0AA 3BH0A 1EGVB 2CLLB 1Y4SA 2GT1A 1HNWB 3UB2A 1H05A 3VO8A 4BWVA 3D0QA 2VATA 4FGWA 3RNLA 4EHIA 4YI3A 2FRVA 5F1YA 3KWMA 1P0MA 4CLDA 5LXTA 2BTEA 2OCGA 4QYTA 1RAEA 3Q7IA 3T1YB 5AXDA 2IKSA 2ORIA 2QR2A 4FOSA 2F90A 1BHJA 1VA5A 3RC9A 4CL2A 1XA3A 3UUEA 4DEXA 1NW6A 1OR8A 3RJMA 3V8QA 5LQNA 4DBLC 2ZLBA 1DQRA 3LWDA 5JXJA 1DJMA 2FDXA 2AJBA 1MZPA 3ZVRA 1KOJA 5AOBA 3CX3A 1Z6PA 1G0OA 1E59A 3L5KA 1U0FA 3DFFA 3TSCA 2P7HA 1X7ZB 2FEAA 2WTEA 3ZWDA 4AJ1A 2IY7A 4MOWA 2HCBA 1U02A 2J08A 4DDHA 3WL6A 4FZVA 3TPCA 3NBZC 1H3EA 4PAQA 4HDMB 4WK4B 1YVDA 2LWIA 4GSLA 4FQ8A 3C14C 4OHXA 5CW1A 2FDCA 3OQ1A 5C1PA 3V9AA 1GZ7A 2JFBA 2O2DA 4BTEA 1X7ZA 3RC2A 3P1JA 3WZLA 5B1YA 2AXQA 5EN4A 2GHRA 3OPQA 4U9UA 2WSIA 4HB0A 1EM8B 3QHQA 4JT4A 3VYSB 1E7QA 2WVGA 4L15A 1T2UA 2A5GA 3VNUA 4HDMA 3DOOA 4JC0A 2IHJA 5L40A 1JHRA 1RHJA 5TDHA 1Z4JA 2GD6A 1V1MB 3EVZA 3WGNA 1U3GA 4G2TA 4WLOA 4C7VA 3RYCA 3GY0A 1AKEA 4HXYA 1RC8A 3KB8A 4FFLA 4XZ3A 1SIWA 4CIWA 1N57A 1UUFA 1RXVA 3PEWA 2LD4A 2XB9A 4GBMA 5DN9A 4JLWA 1ZH0A 4M38A 1Y7IA 4HWOA 3M4NA 3M49A 1CJUC 3UUWA 3ZVLA 4YVFA 5JBNA 3JV7A 2OCKA 5AHKA 2QAGA 5F1KA 3BT7A 1J2RA 1XTKA 3MLEA 1YB7A 4JD5A 3NOVA 4X71A 3ZN2A 5BSWA 3CH7A 1CF9A 1C3EA 1T4GA 2HA3A 3MMNA 2QTTA 4OU4A 4H16A 2LIVA 4B5LA 3TKAA 4BZXA 3K5WA 3G68A 1X70A 4G0NA 4ZMBA 5LA6B 4YBZA 4BNZA 3UGQA 5JQGB 4ZOEA 1XQ1A 3EHEA 2XJ4A 1J39A 2Q6IA 1P3Y1 2NZ2A 2QUJA 4O1HA 2CEKA 2YWHA 5T6MA 4AP5A 4UC0A 1MEJA 1OU0A 3N2IA 4UZSA 4MR9B 4BNTA 5I01A 3IVCA 3WXBA 5LA6A 3HL4A 3AFHA 4IHKA 4RK1A 3JQ8B 1YUBA 4L0MA 3BFPA 4BB0A 5JQGA 4MZXA 4F60A 5IX8A 1PE0A 1XVAA 2PRJA 4NP6A 5HDBB 3JQAB 3ZCVA 1M34E 1YMVA 5F5XA 3QGMA 5ALTA 4OHFA 1JEYB 2VJMB 2B7CA 3A6PC 5LFAA 4MR9A 4OUDB 1ODJA 2C5GA 1P0CA 3GXBA 5COQA 4EO7A 3LP8A 5TARA 3ITEA 2ZDQA 1KZ1A 3UWSA 4F96A 1MJGA 3U4AA 5BQXA 4MDEA 1J5XA 5D86A 3JQAA 2YJ6A 3AUFA 2RGEA 1AKWA 4J0JA 3LH5A 3MGCA 1LUAA 2I67A 4CCWA 2H7CA 1GRCA 1SKUA 1OV4A 3GFTA 1XA4A 1FEZA 3BL6A 3CLUD 3DOUA 4OUDA 1KFKB 4DIFA 5GY7A 2JC3A 3IULA 3A9VA 1QM5A 1QHXA 2JEYA 3V2GA 4L73A 2VPTA 1N33B 5TT1A 3ED1A 2ZE6A 3K7EA 3VAAA 1EUZA 3FR7A 5CB4B 5LP6B 3TD2A 3UKDA 5HOEA 4S3MA 2AG0A 4D82A 2ZU0C 2JI9A 3B2QA 5SYNA 3TQIA 3T1OA 2GJ8A 1ID1A 4WH0A 1UAAA 4IIVA 4N82A 2PSHA 5A02A 1QG0A 2AYZA 2I7TA 5EGNA 5EP2A 2IIBA 4LJYA 5LP6A 2ONKA 3FCUB 4NI5A 2J3DA 4KJXA 5SZIA 4BE7B 3GT3A 3U7FB 2E3JA 2XOKD 3MINB 4IXDA 3RSSA 1GPWB 1NASA 3HBLA 1KKMA 1E1LA 3DEAA 4LVOA 2QD2A 2Y99A 5CCXA 3VH1A 1U8TA 1L8AA 2AJDA 2ZR8A 1JTEA 3F6SA 4MW5A 1JQLB 1M10A 3HM2A 4NV0A 4V2IA 3SK0A 5FADA 3VYRB 4D0LB 1PBTA 1Q2UA 1E5TA 4Q9IA 3GRCA 1GJRA 1N7JA 4LJLA 2AUTA 1G8SA 1ZGHA 3D9QX 3ETDA 3R5HA 1OH5A 2B30A 1N0UA 1LX6A 1DB3A 1PJZA 4ZOLB 4ZJUA 2CD7A 4FYKA 1I7PA 1NA5A 4UAVA 1OUMA 3FOAA 3D02A 2FPLA 3IQFA 2ZATA 1Q50A 5ITZA 5L3VA 4ENVA 5K8VA 3F96A 1A97A 4WI1A 3FXAA 4BNJA 4GXTA 2F43B 4E70A 2B92A 5F21A 2JZCA 1NVDA 2LCQA 2LCIA 3L2OB 4U8HA 1FJXA 1YV9A 5C7YA 1THTA 3IXMA 4XI9A 3QVUA 2C5FA 4D6XA 3MK31 3LUFA 4ARAA 4OQXA 2PX4A 1YQXA 3L02A 2GN6A 2P67A 1U7XA 3CB2A 5E3JA 4P4UA 1GNRA 3LHDA 4G41A 1J8MF 3VGPA 3TGLA 4Z3OA 4RORA 4HNHA 1RT9A 2YUIA 4L4YA 3B3JA 2WYHA 1LDBA 1W4ZA 1EAYA 3GMSA 2R6JA 2GESA 1OQAA 2R6CA 4BUCA 2J3HA 3KJIA 2DFLA 4X7MA 4IRMA 4YV2A 4JYPA 3VV2A 4B87A 3V4SA 5HHTA 4JLNA 2A5JA 1CNFA 4ZDJA 2NYAA 3PTAA 1Z63A 1RFLA 4MUJA 5CAEA 2FOXA 1SXJC 1MLDA 3UXEA 3LPMA 3T4XA 4XVUA 4RNDB 4A5OA 4MGKR 1PNOA 2E4XA 4GEGA 3R7DA 1B8NA 3GLHB 3L7BA 3RRMA 4MA0A 3OF2A 2QSJA 4D0NA 1CXZA 4H31A 2GARA 2XOKA 4UUOA 1E2MA 3G9UA 2PSJA 1T9ZA 2JASA 4Z6KA 2OE2A 2PYDA 2EZTA 4OV6B 3HVHA 3K1TA 4YP1A 2JLXA 1CJVC 1G8PA 3QY9A 1SUCA 3FFBA 3IR6A 4WN3A 3QVTA 1T13A 3KHSA 1AOXA 1Y9ZA 4U3JB 4Y8VA 1SVSA 1WUIS 3KVYA 4R7GA 2Z2XA 5FT9A 3RRNA 1WAMA 3IJ5A 4C0XA 4K8RB 3MMSA 5AESA 1NUUA 3LSYA 3HB0A 3WNDA 4DCTA 2OMEA 2REOA 1RPJA 4XLZA 4H17A 3MEQA 4DL9A 3NUZA 3BWXA 4YBRA 3FNFA 4U3JA 3EF3A 4RVGA 2G9UA 4EFKA 5EJ6A 2A5DA 1OBCA 4B84A 1ONNA 4UXIA 2BH2A 1U0RA 2IPXA 2ZBPA 1U3CA 2VRCA 3HU5A 1KC1A 3IBFA 3MIIA 1IAVA 1CUIA 4MWZA 4XJXA 5IW8A 4I36A 3TCXB 4N48A 1AS0A 1W29A 3FDZB 4RZIA 1VRVA 1DC3A 4FOTA 1FL9A 2MYUA 1LZLA 3MWKA 3G0GA 3ORQA 1RU3A 2OBLA 4G65A 4RWZA 5EE1A 1U11A 5JAPA 3R6TA 2O2YA 3DXFA 4EA6A 4R1UA 3AJ8A 5FNVF 2QPAA 1Y0BA 2Y1WA 4IIUA 3A8TA 1E1RD 3H5VA 3GLFE 1NR1A 2AC4A 1N2CB 1QX4A 2VDUE 2WWFA 3PE3A 3B13B 4H0CA 4U5XA 1A82A 2QLFA 4YRAA 3TX2A 1R9NA 5TXGA 4BC1A 2XAUA 2O0HA 3HXPA 1V11A 1XEWY 2H1HA 1J24A 4MWOA 3MS2A 1KJQA 1W76A 1I80A 2EF0A 2GYVA 5H8WA 1M74A 2NVWA 1OWPA 1N2CA 5K51A 4DA8A 4FX2A 4PWYA 2AVNA 1WUKS 1PGNA 3QFFA 4OQDA 1OROA 1R3UA 4MI1A 3QJGA 3UOWA 3ZDFA 1BEZA 3TZHA 4TZTA 1WB9A 3K9NA 2IY8A 3E0QA 4H3KB 4Y1RA 5C8YF 4GGOA 3K16A 5JAHA 2Y0EA 1WY5A 2YJTD 3H7IA 3BHMA 1CUEA 3BXFA 1TE2A 3EEYA 3BMOA 3VHXA 3OKCA 1AGNA 3KYJB 3D3JA 4ETNA 1CKEA 1K63A 3A2MA 1DO8A 5FFFA 5LOVB 1CY2A 1ENYA 1H4QA 2AL7A 5J58A 2GPJA 1U3FA 3E7PA 4V2UA 4UEWA 3DJYA 2FYTA 3C2QA 2OXRA 4Q7MB 1Y9DA 1X8XA 3IC5A 2HV8A 4I6EA 3SLRA 4AJ9A 1NKVA 2BEKA 2BKLA 4Z51A 3K0SA 1EVIA 1GUZA 2EP7A 2RHWA 4FSDA 4QULA 4Y6OA 1E2UA 1D0IA 2YN4A 5DT2A 3KUKA 3CKLA 2JVJA 3NHMA 3ZXIA 4HFRA 3C8DA 5BSUA 4B33A 1DV2A 1FX1A 5LOVA 5BWCA 1WUYA 3W78A 1NP7A 3WFZA 2AR7A 3IP3A 4GE0A 4MDFA 3AW9A 3TECE 1H4SA 1UEJA 1SQGA 2RJNA 2AYXA 2OQIA 1N7IA 2B5OA 2R2GA 3CRRA 3FIJA 4QBFA 4N9WA 3RF6A 4CRWB 5H4GA 1JG6A 2R4UA 3H1GA 4HLQB 1HR0B 1VPVA 2VRBA 2XYGA 2EZUA 3FKSA 1PFUA 1SXJD 2YV4A 5JYBA 2IZ0A 3GV0A 3HEBA 3WIVA 3ERCA 1XMOB 3A9UA 4MWDA 1JQAA 4HVCA 2OO7A 3PFFA 4IQGA 1YOVB 1LFAA 3AU8A 4W1RA 4D8UA 1E1RA 1L4NA 3I2HA 4KRXA 1O96A 5K0TA 2UZAA 2B61A 4QUDA 2HDHA 5CLIA 1V9LA 2GXUA 2Q5LA 3F2VA 2CV2A 4LF5B 3OWHA 3HZHA 4CXMA 4KACA 2ZJ1A 5FORA 3H2ZA 3BDIA 4NHEA 1C1XB 4BV2A 4C88A 5CEFA 2I6GA 4S1WA 3CF6R 3AXSA 4OPMA 2CCJA 4IMRA 1CP2A 3KKMA 4EHDA 1UFVA 2NYUA 1RRKA 2H2AA 4RLHA 1G18A 1KJ9A 3EIUA 2RKWA 2PUAA 5KNCD 4QKQA 1G6HA 4B3FX 4QASA 1GPBA 3HUFA 5AKXA 1CJMA 9GPBA 1C1XA 2V5VA 4ZZ0A 1M1XB 4RELA 1QGAA 3BTUA 3HO8A 3L8ZA 1V3QE 3MOIA 1T6XA 3NJ8A 4P38A 4ZJPA 5B6IA 1CVIA 1Z5VA 4Y6QA 1DQPA 1WO8A 2PD3A 4NMWA 2PZEA 3Q4GA 5SZJA 1C7ZA 4EYKA 2QL9A 3EGWA 1GGHA 1EUCB 2YL2A 3LBHA 3ZZUA 4BQPA 1XYVA 1A9YA 2YHUA 1OH8A 5J5AA 4FB5A 3AKYA 4CIYA 5LKRA 2A1TR 1HG0A 5CEEA 2V1UA 3B1FA 4BP3A 2L2QA 5T6BA 1P31A 1V7CA 2ORWA 4RKQA 2ZB3A 1BDHA 5KIAA 5JBIA 2VHJA 2FZ4A 2PUJA 1RM5A 2QLJA 2ZSKA 5AM4A 1KPHA 1SPBS 1GGMA 1EFAA 3FZNA 3ORFA 4UEKA 1S2DA 1YJBA 3D3WB 5IJZA 5JAQA 2VPYA 1NMQA 4YB8A 1II0A 1AKRA 4ER5A 1Q1ZA 5ESRA 4WCFC 3KPUA 3U80A 4XSVA 4P5PA 3VTAA 1MPTA 1KHTA 4IICA 2HWWA 1GIAA 3KXKA 3QQPA 4ZXFA 1XTTA 2OV3A 2VDWA 1PSZA 3V2HA 3ITNA 3OZIA 1BH6A 3A3KA 1SBCA 3D3WA 2PS9A 3GB9A 3QKTA 2PKXA 2RK4A 1ZOOA 2RC6A 3DM5A 3KJFA 2WAYA 3K6SB 4CQNA 4PSDA 1O94C 3AF3A 3BCRA 3ZQ6A 5GZ1A 2RE8A 4OHYA 3A2NA 1YAJA 3DEJA 3H11B 5EE0A 4BEBA 5ADWA 4OHVA 4PZCA 5H16A 1GSIA 3EQ8A 3OTHA 1GSHA 3U6BA 3UCEA 4TS9A 1U0NA 1Q7EA 2ZYRA 3HLKA 2NT4A 2ZQZA 4BX3A 1SIBE 2GM5A 3E4DA 1YCHA 1A9RA 4BIMA 1ADJA 2HMSA 1A9QA 1GNVA 4X84A 3HNPA 1P3DA 2H00A 2GASA 2IOYA 3H11A 3IPXA 1JEQB 3F47A 4GM1A 5AW0A 2QRQA 3ASZA 5KNCA 3EWSA 2KBEA 4OIFA 1HE3A 1HLFA 1ZWKA 2IVFA 4BNFA 1SVIA 5IAKA 3OOJA 3DFKA 2F1JA 3BD8A 3IJRA 3ZD7A 4LF8B 2Q0QA 2ZJ3A 4MMYB 4RF5A 1QYCA 1V3VA 4WNIA 5DSTA 5AW8A 2WF9A 1TCAA 4TSFD 1DAGA 5DN6D 1HFWA 4W9MC 1P80A 1G20E 1JQ3A 1ZL2A 1JEQA 1M6WA 1TKCA 1PVOA 2WYWA 5IBRA 1AGXA 1ENOA 1N6PA 1I0IA 1BO6A 2RH5A 2FVXA 2R66A 1DEHA 1E4YA 1VYHA 2FZ5A 4EUKA 2WU3A 4D25A 3P2MA 1YMUA 4RF3A 4AJKA 2WDPA 3X2FA 1GY8A 4RMNA 2QVXX 4TS1A 4Q1FA 3DFIA 4XSGA 4TZKA 1K98A 4XFDA 3E53A 4IL5A 3FPCA 3UB4A 1YJ8A 2JIRA 1SC4A 1MX3A 3BZBA 4CGZA 5JNSA 2C3MA 4QPJC 4WKPA 3KQSA 1E2EA 4XUGB 4W5QA 4INJA 3KSBC 1SQ0A 2WMDA 5AJXA 2GAFA 2QV7A 2ZUWA 2HQBA 4QT4A 5JD6A 3ECCA 2C61A 5DYGA 1ECCA 1SHJA 3GVHA 3M81A 3CUYA 1H5UA 3R6LA 4H1UA 4LV6A 1GPNA 1Q1GA 2XMRA 1YASA 1MHTA 3WLMA 4BL5A 4NONA 2X5NA 2G83A 3C87A 4GXQA 1YS7A 4J7CA 4WE3A 3TQOA 5HF8A 3VC1A 4E1AA 3FNGA 1C8KA 3M6IA 3GLQA 2J9FA 2XR1A 1BD4A 3SSNA 5ELXA 1B23P 3L46A 3PQ8A 1G5RA 1DJOA 3ONFA 1RMQA 4RIEA 4D8TA 2DBYA 4ALLA 1GL6A 4R9RA 4RQTA 1VIVA 1MPXA 2F9MA 4YCDA 5JZVA 1RRFA 2NP6A 1C9YA 4OXRA 3ZHQA 2ZB4A 1VJ5A 5B58T 3TXXA 5D1HA 1AHIA 3OFND 5LBIA 4KW7A 5G1PA 3OPVA 2RCYA 2Q6VA 3GEPA 1JG3A 3JQGB 1XAIA 4HF7A 1U0JA 2H31A 4K46A 2IYPA 3P19A 2HJSA 3NCTA 1R8YA 2NOAA 1I3OA 1GTRA 5DHPA 5JSYA 2AVDA 3I9V6 5JT1A 1W1WA 4HDKB 2IYXA 2D7JA 2QVCA 3ZD8A 3J81A 1DIAA 2RFLA 1DIOB 3QEMB 1CDEA 1E60A 4X93A 5KDLA 2FQQA 5JC8A 4AAYA 4F3RA 2R0QC 3JQGA 3OJOA 4ZQHA 1YTLA 2M32A 1P5ZB 1B14A 1GT91 2FW0A 4MRRA 4MI6A 3EPJA 2AI1A 2DFPA 3HCCA 3PHIA 3FUTA 2PIAA 3AKCA 4B7UA 4PCAA 2RGAA 4I9FA 1AT1A 3DDSA 5G2OA 4Z4IA 3C8ZA 1PSWA 5CLLA 5A62A 4EATA 5EEGA 1KRWA 1O94D 1XQXA 2H48A 2NO1A 1HT2E 2YHBA 1P4SA 4I1UA 3ANLA 1NV8A 2WJGA 2ENUA 4DA7A 3Q3JB 5AW1A 3TPFA 1FYDA 3I2IA 3V5NA 2REBA 4C07A 2VOEA 1VM6A 4HATA 4WW0A 3F5QA 4IDOA 5JJLA 4TMZA 4PLTA 3MQFA 3K05A 2GUWA 1FA9A 3FFAA 3HDJA 3UT5B 1NJSA 2WA1A 2WB2A 4JI5B 2CNBA 2WKRA 4NV1A 3W5HA 1JAHA 2PMEA 5ES4B 1YK0A 1GRNA 3A1EA 3SYRA 4DUGA 3WI7A 3ZC3A 2W48A 1I7LA 2H1LA 1RQLA 2EX0A 3N8HA 4LYYA 5HQTA 5JCOC 1XQ9A 2C77A 2VUTA 3JWPA 1YRYE 1C4XA 4AZSA 1J23A 3ETGA 1U0TA 3UT5A 5LIPA 4E5VA 1Q0TA 1L1EA 3FN4A 2Q5OA 821PA 4M76B 2PYZA 3W9UA 4DTCA 3IIIA 2CLIB 3OAAA 3ENNA 2WM9B 3JD3A 1P7CA 2F7SA 2J41A 1W5FA 5BO5A 4BU0A 4UOEA 3KSAC 1DCTA 1NVWQ 4U2DA 4ZI7F 4NYIQ 4PWZA 4B2IA 2QP4A 2J0UB 3VKFA 3BPSA 2OM6A 2P9EA 4Z53A 3H5IA 3I53A 2R5WA 2PXCA 2O23A 2HD4A 2IP1A 2CUZA 4RD3A 4WERA 4DLSA 3NC0C 3JD1A 4U7TB 1TZMA 4QXOA 3C3BA 3F98A 4P0PB 4DARA 1M75A 1UF9A 3MRVA 4CCAA 3GGOA 5AK5A 2Y67A 4ZU3A 3QXJA 2WZDA 1B0ZA 2J0UA 5I7SA 3WGLA 5H82A 4WCFA 1BOOA 4Z9XA 5IF9A 5L53A 3QX3A 4RSHA 2OAGA 2WJPA 1X19A 4OTZA 2B4KA 2X3YA 5FYDA 4DGSA 2IH5A 3AJAA 2QQ5A 4UCFA 5E4JA 3AVYA 1CQWA 4M86A 4EI9A 3SBOA 5FIUA 2H0RA 3E03A 3RS9A 1O94A 1WE2A 1XN4A 4CDRA 3AUYA 3QHAA 4F6CA 5P21A 3LUAA 2IPMA 1F12A 2Z4TA 1BCRB 2J3KA 2FEWB 4HBZA 3SN6A 1R10A 1S01A 1PVDA 4KQ1A 4I50A 2TMGA 3H6GA 4JN6B 4KR0A 2BW0A 3CUKA 5D6OA 5J2UF 1IUOA 2CVOA 2JFHA 3DLCA 4DA9A 1WVMA 4Z7OB 2Y6UA 1WUJS 4Q4AA 3TAUA 4RM2A 1YDMA 5MFPA 5EE9A 4U6NA 2GZSA 1AURA 2QVLA 4L8FA 3VR4A 2FMTA 4RJIA 3N8GA 4OQLA 4AU1A 5GZ6A 1HUQA 2G6TA 4YCJA 3VZSA 3T61A 3ZLTA 2OENG 2P4SA 2AFVA 3GU3A 4WV3A 3ZE8A 1GDHA 3L6UA 1CUUA 3LT2A 2ECOA 4ZWNA 5IKEA 4M7RA 2PS1A 3FVQA 2GD2A 4MMZB 3MGKA 3WBBA 3ICWA 3KCNA 3A31A 1ZOIA 3FNHA 5TRTA 4MVXA 3WFIA 4ZYWA 3BE6A 3DPUA 1DDIA 4R54A 2B7BA 5DM1A 3FPAA 3MTQA 1HRDA 2NYRA 3FTDA 5TMDA 1EBFA 3ZY5A 4E5YA 5TY0A 2YZ2A 4JJAA 4QLBA 5JSZA 2HR1A 1JNYA 3NEYA 3PJGA 5K0LA 2IX3A 1RYZA 2DG2A 1ULZA 1IK4A 4TMTA 4YT5A 3DTTA 4JI0B 1EINA 2QYOA 4MUEA 1H2HA 3OTQA 1XQWA 3SIWA 3LY5A 3RUEA 3R2JA 5E2AA 2J85A 3R3ZA 1TQDA 4HQNA 3RS8A 4KZPA 1VCOA 3PXUA 4C4YA 1YS9A 1KEKA 2WD8A 5TGZA 4F3TA 3ZWPA 5AVZA 2D3TA 3I6IA 4X3CA 2C7VA 4IIJF 1LDNA 2PX8A 3AB7A 3NGXA 4AX8A 5JEDA 1X7WB 1YQWA 1FYVA 3OQIB 3OOSA 1W30A 5I7WA 2O8DB 1KHHA 5IFKA 4JC8A 1M2NA 2AHRA 1DTWA 2H2GA 1RBZA 3LUCA 5CA1B 3BX1A 3GDWA 3RTDA 1A04A 2EQBA 2H6EA 1ZZGA 3DC2A 1AK1A 4WKCA 5GP1A 3F4KA 3S7ZA 3LI2A 2ZWPA 3LOPA 1FFHA 5DGHA 3U1BA 5CIQA 1QCDA 1IN8A 4F9EA 1MIOB 1X7WA 3OQIA 3QE4A 2YRWA 3H0KA 2VP5A 5CHYA 1ECPA 3DOCA 4G9EA 2C84A 3W4KA 1I1HA 3N0XA 3ZNNA 5CA1A 1V16B 2OSVA 5EJ7A 2ZUEA 4GQBA 4BMZA 4FQ7A 2IV2X 1UWLA 3LYAA 1DRJA 5F5LA 5LD2B 2DHEA 3ZWBA 4L6CA 4BAZA 2WHPB 1XMVA 1F0NA 3DQQA 5JOQA 1GILA 1MIOA 2GB4A 1SVLA 1OKKD 3GZJA 3I28A 3E27A 1AZLA 4DOMA 4Q3DA 4IV0A 1V16A 4DDVA 4LKOA 5EJEA 2YCBA 3TLZA 2H9IA 1FDOA 4FXPA 3ZIAA 4CN9A 2WT8A 3PENA 2WHPA 3AT1A 3LBNA 3M6MD 4QAJA 4NESA 3ZG6A 4DS3A 3SZ3A 4W63A 4U6SA 1OI3A 4M8KA 1EK1A 1ULSA 3EF0A 4PC7A 3WNZA 1CFZA 1CYEA 4MB0A 3C48A 1CIVA 2H2DA 4J91A 5T4HA 3T7IA 3ZHZA 1Y6JA 2OCPA 1YVEI 2JRLA 3ORHA 4RABA 5ETJA 2BEUB 5REQB 1Z5PA 1AKYA 1JHYA 4COOA 2Q46A 2HDNB 1T0BA 3IUJA 1HYBA 5LKAA 4GOXA 4P7FA 1ZK4A 4TX1A 5GGYA 2VG8A 2EKLA 4RTLA 4OB7A 2VWQA 4TKUA 5B7PA 4BCCA 2YJ4A 5G0WA 2P62A 4OHCA 4E32A 3TLKA 5ANRB 2ZM5A 1M0EA 2UVQA 2PEZA 4L9RA 3PC3A 3WYNA 4B40A 2J9YB 3SHFA 2BEUA 2AFHB 2EKDA 3KR0A 2YBEA 5T8KC 3T8YA 3WIDA 4EHKA 1I4LD 3WIUA 3AP3A 3BRWD 3DZDA 1W46A 2Z5GA 1YZYA 1KJZA 3NHJA 3Q3IA 4LS3A 3TQSA 4C4TA 3HXQA 2DBVO 4L0CA 4MRPA 5JCOA 2VJQA 6LDHA 5K03A 3OOHA 3A7DA 3G5AA 4J29A 5EXSA 2UXCB 2MIIA 3D7LA 1PW5A 3UO8B 4C4AA 3H84A 2AFHA 4YT2A 4TVBA 2QJTA 3O93A 4HNSA 1QFSA 3P9SA 3IQGX 4DSZA 1SQSA 2IFTA 5DYIA 5EQJB 5I7OA 3UXYA 2QU8A 2YFQA 1DJNA 1E98A 2J3JA 1DSSG 1MOSA 2BD0A 2M6SA 4IHJB 4BX2A 2GZ3A 5T67A 3T0GA 3KSMA 4D2IA 3GLIA 1RLUA 1NVMB 1W87A 3NWJA 1A2OA 1I3LA 1TYEB 4P32A 2C0CA 5F7XA 3MUOA 1KSJA 4DYVA 1HDOA 3GX1A 4OB6A 3UC5A 1QIHA 1PZGA 1R64A 1T0PA 4LY0A 1Y5RA 2WU1A 3CCCA 1T3LA 4MPPA 3RAGA 4BCDA 4D4GA 2PZKA 2YY7A 2BP7B 3EC1A 4IHJA 1UOOA 4QHTA 1NX6A 1SPXA 3FSEA 2V7EA 5FHRA 5JVDF 3PEYA 2AD1A 1LVUA 4ABYA 4MZDA 4UXHA 2A9PA 3INNA 1ZP6A 3MJRA 4QL3A 2Z9CA 1XZCA 1M33A 4YRSA 1I36A 1PEYA 2BP7A 3JWEA 3KLBA 4PCVA 4X6YA 4POAA 1UEXC 1XOIA 4KXLA 4F2HA 1I0LA 5CX1A 3VX3A 4UNIA 4C3ZA 3D5EA 4DPLA 3GZTB 1S2LA 2WOJA 2WV9A 1CB0A 3C1AA 5KOHB 5DNAA 3MMZA 1LK7A 5JZSA 1E64A 2A59A 3F3MA 4HGQA 4JYBA 2F64A 4QDUA 4B83A 3ZVMA 1U6KA 2GKGA 3C3EA 3ONVA 2C54A 1E5QA 4GI2A 2KBFA 2QXYA 1OE0A 2ZIWB 4YJFB 4LSZA 5BURA 1SCAA 2ZRKA 3ADOA 3FY4A 2WYIA 2I2WA 1TMYA 5KOHA 3WBJA 4LVCA 2ARKA 1U4OA 3MGGA 2OHFA 3PCXA 2BUAA 3COJA 1T9AA 3SI7A 1S2GA 1SGWA 3A9RA 1COWA 3LLMA 4PIVA 1HNZB 1X9GA 4OP1A 3K2QA 3VTZA 1ESEA 3W77A 1EBBA 3TWOA 1CEYA 3EODA 5AVUA 4RQUA 1KK1A 5BXQC 2BKXA 1E62A 1JALA 1JWAB 3EWNA 1LLQA 3LT0A 1RYFA 3EDCA 4OBBA 4Y2YA 2BJHA 1U9CA 3C3DA 4DCVA 4JDUA 2AD5A 1XHEA 4H1VA 4NH4A 2BKUA 3UJ6A 4ZCQA 1RKXA 2EFJA 1X1SA 2VDRB 3I2KA 1D9ZA 1XZQA 2W0MA 1MN6A 1QFXA 1QK3A 2XYRA 2F1OA 1ST3A 3N39C 1NXOA 5CFMA 5H0IA 2WNSA 2ZWMA 2QORA 3N0RA 4WBXC 2XVAA 2H0AA 5ALUA 3RUCA 2HJRA 1C2YA 1F48A 3QWHA 3SP1A 4LMPA 4QT0A 3E61A 4TTVA 5DBFA 4JBGA 1E2LA 1B8PA 2QN8A 5FBHA 5JY6A 4LJSA 1EQ2A 1OI2A 1KR5A 2F1KA 1GVHA 3HKDB 3O8DA 1C7JA 2F8SA 1IXRC 1FPMA 4RGQA 3A9SA 3CG4A 4XWKA 4F4UA 3CPHA 3OE7D 3IA7A 5F78A 3EMBA 4D9MA 3LBIA 3I05A 2ZTLA 4JBXA 4QDOA 3W6PA 4F5DA 3JD0A 4ENTA 5FQNA 3FZYA 3GH3A 3HKDA 3IV6A 4TT8A 2WTMA 4OH7A 4AYXA 4JMPA 3M3PA 2GVZC 1N4DA 1TK2A 2JS7A 4F1JA 4KWIA 4AMVA 2XGJA 4M1EA 1EFKA 1LVGA 4HQOA 1WMEA 4KIWA 4NAUA 2QYSA 4CIXA 1SMKA 3BBPA 3NIBA 3EFBA 2CHUA 3CR7A 4LZNA 4DSAA 5E9WA 5KNCH 2G3YA 2VDOB 1F06A 5CTJA 3IOMA 4BFCA 3X2SA 5HX7A 2FNAA 4IFTA 5BSGA 1FLAA 1IN1A 1B42A 1UBFA 4AFNA 3K6RA 5CIWA 4CM8B 3O4HA 3V7UA 1E2GA 1IE3A 4Y2PA 5A4AA 4WDRA 5JPDA 4TLEA 1QHFA 1ULAA 3ANSA 1EP9A 1KAHA 3DBIA 5K3SA 1EA5A 2HMWA 1KAOA 1W5SA 2A30A 3FI0A 3PBKA 5BSFA 3E9DA 4D4LA 3ODPA 5EKXA 2D00A 3DE6X 4EABA 3TOSA 4OSOA 3R9XB 2F3RA 1G2OA 1YRHA 2N9UA 1UAYA 1B4DA 1VPTA 2RHDA 3GGDA 1X86B 2BY4A 3UYLA 3AL0C 2JJMA 2UYHA 3RADC 3HUDA 4DUZB 1QOPB 4JOQA 4Y2TA 2WSMA 4O2BF 2DTXA 2ZIXB 3NBAA 3PLRA 4EUSA 8OHMA 2XUKA 3JR3A 4XB6B 2L69A 4YLGA 4NYIR 3AFMA 4REQB 1Q11A 2BWJA 5C4MA 2OXEA 1BJTA 2O3SA 2YX1A 3LO8A 4ANFA 2GPAA 2WI8A 1WXHA 2FPPB 4GEKA 2XUOA 1QTIA 1K8XB 3JYNA 1KEPA 1GZ4A 1X0VA 4WLFA 1I30A 4M37A 1JHAA 5T8KA 3ZZTA 4EMUA 5I9IA 3H18A 3HBFA 4JQSA 4PBSA 4REQA 4GX0A 4BJ5A 1B15A 5B30A 1N5OX 1NBWB 3OZXA 4KU4A 5BYJA 1J8FA 3NHPA 4WWHA 2Y1XA 4N47A 2Q8PA 4CKZA 1DC5A 1WXXA 1JI3A 2VP4A 2YXEA 1T1RA 3TJRA 1TTQB 2B99A 3RC3A 4CT5A 2DBRA 4E11A 4E30A 4I1RA 4JNKA 2OB1A 3U1VA 3DXYA 4LOKA 1LDYA 5DHTA 4ETIA 4F4CA 1ZN9A 1Y3IA 4J1TC 4WVFA 4EB0A 2JCXA 1E20A 4NZ9A 2IYRA 4TTTS 4DPMA 4UARA 1Q6ZA 3UH1A 2D62A 3G2JA 3U44B 4MQFA 1GEEA 1XTQA 5BV2P 2QJWA 1V8OA 2D4HA 2Q1XA 1K6IA 2Q99A 5BSRA 4ZHQA 2Q2QA 3SSOA 4CF3A 1ZBQA 4MP6A 1FFYA 1LDEA 2X1VA 1C1DB 1TK3A 2GPBA 2O6HA 1R18A 3N7TA 4DEVA 4QBIA 2BHSA 3T1VA 2P2LA 2DEUA 1S3SA 2P9BA 3F0TA 5EHNA 4ZEOA 3U44A 1MB2A 1JBEA 2WMYA 2H52A 3A4YA 4GM0A 5CT8A 5DP2A 3C8UA 4S0ZA 1JSZA 2ZBGA 2JFYA 3JS5A 4BVLA 1XFDA 2CWDA 2RAVA 2ZIZA 3BMCB 3Q5EA 4W1SA 4CM4B 4IMJB 1U8AA 5C8VA 1C1DA 4QODA 4YYEA 3AWIA 1E1YA 4AKGA 1HYEA 1Y42X 2P2SA 4H4DA 5BQOA 1Z0UA 1CP3A 4I08A 2H1IA 5DGIA 2DWUA 4DRXA 3ER9A 3JZMA 1RW4A 3O8CA 5C1IA 1SUFA 4CM4A 3CU5A 4JS0A 2IBMA 3BFJA 1KL7A 1M8GA 1T25A 2GR9A 2RHOA 1NBME 3IUYA 4LDPA 4QAQA 3L7JA 5HIIA 2HIHA 5TR9A 4PLWA 1L5YA 4BVKA 4F11A 3R9KA 1DBQA 4GPAA 1JV2B 3KT0A 4RD0A 5FR1A 2IIQA 1NW7A 1ZCFA 2XT0A 4IX1A 1NW9B 3N2ZB 4AW9A 4ZYLA 2HUPA 2OO3A 5JNVA 2MSKA 2BL4A 2LGJA 2ZZNA 2FOIA 2ZEJA 2XHZA 1RRMA 1MC5A 1DV1A 3NHLA 4OLJA 2JLVA 5DX8A 2SCUB 3ZEIA 3MN1A 2WE8A 4NYJQ 2PMFA 1Y5LA 2A4MA 1GITA 3MOGA 2G0TA 4MS3B 1WMFA 1JYEA 2W6OA 3I58A 1ZM3A 2V7WA 4JXJA 4RK4A 5DK6A 2UYCA 3BWYA 4D46A 1RI2A 4HX9A 1K7FB 3WLOA 2B4TO 2SCUA 1XEXA 1E99A 4Z9YA 3EVAA 1Z6AA 3RFVA 3G2HA 1KA9H 2QT9A 1DWPA 4DW8A 4F72A 1JILA 2AF3C 1G8AA 4YRGA 3LECA 4BJ3A 4YPFA 4LYJA 2OCBA 1K5PA 3IGFA 5FAXA 2Q2VA 5B53A 4M1OA 2VZ8A 4B43A 4RZ2A 5BW5A 3WO1A 2TS1A 2QRPA 3LDFA 4Z4FA 4FFMA 1UZLA 3OX4A 2AZTA 4DLYA 4CMIA 1B16A 4R5MA 1Q0SA 2QRZA 3GUYA 3QE9Y 3TIGA 4MUNA 3ZY6A 5EIBC 4DEYA 1MD9A 1PS9A 3JXEA 2HY7A 1LNZA 4PNPA 1WDMA 4FDUA 1NVTA 4U2KA 4EBFA 4RZQA 1BN7A 1XCJA 1XP5A 2GNPA 2YVUA 3GLFA 2B9EA 1Y98A 1KBOA 1Z0SA 3KU1A 3GEIA 4LK2A 3FROA 3H5OA 4OHMA 4EHBA 3LCMA 1Q12A 4TWAA 2JZNA 2IHBA 1Q84A 2D8AA 3BJZA 2H5JA 3HB5X 3KAQA 4HB4A 1IOWA 1X7XA 4X5OA 1OFUX 1TJ5A 2RB4A 5DYWA 3SVTA 2AOTA 2ZT8A 3HBNA 4Z54A 2GWRA 1VJDA 1JDNA 4ZKEA 4AMYA 2V7QA 1OWLA 2W2OA 1BWRA 1Z2CA 3IXQA 5DYYA 2C2MA 4KLZA 3VZPA 4ROTA 1FFXB 4OL0A 1U2RA 2BPOA 3VR4H 1R88A 1K75A 5L51A 1RXEA 4B76A 3TSYA 4IEEA 1Q0PA 5BR7A 1M72A 2QR5A 1I4OA 2EIXA 2P2CA 2IXAA 1TX4B 1DRWA 5D3KA 5ALMA 1F5SA 4TLCA 1DG1G 4H4EA 3QUAA 4ZTZB 4KB5A 4YR7A 2VHCA 4X92A 5G0VA 4P54A 1X80B 4Y7DA 1ZONA 1KNQA 2GTPA 3EOZA 3DE1X 2HO4A 2XMGA 1FUUA 4XSHA 1AV7A 3PQ3A 2DQZA 3LPLA 3MUFA 2F3PA 1ZVQA 4A2WA 3VVLA 3M2TA 4TRRA 4QDZA 1X80A 2ZQYA 2JK0A 1FQWA 4JJ6A 5CNMA 3PSAA 1U8XX 2B20A 2D7DA 3TTSA 1U1DA 4WNAB 5I9MA 4MW9A 3VSBA 4HJXA 3WDSA 1BVYF 1IY0A 4MUMA 4UE3S 3ZWQA 4F2PA 1Z15A 2EHJA 2J9RA 3OLZA 3IEMA 2I54A 3IL2A 3BA1A 3A70A 3J7AC 3VYVA 3Q6NA 4DR5B 1FVXA 1FFEA 4LHZA 4W8OA 1EP2B 5F5NA 2DWPA 3ESXA 3JASB 4YX9A 1TM5E 2H2HA 3TN7A 4G8JA 4CLOB 5BW8A 5HS4A 3AQ4A 5FPPA 4K9MA 4NIMA 3BRQA 2D2XA 3DLBA 5I9SA 1Q6YA 1R4AA 1TCBA 2PTHA 3AETB 4YJ2F 1EVJA 4E2FA 3MJDA 2P9GA 3PWZA 2VNSA 1V1RA 2Q8QA 3QVKA 1YA6A 3KEQA 4J1TA 2HU2A 2CLCX 3GCXA 2O0LA 4JSTA 4IIFA 4X7BA 1FP4B 4R8VA 3GP5A 3ZQKA 4CLOA 4UDNA 2XSZD 1UH5A 4R81A 4KKVA 5K3FB 3D1LA 3GD7A 1IBMB 3C74A 2CHQA 3OC6A 4MRVA 4D3YA 5FB3A 4YXWD 5K8CA 2IH4A 1YIOA 3CKMA 4CV1A 1PYOA 4YRFA 3VDNB 3QU2A 1CPYA 3D0RA 2B7LA 1R2QA 1RJDA 3K1JA 4A73A 1FP4A 3U0BA 2XVYA 2I2XB 1ZIXA 4OHRA 5HCIA 4NHOA 5FA8A 5AMXA 5EWMA 5LZ2A 4HNQA 4NU0A 1GPUA 2UVDA 2VO1A 3H4IA 4M83A 5CRIA 4LOIA 3RS2A 4BQFA 1R0KA 1Z16A 1L4EA 5EIBD 4YTEA 2BDTA 1QRSA 2EZ9A 4M60A 5L3RA 2CNKA 1IQ0A 3REFA 5JJBA 1XGKA 4I9NA 5BQFA 1L7OA 1XLUA 2HQRA 3BD9A 4TV9B 1UKVY 2Q29A 3NTOA 3FUCA 5IXYA 4DR7B 1KO1A 1MR3F 3OUTA 1T91A 3MYYA 3ZXUB 3STXA 1ZMRA 1UFRA 4XDZA 3HRHA 4DJEC 2J1LA 4IQ4A 5DHAA 3HSSA 2X5KO 2O5EA 1ZOLA 3HDVA 5JC1A 1SKMA 4QEDA 1IY1A 4JJKA 4TV9A 1C50A 3PR2B 1KAMA 3FBTA 3SBDA 2ATCA 3AUAA 2Q5FA 4MDYA 3ZCUA 3OUZA 2X6QA 2FWNA 1QG6A 4ES6A 1JWBB 4INOA 4W4TA 1VSQA 1PQYA 1S3GA 3MRTA 3QPCA 3S5UA 4DMUB 4EMBA 3MZ0A 3P9YA 4XOIA 2X6TA 4IINA 1J0EA 4XRRA 1MTOA 4TTAA 2RSLA 1O97C 3L8YA 2GPWA 3I6BA 1P0QA 3GZNB 4X6XA 5FI1B 3SFTA 4EF5A 3UJNA 4C3VA 3HKCA 3K1YA 5AJHA 2HU5A 4O1MA 3FVRA 3FG9A 3A36A 5CM9C 2I80A 4Q00A 1RWKA 5ARCA 5B2ZA 1TRKA 4BFLA 1EVZA 3BWDD 1G291 4MVJF 3HACA 4Q24A 1KI1A 4YXWA 3WNBA 2ZB2A 4ZRNA 1L5HA 1QFMA 1ISFA 2YIDA 1GSOA 3E3AA 3GZNA 5DRTA 1ZI9A 5KQRA 2WOOA 1JECA 3F3SA 2V6IA 3I12A 3AJDA 2OVFA 3OE1A 4D1YA 4TKVA 4KWCA 2GVNA 1N2BA 4E07A 3H2BA 2PMKA 1ZJ4A 5FI5A 4NJMB 3VVCA 1THGA 4G36A 1MAAA 3JD2A 1XVLA 1GLGA 3CO5A 1GG5A 1E7WA 2WF6A 2G88A 2XLCA 4FS8A 1NUQA 5HRAA 3TCKA 1IM2A 4K2AA 2R48A 4MPDA 3IBYA 4F8EA 3QEBZ 1P7YA 3HCEA 3MAGA 4HRYA 4MJXA 3VAZA 3INTA 4AJEA 3U6KA 2D8MA 1UEIA 4NK5A 2IOQA 4EOGA 4AI6A 1YFZA 2W7TA 2G70A 3DBRB 4LCEA 4DDTA 3FZGA 1KJWA 4TQGA 5GONB 4GSKA 3STTA 5ADUS 3M3DA 1M2JA 1LI5A 1NVBA 1URPA 1P9WA 5FBWB 1P39A 3LLUA 4ZJYA 1JR4A 3L07A 1EJ2A 3F97A 4Q3LA 4CTNA 1EZZA 3ULKA 3WGGA 1CQIB 4L5JA 1U04A 4KXUA 1FMTA 4MAFA 4LGYA 5LN1A 2Z43A 4H1HA 1POXA 3GUZA 3MBKA 5GONA 4D8XA 2VJYA 2XUZA 2NZXA 3OEYA 2WB4A 2P9ZA 2QD1A 3OZCA 3QZUA 1JHPA 4FC6A 4KIUA 1DC8A 1OX5A 3UYKA 1EXWA 2QTWB 2W83A 2N0SA 4GI1A 1DKQA 2JHCA 1CQIA 3PJEA 3TW4A 3EUFA 2P4UA 4ZI5A 3K0AB 1F8UA 2RC5A 2SBTA 1ZM9A 1KORA 3KPVA 5PNTA 2LE0A 3UWOA 3WBKA 1T4DA 2VUSA 4QM6A 1FE8A 3OM1A 3EVGA 4BBZA 4DNQA 3RUPA 1HLGA 1EWTA 1KYYA 3IQIX 4IIEA 4R31A 1VFPA 1W2GA 3GGPA 1M6VB 4HNUA 3WGYA 1T8TA 2V0GA 3JVDA 3N0TA 4G5QA 3K0AA 3WMEA 1G59A 2WKPA 1JQ5A 4UU8A 4YMTA 4HX2A 5DWDA 2H08A 4GP7A 1XIVA 4BNKA 2JDID 4IHAA 2P2ZA 3ESQA 4YMUA 2DQYA 3G6WA 1FDTA 2EVWX 2G5GX 4UNSA 1P5HA 1M6VA 2BJWA 2CKDA 1GFZA 4HBGA 4OM8A 4AMUA 5JANA 1WTAA 3L6BA 4ZZIA 2FW7A 1GPJA 3U5ZB 5HQ3B 3EZGA 4RPJA 2PKEA 1Q44A 5P8WA 4D3DA 1DHTA 4DM7A 1X0XA 4BQIA 4GWGA 3MJVA 2Q5CA 2ZYAA 3G3EA 3SSAA 4ZVRA 4MHSA 2PUCA 1QF9A 2VLIA 2EERA 4U7DA 5AVSA 3DWFA 4FI3F 1IJBA 1Z4LA 4FT2A 4PG5A 3CH6A 4YALA 1KJNA 5GJWC 5JV5A 1XJCA 5HQ3A 1GA1A 3I9V1 3NS7A 2A88A 1T24A 1PG2A 5CBKA 3OM9A 1Z3CA 4KQ6A 4D8VA 5LMUB 4PY2A 2FVYA 3V1UA 1U6IA 1J90A 1HFJA 3T35A 4DMMA 1JBKA 2H7YA 4QBKA 1ADFA 4CMBA 3QVLA 4PIMA 1ZJ5A 2X2FA 5EPUA 3FETA 1GWNA 4J1SA 1TD1A 1OHHA 4OLFA 1B43A 2B5WA 3N8KA 4R98A 4TQUS 1Z82A 5A4MS 1P44A 4KXNA 2ZSAA 4GW3A 2X0EA 3KR9A 4YLYA 5HVNA 1Y1TA 5IKPA 1CERA 5D2CA 3AEQA 3IBSA 1QKJA 4K26A 4Y1EA 3ZHYA 2J0QA 3EWIA 3SIPA 4RWEA 5LA6F 2G9VA 1RYYA 2FW1A 3NBFA 4YRJA 3FGOA 5JQGF 4FCCA 1HZZC 1T0UA 4NYJR 1VXRA 1XD2A 2KM1A 3EZXA 4ND8B 2MMCA 5CH3A 1U8FO 3ZWMA 3ZCRA 4OL9A 4AJNA 5CBPA 1Y8ZA 1GFIA 4RE5A 1LPBB 4GMHA 4XH9B 3ZHBA 3PGKA 1YB1A 2MINB 3S2ZA 5LU8A 3CJTA 1GQRA 3PA6A 1EX9A 2P78A 3ZWWA 3VKUA 1P17A 3HXOA 2RHBA 4PFSA 5FUWA 3TXYA 1WPRA 2XNSA 4J2TA 5IKXA 4HN9A 4V1CB 4KAFA 1XCBA 3N70A 4PGMA 4CTMA 4WN9A 3V1MA 1UJMA 1NE7A 2HSJA 4UU7A 2XKAA 5ECDA 2PBLA 4MCIA 2QZSA 3S29A 3ADCA 4IG4A 2MINA 1P2FA 4KN8A 3UGTA 1HT0A 4LW8A 3V7FA 1ACLA 2H1RA 3BAZA 1X1BA 4PM4A 2BMWA 2IW1A 3H2HA 4M1SA 1TECE 4LMRA 2Z6UA 5FEMA 1R4MB 1AUOA 5LYYA 4H27A 2BE9A 5DK4A 4AKSA 4CKWB 1BDIA 1T2AA 5EP4A 5EUCA 3RJTA 4EFLA 3Q8MA 2R00C 2BHTA 4MW6A 4ESVA 1N2EA 1ZIPA 4D6YA 1SA0B 3P2JA 2RGRA 2E5WA 3QOWA 2I76A 4OQPA 1AKTA 3SQNA 1KAQA 2Z8YM 1MJ5A 3KOUA 4N12A 3THSA 1P91A 4D0RA 2IZ5A 3PKZA 3IE1A 1B6RA 1I33A 1ZNWA 3ADKA 3M70A 2V0CA 5BRJA 4CKWA 2RHTA 5IUNC 2XBMA 1PX2A 2IPLA 5JHHB 5LP6F 4DR6B 3SEZA 5EJGA 1Y48E 4YJDA 4ENRA 1SA0A 3DMPA 4MIKA 3TFQA 4L6IA 3LXXA 2D2VA 4BBPA 5K3DA 1JQJC 2DPXA 2WWTA 2XCQA 2FPWA 5FAKA 1HORA 1SD1A 3S70A 5I9LA 1E1DA 1LNQA 2FX5A 3LWBA 4NDNE 1AMOA 4DIMA 4URHA 3ZS9A 3P0EA 1ESCA 1SXIA 1MTZA 3O9ZA 4NNJA 3GFRA 3CMMA 3HJUA 4NEHB 1QAQA 4JUAA 4MKFA 1MO4A 5EINA 1E5VA 5E4YA 1J8DA 1GAEO 4BGDA 3UMJA 1GTJ1 3FPFA 4PIPA 1L7BA 1HE2A 3KBBA 5JZMA 4FHGA 1JR3E 1SBHA 4R0NA 1II8A 1NR5A 4JWKA 2Q3EA 2BFMA 1NGSA 3LD9A 1KZYC 2P9FA 5J3JA 3S2SA 3ABIA 1HMYA 1Y7HA 4YUAA 4BLTA 3TFOA 4E21A 1P2TA 2FN8A 2G0NA 2WHQA 2Q28A 3OZGA 5FO1A 4RK5A 1S8FA 3HSYA 1Z7WA 2BZ1A 2QG9A 3E5RA 4ZOLF 2PGNA 4G0QA 1NQUA 4ESHA 3ROFA 4P4GA 2IW3A 2H65A 1ISHA 3IAS6 4NH0A 1OXUA 5FV4A 3EZ7A 1HYHA 2FI1A 1CUHA 3SR0A 1ADGA 4OXNA 5JU6A 2QX4A 3KOWA 4LYHA 4Q9NA 2HDWA 1STOA 4H60A 1CY0A 2VA8A 4R2KA 1PN3A 1RHUA 3U9LA 8ATCA 3E05A 1Z8DA 4WASA 4CF5A 3HM9A 1AXEA 3AEKB 4PXYA 3PPIA 1OGIA 1RR6A 3NPAA 4NSNA 1R0XA 2RKOA 1GZHB 4MWCA 2HMAA 1QP8A 1J1ZA 2VK1A 3OO1A 1K7CA 5B55A 2BIFA 4KODA 3PVCA 3BWEA 5EKTA 3SLKA 5ICEA 2W6NA 4JEHA 5LL6P 1DADA 2QG4A 6GPBA 5G1NA 3QPWA 4UJ5A 4LNUA 4R1TA 3LBYA 3FVTA 3PUKA 3PS9A 4LI3X 3VV3A 1WLSA 3RAFC 4RLSA 3FOFC 5K7SA 2XQJA 1NTRA 1YR8A 3IMEA 4KRYA 2CD9A 4EVRA 3P4XA 1C9EA 3QMWA 3VR2A 1R37A 4F8JA 1JB9A 1Z5UA 1C2TA 3VPFA 3QUSA 5KSPA 2WIDA 3GPBA 3UXHA 2RBEA 4NABA 3SE0A 3K71B 1UAGA 5AM1A 1F1JA 1ZK2A 5CDTA 2ZRJA 2YV1A 4ERNA 5CYOA 4PW0A 2Z2JA 4JP2A 1E0SA 2Y2UA 4G1FA 5TS2A 4F4IA 3RAEC 5C7OO 3HY4A 4QOGA 1R6TA 2GOYA 1Y1RA 3DPIA 2WA2A 1SAYA 1Y9AA 3P0RA 5L4NA 2FE1A 3ID6C 3SS8A 4DAEA 3KJHA 3NX4A 2I55A 2RGXA 2JIOA 1ONSA 1UJ4A 1WSWA 2NSDA 2VH2A 3PU6A 4H15A 4O59O 3FW1A 3A6HA 4Q5IA 5A1JA 5IABA 2ECFA 2VUIB 5EC8A 1WL8A 4M6WB 3UT0A 5E3IA 2R8PA 4CE6A 1QCCA 4NZNA 2PO5A 3R3XA 3W3AD 1PTJC 2CDRA 3ABZA 1RYDA 1L3IA 4K9LA 1SKYE 4HJRA 4ARZB 4DIKA 3HY6A 4BWFB 1GU1A 1J0DA 1A8PA 1WEHA 2B8WA 3PEFA 5B1IA 1NW5A 1SUEA 3GA5A 4IDEA 4LVUA 5GPBA 4M6WA 5FQOA 1WXFA 4EY5A 1FZQA 4U00A 1ZD3A 4OREX 1AB5A 2Z8YA 3Q6MA 5JI2E 4JL6A 5HA5A 3HJFA 2PJUA 6PFKA 1Z6QA 5IANA 3ZEAA 1PNRA 1NP6A 2QRMA 2PQ0A 3G2NA 5DMHA 3I83A 4PYIA 4QFBA 3RE1A 4C9BA 1Z4QA 3ILYA 2R87A 4QQ8A 5I3CA 1OTHA 2XUFA 4A8TA 1HZZA 1PV4A 4B7AA 4HNVA 1K7YA 2RHCA 2C5BA 4WZ6A 2QN6A 1VLQA 4NCJA 1JSLA 2FEOA 4GM4A 3NP7A 5CX4A 2R11A 3RCBA 4BNXA 3WOVA 4B34A 1VHJA 1KVSA 3H9EO 1E9FA 1DXYA 2PSFA 4M0MA 1QUFA 2X76A 1JJFA 1RP7A 2VPPA 2PUVA 2DOKA 2W2XA 3E4CA 3GLSA 3SGLA 2AS0A 4IWNA 3EBLA 3B9PA 4RHUA 2X13A 1LJLA 1SIOA 3R8CA 3EGVA 2OY0A 4KJZA 2NNLD 4R69A 5DYNA 2K7FA 1G3QA 3OG9A 2WWXA 2VF8A 2AGVA 1KVUA 1XDBA 3N2GA 4G9BA 4HUQA 5LOVF 1TEHA 2HMVA 5K2MA 5DNEA 1Y37A 2OO5C 2I7VA 2ODTX 2NAFA 3L01A 3OFSA 4LXUA 5E6SB 5EJ9A 2VQFB 1FFDA 4LF7B 3ZXYA 2R00A 2BFAA 1W75A 3PC4A 4C5BA 3LKBA 1GRRA 1RYMA 2GTHA 1NNUA 4LSWA 2PU7A 2IYVA 2ZUTA 1DKUA 3ZR4B 2HYIC 4MULA 1EK0A 4JP8A 3OPYI 2Y1DA 1QQAA 4W99A 5JO9A 3PEEA 5AO9A 3UMMA 2GTIA 1QK5A 2QUIA 2V55B 5JYEA 1MGPA 3IILA 2DUJA 4FS3A 3KYCB 1DEOA 1B0AA 1YI1A 1YGPA 3A1WA 3AHFA 3N9IA 3LTEA 1PAUA 2P5SA 3R4CA 4S1NA 5JSHA 2FMXA 1RKUA 3KQOA 2AR0A 4N0QA 3AF6A 3DUFB 2B2NA 5BOSA 2O8BB 3FHLA 2PGOA 4MVJP 1Q3TA 3UMSA 4C14A 1ILEA 2FN9A 5LWQA 3FKJA 2J0EA 1O58A 2HSWA 4AX4A 2MCFA 4EW1A 1XZJA 4HWRA 1SBZA 3CUSA 1YRAA 2KJQA 4DV5B 3V4RA 4A10A 1H93A 3HXKA 4JGBA 4A26A 2IEAA 4UDYX 1CJTC 3FRJA 4M1KA 1IQUA 4ZEMA 1GV0A 3DUFA 3K5PA 2IGBA 5HIJA 4B48A 1GG2A 1NN1A 2NW6A 4YDRA 3TZQA 1VKZA 3B1VA 5ER6A 5IUKC 2FEMA 5F98A 2FMFA 3P9KA 4HR7A 1J25A 1NQTA 1RWMA 3GO4A 3QELB 1IEQA 5G4KB 5GQSA 2JH3A 2NP7A 1RQ2A 3LUPA 5AHRA 4WESB 5FTWA 4N5IX 3SJZA 2B2CA 2DY1A 3TAXA 4B2YA 3RV4A 4B8YA 2ZJYA 3FBWA 4WKBA 5JMOA 1A5BB 3GMIA 3B5EA 4GRDA 5HR5A 1OVMA 4KHZA 2EATA 4ZARA 3DDWA 3EYAA 5G4KA 1GCIA 2AZXA 3WJ7A 3LPCA 1I3NA 2VYVD 3ANMA 3BD7A 4DABA 1V2HE 5JAUA 4WESA 2GM4A 1IMJA 2J46A 2VSOA 2X42A 3FLBA 3JZDA 4HB3A 4JA0A 3T9FA 2CNOA 4YP5A 3W90A 3B8EA 2PH5A 1W0JD 4Q7KA 1TDJA 5IYZA 1BC5A 1CIPA 2G76A 2YZNA 5BN4B 1KMIY 3AERA 1L5RA 2P0YA 2R1UA 3N6XA 1RBMA 2WINI 4FYIA 4TTPA 4L5YA 5FJJA 5G02A 4E08A 2Q3CA 3UJ8A 3VISA 3CC8A 1KU6A 3R40A 5GMOA 4CW7A 1CZRA 2F3UA 3I34X 4WOBA 1A9SA 4B5KA 2F55A 3ZS8A 5BN4A 2ZUCA 2W2KA 4M21A 1UJ6A 4BDTA 2O5RA 5BR8B 1A1VA 1MW8X 1B26A 3NVMB 4L9WA 1SCUB 1XZFA 3V97A 3AKZA 5IVIA 1JE1A 1RTTA 1Y3HA 2PZMA 1FMCA 1B3BA 2VJNA 3AEUA 4F2GA 2E85A 3WB0A 3MRSA 1RWWA 4G2NA 4X8MA 3MRXA 4GL2A 3GW8A 4JEIA 4OMFG 5IDQA 3MJHA 3M9LA 1MB0A 4II7A 1JLLB 3TQRA 3BHIA 1VSVA 3KDSE 1SCUA 4DV1B 1UBTS 1UWCA 3BWBA 2JL1A 4OQEA 1HDYA 3G82C 3JW8A 5LYJA 1WSBA 2IDJA 4Y1FA 3VR6A 5IZCC 3WA6A 4X41A 2GDJA 4EA8A 3S1AB 1GDTA 1EUYA 3IAHA 4UMEA 4TYYA 2WM8A 2XUIA 4U2CA 5A05A 3PX7A 4HFNA 2V98A 4MR8A 4ZT7A 5T7BA 4TXNA 3E9ZA 3FVWA 1XTVA 3P2KA 3UK1A 2YZKA 4HZUB 4V39A 1NBMD 4JB2A 1CULC 2PSDA 1NYQA 2HAEA 3OIWA 3S1AA 1IUKA 3V4OA 3ZU2A 5IDXA 1M1NA 1QG4A 5JNLA 2PRSA 2ZYTX 5CXUA 2W2LD 1TC1A 2A0YA 1ZZEA 2UUBB 2YWBA 4RTMA 4RXMA 1DHRA 4MUXA 4BWGA 5J47A 2VNIA 3BMXA 5DEIA 1TAQA 4HZUA 5EZ6B 2EFHB 3U81A 4ZGGA 5LQDA 4AP6A 1D8TA 1Z28A 2VYFA 3WLNA 4NBTA 4IWYA 3BFKA 2J6CA 3KPJA 3HN7A 5I6DA 1RJ9B 1GR1A 1IEVA 3G0IA 3AR7A 1RPAA 3VDQA 2O8NA 4KFUA 1IG3A 3FYCA 3DDCA 1DWOA 2VZLA 5CT6A 4BP1A 3VTFA 1MCZA 5LCXA 4OQYA 3PLNA 2OXTA 2ZANA 1ZD5A 4MLCA 3K0FA 3GNTA 4NMXB 4UCXA 1RJ9A 3DKIA 3F67A 4K0RA 3T15A 4PLZA 2I1LA 4XOUA 1SVNA 4OHWA 2M6LA 3VSCA 1UBLS 3MJTA 1K7XB 2O3UA 1WUTA 4HQLA 4RNCA 4KR9A 2X40A 2X9VA 1SB9A 5IVHA 1AZWA 3WLAA 1CS0B 3E70C 2GCPA 4MW7A 1JVNA 4AZWA 2HHHB 2Z5LA 1Y6ZA 4UNNA 3EDQA 1TZ2A 3HRIA 1N6IA 2JLSA 2NO6A 1EI9A 1C30B 2AKYA 3PC8C 3KQQA 1QZXA 1QO0D 1TVKA 3I4CA 3UQZA 1E77A 1M0SA 3L04A 3WMWA 4CHGA 1WRBA 4YASA 3T52A 3BM5A 1BJRE 1DUIA 4PC3A 4DNFA 1GADO 1XMSA 5E6UA 2BF4A 1ZN7A 2F17A 2QAJA 2GERA 4DCUA 3IUNA 3ZCPA 4IDHA 3SKVA 1F5NA 2OO5A 3I9KA 4ND2A 4RULA 1T2NA 2B21A 4C7XA 4INZA 4L7VA 4YLEA 4Z9BA 1OJLA 1YCDA 5FRDA 1DBWA 1BA3A 4RGVA 2CXTA 2J3LA 1ODKA 2BMDA 3AB3A 3E81A 4J1QA 1RVV1 4RY8A 5A06A 1SURA 2X41A 2ONJA 4BV8A 2BR4A 5DWQA 4GMGA 1UBEA 1U3DA 3SZOA 4JELA 1U99A 2VHEA 3EGIA 2FPMA 4CQLA 4MPRA 3EXHC 2Y1GA 2PRIA 2Q6KA 1QAMA 3KAKA 4RF4A 1P9OA 1PEDA 1P9RA 2YOFA 3EULA 3NHRA 4QFCA 3U26A 1QTNA 2NTJA 1BYIA 1JP7A 1B3RA 4Z0TA 3T4PA 3CF2A 2FA9A 1I0ZA 3T5MA 3TM5A 3PSHA 1T5TA 2WAOA 1IDOA 4WPGA 2AR9A 4F45A 3T6KA 3RQSA 3SLGA 2C5HA 3LUBA 1NQ5A 1W2HA 1CR6A 2IEZA 3IV9A 1U8EA 2FSGA 4ESOA 3GHHA 5TC4A 5BUZA 3TKYA 4HWSA 2D1RA 3W8NA 1RXYA 5JYDA 1N4AA 1AK9A 2FJ0A 2XOXA 3AR6A 3OJCA 4IIHA 4EY3A 5G0SA 4JGIA 4BQSA 2BHRA 1SK8A 4QRIA 4C7JA 3K70D 2H7XA 1ZBDA 4BMPB 3D1JA 4EI8A 3OZFA 4AZ3B 2HRDA 2OWDA 2WFMA 1AQYA 4BLRA 2R7MA 1AUXA 2FSHA 4ND3A 4UMFA 4LWOA 2XODA 1ZKMA 1ADYA 5KYKA 1FDSA 1DKPA 1TLFA 1Z9BA 3UGKA 1QMGA 1EM6A 4R4JA 2BTOA 4AZ3A 3I42A 2FUNB 1LQUA 3QMMA 4Y2SA 3W4JA 1E3QA 3A6KA 4CN8A 3AXTA 5J1SB 5KTKA 3CLRC 5D3MB 5ECYA 1X7DA 2P35A 4QNMA 2FZGA 1PR2A 2B6NA 3R4VA 2CJXA 3OFJA 1M7GA 2DC1A 3HEMA 4CIVA 4DXAA 5KTRA 5EI5A 2I8LA 3DOHA 4ARUA 1GCUA 3WIEA 3GEGA 3PHHA 1Z73A 4DY4A 2V6BA 4HWPA 4ZGWA 2D1FA 3GK3A 5EIFA 1C3XA 1GKLA 4RMIA 5H1YA 2JJ2A 2R79A 3BVPA 3M6XA 5D3MA 4RESA 2QMEA 1SU4A 2VT6A 5EWJB 1QDLB 4IEFB 5EJ8A 3GWZA 3GIDA 5EUBA 5SY9A 4CBVA 3EEFA 1I32A 1K6JA 4PSKA 3ZCSA 4FMDB 5PGMA 5KBYA 5DI9A 1A9OA 1G16A 4YXFA 3N2LA 3PYLA 3DTVD 1F7UA 1OREA 2EEZA 3GUUA 2AOUA 5EWJA 3D64A 4I50F 4YJHB 3WC4A 2CZGA 1U5CA 5H5JA 3A4TA 2KPOA 2Y1KA 1Y63A 3O4RA 5BSTA 1F8GA 1N92A 4CDGA 3ZNOA 2IHNA 1QO9A 2XMDA 1E1QD 3DBLA 2XZPA 3KKQA 5IZCA 4W5JA 1NXTA 1KYWA 4V24A 4GLBA 2DMRA 2CDCA 2EU8A 3T7SA 1OIXA 2XNKA 2JKZA 3INRA 4G26A 1SUWA 3CUUA 4R2MA 2IUUA 1T36B 3AYXB 4J94A 4WK0B 1AH2A 3SHWA 1F6DA 2C4UA 4RZXA 1QGYA 2WR8A 2DPMA 3M4XA 3NTQA 1QTRA 5NLLA 4CG3A 2D2FA 2WTXA 3S5JA 2UZ3A 1ZR2A 1DINA 3GUVA 3PQ4A 2A8YA 1G9SA 1MX5A 1TTPB 2Q5QA 1PT9A 3QYAA 4YMHA 1FSGA 2PZLA 3HQ4O 1N3BA 4TPKA 4CETA 3T9BA 5IC5A 4CEIB 4GS5A 4HXEB 4PFQA 2YMQA 4JBYA 1HDXA 3F46A 1VHQA 1RWBA 3QUBA 5ILQA 1C9JA 2HHAA 2A1UA 4PSAA 4DY6A 4JLVA 4QJ4A 3OM0A 5CD1A 2CJYA 3BORA 2R62A 1YA4A 3G6KA 3KQWA 5F4BA 4PCLA 3UH0A 2H92A 5ALNA 2OLEA 4AURA 4QZVA 3DZIA 2HLHA 1SKBA 4CEIA 1FJ2A 1ZG3A 2WC1A 3IT2A 2QT0A 3LGSA 2GZ1A 2BFOA 2VT2A 2EX1A 2NU7B 1L5OA 2W6ID 3KZCA 5EMKA 4A5SA 1RJWA 2D2IA 1JDSA 2C88A 2DJ5A 2YWJA 1CNEA 2VHTA 2CDBA 2WJVA 3I01M 4M99A 1W5EA 5E7IA 1PZNA 4E5NA 3NONA 3GAAA 4KWTA 1TEZA 3L79A 4I1OA 4OJQA 2C7RA 2NU7A 3ND6A 5CA1F 4CEJB 5C5EA 5F9HA 4JLPA 5IWAB 2JHGA 1FLNA 2I8AA 2ZI7A 3PC8A 1NPTO 1MF7A 3QJ5A 5F12A 3EUEA 5ARDA 5E7QA 1KO7A 3R0VA 1GYQA 4KREA 3ASYA 5JNTA 4PAGA 1SKAA 4BAUA 1XBTA 5K8LA 3BJRA 1FX0A 5D3QA 3UOGA 2IELA 3S2IA 1H0KA 1Y4UA 2FUG1 3KELA 2DCUA 5KYUA 3ZLJA 2H8KA 2C78A 3SIXA 5KDOA 4HV4A 3EXHB 2ZI6A 1PT5A 5SICE 3SSMA 1XK7A 3WGVA 4WOJA 1LX7A 4R2IA 2EL9A 5FLXA 4M1QA 5EQDA 3TSAA 4PRLA 3ABSB 3JVVA 5DISB 5BN3B 3ACDA 1DKMA 5CGQB 3KDAA 2C99A 1RP1A 4WZAB 4AG6A 3JY6A 4RVUA 3WMXA 3EXHA 4LQLA 1P77A 1P81A 2UYOA 3E3OA 3OQNA 1LS1A 2W4IA 3NBXX 5CK4A 3X1JA 2YJ5A 2V9PA 2V4MA 1HMPA 2LKCA 4GLFA 4UU0A 1JT2A 2QD5A 5BN3A 1Y7LA 1HFKA 2D1QA 4IGKA 3WICA 2PZGA 1NF9A 3CT4A 1PJ3A 1WCIA 4KNWA 4QYXA 4ENPA 2FMUA 1C9DB 2YXBA 3RVLA 4HVAA 2NUTA 1G6KA 4LHEA 3UFBA 3KL4A 4B2LA 2ZBEA 2WWWA 4UZFA 5CNJA 4YRBA 2Q3HA 2W6IA 3A7EA 3WGUA 5JARA 4RCVA 3PDWA 4X0EA 3T1NA 4QATA 5KSYA 5DF1A 4Z2YA 4FLEA 1YQTA 4XR9A 4B3IA 3WYFA 5IVPA 4J16C 3ET4A 3VNBA 4OHBA 4TL7A 1E1CB 1NN5A 1DX6A 2R85A 1Z39A 4PU0A 3DHWC 3WL8A 1L4GA 3NM4A 3W5BA 3ZOKA 8LDHA 4M22A 1X1TA 4GNRA 2W71A 2ODPA 1QU2A 4UHEA 4EHFA 1RHMA 1OFUA 1W85B 1Z37A 1LPAB 3FPJA 4Y6PA 2J3IA 1N0VC 2XGGA 1RYBA 3P2YA 3VKVA 1SU7A 2JLUA 2XITA 3A05A 2LTAA 5CDHA 1RQNA 4F3CA 2WVJA 1NBOA 5HKLA 1I6WA 1PK9A 5KVQA 3OKPA 3B52X 4GVPA 1J9EA 4IHJF 3U3KA 4J7UA 2WG0A 3G2IA 2B8TA 1WXQA 3Q8KA 2O2JA 1ONOA 1W85A 3HLTA 3QKIA 1WKCA 4UCQA 3UMRA 3VRHA 3AVUA 5B1EA 4P35A 4GZMA 3NHBA 1QR2A 2PGJA 4RMJA 5B6PA 1TVMA 4PR0A 2PL1A 3GHYA 3RIEA 1PS8A 2QKYA 2AIRA 3LHKA 2OBNA 4UQOA 4CV3A 1XQYA 1SG6A 1RRCA 3OT1A 2WU8A 5A5VA 3ZKAA 5JQWA 4KPUB 3EDYA 1P0PA 2B69A 4G8CA 3W3AH 3DLAA 1LPMA 2PUTA 3JPWA 2O50A 3M1AA 4I9UA 4L28A 5CVDA 5DXFA 2X22A 3TS1A 3DZJA 5KCZA 3A4LA 1O0SA 3H16A 2Q2NA 1XCMA 4N01A 2X8JB 3AI3A 3CLKA 3E3MA 4HQRA 2YJGA 1RAHA 4OMDA 3WRWA 4B6PA 3MW8A 4M46A 3SFZA 2EGUA 4IGAA 3AI2A 4UQPA 4B45A 4IIYA 3D6MA 5INTA 1NI4B 1XU7A 2XWBF 4LPKA 3SD7A 4I6JA 1UQRA 4JR0A 2X8JA 1F1BA 3B3AA 5F9FA 5AJTA 5I7FA 3DDOA 3I01A 3SF0A 1NJ2A 3RVRA 5EUQB 1IBKB 3C41J 1RLOA 2O4UX 1DAPA 3PRJA 1P4JA 1QH1B 3QU9A 3I6ZA 5C0OE 4C4RA 3AESB 3DTNA 1TF5A 5G3ZA 2FPKA 2DQSA 4G4IA 4TL8A 1FVFA 2NSYA 2QJRA 2ZWAA 3CISA 3QA9A 1JJ7A 2ZYGA 5HGXA 1AK2A 3PQ5A 2PSEA 1ULUA 2VJBA 2F1RA 2QHXA 4L4UA 3UJ7A 3T5AA 1PK8A 4FCWA 2ZVDA 2D13A 4FSXA 3TZKA 4RTKA 3E48A 1QH1A 4M55A 1FU4A 1T34A 4LYFA 1B73A 2YMMA 4MS1B 3W1VA 3R8FA 3O8OA 1KP9A 3E9MA 4TL9A 3P5SA 4YK7A 1BS2A 1QONA 1FB5A 1WZNA 4K9NA 4OUKX 3OMXA 1T1EA 2W9XA 4PPQA 2YIMA 4UUAA 3WNQA 4WINA 4JT9A 3DT8A 3LVRE 4PPFA 1TT7A 4JUFA 1I4WA 4RY2A 5EP1A 2BJVA 4MS1A 4IGFA 3FKQA 1P9NA 1IHYA 1CNMA 3LX6A 5IK2D 1YKSA 3A10A 3RIGA 1O95D 1DQYA 1U0GA 3TOXA 1S9HA 2WTBA 2VXCA 5AW6A 3ROEA 1NXXA 4O2AB 4KO8A 2JCSA 3EX7C 1DPFA 2FQYA 4HD8A 5KZMB 4RA6A 2W6QA 2AG5A 1I6KA 2JGAA 3H0CA 4HPWA 3I5UA 4WNCA 1JIUA 3T0FA 4DE5A 2A9FA 4F4FA 2HWKA 1QIIA 3MCVA 3T3NA 4BEVA 3BHJA 1YCFA 2PHZA 3NWEA 4FFRA 3MSCA 1Q2XA 3H3XA 2V4ZA 3LYLA 1QSGA 1FFSA 4MVJG 4GO1A 1GARA 2IK8A 4BGVA 5JXHA 4MUBA 2GD0A 5TMEA 4B3CA 1OTYA 5F1OA 1EFUA 2YVLA 3RVSA 1ENPA 3SCZA 4MV1A 3TOVA 4AJPA 2G6BA 2UXBB 1V9SA 3TLGB 4RV9A 3IVAA 3WMRA 4LECA 2VK4A 5KI6A 4YMGA 4X91A 4Q18A 4BASA 1S8OA 1P2BA 2JIZD 4P08A 4U1RA 1BGVA 4F9TA 1O6BA 2X8BA 1W9HA 2CY0A 3B9BA 3IP6A 2PA0A 3AKDA 5ULLA 3AFIA 1MOQA 2VOJA 2P40A 3I04M 4Y9DA 5FXMA 1MNQA