1HX7A

Solution structure of the catalytic domain of gamma delta resolvase
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
105
structure length
105
Chain Sequence
MRLFGYARVSTSQQSLDIQVRALKDAGVKANRIFTDKASGSSSDRKGLDLLRMKVEEGDVILVKKLDRLGRDTADMIQLIKEFDAQGVSIRFIDDGISTDGEMGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSPOSON GAMMA-DELTA RESOLVASE
publication title Solution structure of the catalytic domain of gammadelta resolvase. Implications for the mechanism of catalysis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Dna binding protein
total genus 20
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2001-01-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1390 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1hx7A00
1HX7A 3UJ3X 3ILXA 3PKZA 3GUVA 1GDTA 3BVPA 2GM5A 5C32A 4BQQA 1ZR4A 3G13A 5C35A 2MHCA 1GHTA 3LHFA 3LHKA 1ZR2A 2GM4A 5C31A 2RSLA 5C34B 2R0QC
chains in the Genus database with same CATH superfamily
1BD4A 4OQXA 1I51A 1RDFA 4QOIA 1NHWA 1RE1A 3WQHA 5BSGA 4R6XA 3K2EA 3G59A 2WOOA 1QRAA 3RVSA 1QIKA 4MR7B 1DO8A 1DPGA 1XQWA 3VH2A 4YRGA 5AI0A 2WABA 3A58B 4NFHA 2FP3A 4Z9YA 2NP6A 3HKCB 4WZAE 2Q0SA 3EQZA 3ROEA 2ZTMA 4C0JA 2E4XA 2FWNA 5LXTB 1MX9A 3RS7A 3AVOA 3NAZA 1JA1A 3DL2A 2FEWB 1CUJA 2FJUA 1AQ6A 1OYWA 3CYFA 1PT5A 4GLBA 2E4AA 1M34B 5JWHA 5KI6A 3L7CA 4YI3A 3GA5A 3PXAA 3VPXA 3DFKA 2GKSA 3IBSA 5HZHA 4N3NA 1RXVA 2WYOA 4CN9A 2Q9CA 1N5IA 2C9DA 1W88B 2OBFA 3U7QA 3BD8A 3P9RA 4X45A 4BZPA 4E13A 3D3QA 3JRXA 5K09A 6AT1A 1KO5A 1SUPA 1MDBA 2JAWA 3EULA 1SHZA 2D1RA 3MGKA 4MQ4A 1RJ9A 4JBWA 4XUCA 4CL8A 1IRXA 5CG1A 2C94A 4CQNA 3GPLA 2VTBB 2VBIA 4BGIA 5EIFA 1E2UA 3G23A 2Z43A 1XP8A 4LX0A 2IYRA 3GGJA 1MW8X 1L5GB 1QP4A 1Z5PA 2GTPA 7REQB 4L9AA 3O8BA 3ND9A 2O05A 4JLWA 5EPOA 1E2BA 1FRVA 1NMZA 1SBZA 2ZVQX 4BIMA 1ST2A 3CBQA 4DV1B 4HUQB 4I4TA 5E4JA 1MF7A 4ML3A 2Y2UA 4Z3DA 4YDRA 2Z8XA 5AXBA 3W8FA 2XSZD 1LPOA 2YS7A 3LKBA 3TI7A 2G1PA 2GN6A 1RAHA 1OWMA 4DM7A 1R5BA 1YBVA 3F96A 5HP4A 1INLA 1FUKA 2H2AA 4E2FA 1ID1A 1ISHA 2ZZKA 4QJ4A 4M0KA 1UM9A 1F6WA 2D3TA 2ERXA 4YMSA 4GOLD 4BGDA 4JUCA 2JFQA 2IXEA 2QMQA 4WECA 1P4SA 1JU9A 1SG6A 2L69A 3VKGA 4ILEA 4NP6A 1U1GA 3EF0A 4A6EA 2BMJA 4WBNA 1Z62A 4K1LA 3TLXA 3UH0A 4KL8S 1A8UA 1Y6ZA 3EFOB 1LBEA 3OTHA 4NC9A 2BFAA 3RUAA 1Q77A 2ASVA 4DA7A 3OE7A 4MUJA 5JIBA 1KEEB 1W29A 1R6VA 3AJ8A 5TQ0B 2W42A 4IYJA 3EZXA 4JWTA 4KWEA 4UAVA 2B4RO 3N39C 2VDUE 1LH0A 3SHTA 4RZXA 5IAKA 1U98A 3PFFA 2AC2A 4ALIA 1RM5A 3VU1A 1O77A 2LDBA 2WKRA 4TUYB 3R8CA 5LWHA 1E3LA 1QJCA 3QF4B 4Z51A 5KYYA 1Y6RA 3LKDA 4QU5A 1LTKA 3I34X 3U3ZA 2XVXA 3T12A 3MYYA 1IY0A 3LZ6A 1ACJA 2ZS9A 3CVOA 4XPIB 2B83A 2QGNA 5L7YA 3ZX5A 3WRXA 4BLSA 1Z06A 1ZK4A 1IUPA 4MUGA 3O8NA 4WMLA 5EJ4A 3TCNA 5KYGA 1FQOA 1Q0SA 2QW1A 3ZCSA 1K7FB 3KVYA 2JH3A 3TUZC 1I13A 1KZ9A 2IHKA 3GDWA 4HH4A 2QG4A 5AHRA 4BX8A 1FSGA 4BMYA 3E5HA 1BU5A 1TVKB 3URKA 4EKIA 4D0GA 3TCKA 2H0AA 3DL0A 6GPBA 1KVQA 1R15A 1EX6A 5HXAA 3TTYA 3SVLA 1UJ6A 3DFMA 4MVJM 2XRZA 3UXEA 2OXFA 1E5TA 4D79A 3NGLA 4M6WB 1UQUA 3NXKA 1LSUA 2BE7A 3UWOA 2I1WA 1XRNA 2UZ1B 3OQBA 2ZRCA 4UM8B 5CT9A 5KCZA 1ZITA 2PVPA 4JP3A 1YMVA 1JALA 2ESRA 2JCXA 4B3JA 4B6PA 1I9CA 2WICA 4XOUA 4CHTA 3KJIA 3VSCA 3GAFA 3IMCA 4DQVA 2YOHA 4QU9A 4LIPD 4WA7A 3VH1A 1RWOA 3W4IA 2AMYA 4JVLA 4Y2RA 5F52A 3V5NA 4AZ0B 4DARA 1WU8A 4YP5A 5IP5A 1OI7A 1JTVA 1NI3A 2QLTA 3M1AA 4YRQA 1N57A 2JEOA 3NH6A 4UXJA 2B20A 2CK3A 3LAWA 4NLLA 3WSWA 5JFGA 3E9ZA 1EJBA 4E2XA 2VK4A 2HXGA 3BXHA 4FMDB 3TZKA 2BEVB 1N2SA 3IRVA 4UHCA 3ZE6A 2G7ZA 4E07A 4FTWA 3I28A 1GOTA 4RVSA 1JJ7A 1QVRA 4FGJA 3SIWA 3BXXA 2O23A 4C4SA 1U81A 5EGNA 1HOTA 1N5KA 5EMKA 3ZUGA 4AO6A 2D2VA 4IJ6A 4HDKB 3I39X 4M0FA 2DWUA 1IRIA 1GT91 4WXPA 2HADA 5CCDA 1H05A 4HLNA 2Q7XA 3WHPA 2XHEA 1DUSA 8ABPA 3PV0A 2YWGA 3FMGA 2ZUUA 1DTSA 4CV0A 1M2FA 3DLPX 5E7IA 4F12A 3BICA 2RHMA 1RJEA 2JI9A 3C6ZA 4MCAA 2XSZA 2WA1A 3DZ8A 2ACVA 2HO4A 5A6SB 5HMLA 2EC5A 3SICE 2P0YA 2D0IA 2F3RA 2CZQA 3QVKA 3V8NA 1C0EA 3GJSA 2W8BB 4Q9NA 3FKQA 4EO4A 1FK8A 5FIUA 1YS6A 3GJTA 1U2QA 2J3EA 3HDJA 4QOGA 3IEPA 4Y98A 3UA4A 4B3HA 2PSFA 1ZH0A 2H2DA 1L4FA 4EEXA 4ZVPA 4F3CA 2Z8ZA 1GPJA 2B0JA 2Z5VA 2ZWMA 3EQ2A 3EWNA 3OPYB 3Q87B 1N2ZA 1JHQA 3QKRB 4DMMA 4OQPA 3BZBA 2E2WA 2G5PA 3QA9A 4KYIB 4XM0A 3ZQ4A 4NU0A 1MC5A 3NT5A 3WIOA 1GTG1 1PL0A 4HRYA 1US8B 2PU5A 1TEXA 3VO1A 3MPUA 3TQOA 1AHNA 3PCRB 5BO5A 1KEVA 3U4CA 3L0CA 3LWZA 2GN2A 3KUKA 4RM3A 4NONA 3A0UA 3AZPA 3DR3A 1LSSA 3LF1A 4H3SA 3R7DA 5G53C 1HDRA 3SC3A 2RJNA 1OZAA 1AZLA 2XGJA 2XCIA 2IODA 3U7RA 4WOBA 1WNTA 1ZL0A 2FLVA 2PGAA 2ZJ0A 2WTNA 3CX6A 3H5NA 4JELA 1QRTA 1SVKA 1II8B 4RIFA 3TD2A 2BT4A 2PWPA 3GT4A 4GWGA 1FLDA 1KU0A 1QUFA 2ETVA 3IAUA 4M55A 1XZJA 1NVMB 3JD3A 1Z33A 2I6SA 4CM1A 5E0OA 1IHOA 1FUYB 2P9CA 4Y2UA 5EKUA 4WZBB 4QFMA 3COYA 5DM0A 1ZRSA 2E18A 3N7UA 5AVKA 1AU9A 1U2DC 3JYOA 1S2IA 3M6MD 3N59A 5IYZB 2HX1A 4TTTS 4MV4A 1P7PA 3BB3A 3CH4B 4I7EA 1P4RA 2FF7A 3FNEA 4W63A 3K0FB 5E1MA 4JBIA 2VYVD 4DW8A 4CKWA 6PFKA 3Q3IA 4P4SA 1ACMA 3KFVA 3LS2A 1JDJA 2J9FB 3ZLJA 2XT0A 4WZAA 2K4MA 1SC1A 4B73A 5B57C 3BFJA 4KXNA 3AVXA 5REQA 1UDCA 2ZUCA 1AO3A 3BL5A 3W6PA 2IDKA 4KN9S 2CVZA 4YC7A 4AICA 2XJ4A 3EK2A 4P93A 2ISQA 1U7PA 4BX9A 1V2HE 4AIIA 3T5DA 1RLOA 5E6RA 1N0VC 1J8MF 4I1YA 2H11A 4JT9A 2PL1A 2GN9A 1XQYA 4LSWA 4P1ZA 1V16A 5EJ2A 1KTIA 5E1DA 4RFSA 1SRQA 1SU8A 3STUA 5K0EA 3AJ9A 2CNKA 3QOYA 4JYAB 2XA2A 1X70A 3BREA 3DZHA 2WVAA 1LLUA 1ABEA 1J42A 2XOKD 1EXNA 4I50F 3M9LA 5H80A 4YUVA 3NORA 4Z54A 3DLTA 1YZLA 2HJRA 3QVLA 3ZD9A 2V4UA 1FTSA 4OK5A 3N0WA 4DR5B 2FK7A 2YZKA 1L7NA 3SR3A 2H5EA 3WY9A 5BV0A 3T9CA 3GRRA 5C31A 1ZN7A 2GN0A 1YK1A 1LPAB 1SZJG 3RW9A 1VZ3A 2V54A 2ZK7A 2ZATA 1B0AA 1HNXB 4GC9A 3DMFA 4TMKA 4UTZA 1PSWA 2AG5A 2GAFA 3GR6A 3MLAA 1KYQA 4RADA 2HSJA 3WB0A 2AMJA 3AOEA 2P35A 4JUBA 1IPHA 1OU4A 4I5FA 3RU2A 2JIBA 2Q9UA 4RAOA 3TOVA 3KZMA 4P35A 4L4RA 1ZIPA 3OPMA 5HZKA 3DT9A 3ORHA 4G09A 3UAWA 3KQYA 2I2BA 1IN8A 2XMBA 1D1TA 4JUDX 4URFA 4Z6KA 1QZZA 3OIYA 4K9NA 4WFQA 2WI8A 4LDRA 1U7TA 3HO8A 2QQEA 1EZ1A 1UDBA 5B1YA 2ZYIA 2AFHB 2ZRGA 3P0RA 4EF4A 1HXHA 1FRZA 1YMQA 3TK1A 2VK8A 1ZH8A 3WKDA 3WKCA 1I1OA 1SCQA 1NP7A 3ROKA 1SOAA 2H29A 2Y68A 2AOWA 3AU9A 1W5BA 4REQB 1N92A 1QSGA 2IUFA 4AY4A 4FKZA 1LZLA 3E4DA 3QQPA 4E14A 1YS9A 2WQ7A 1Z56C 1H2ZA 2UYGA 4CM4B 3K9CA 521PA 2PS1A 3DOFA 4V0RA 3O90A 4JWKA 1YJ5A 2IUTA 1ISIA 4E5YA 3P9XA 5L3QA 4BE9A 4R83A 3FPHA 5KU1A 4DR4B 1QU3A 3KDSE 1UZUA 1JB1A 1E2IA 1TA4A 3AR4A 1C7EA 1MAUA 1P81A 1SXJA 1ZHHA 4FUQA 4LBWA 5I5EA 5KZMB 2A9KA 2OHFA 3P0HA 5BQ5A 3U7EB 5CFNA 5TQJA 3BPSA 2H7XA 3MOSA 3WNZA 4AX8A 1YOVA 3DCNA 3OY7A 2BHNA 1JA9A 3HUUA 4QEDA 1TD9A 2ADOA 3ET5A 5FI0B 3X2FA 4WV3A 3I6MA 1XTQA 3F9IA 2BGMA 2RHRA 1E94E 3OIGA 1A1VA 1VLZA 1REQA 3OE1A 4K5QA 3NLLA 2RARA 3FVWA 4LK3A 4JB0A 2EKPA 4PYLA 4BUCA 4C4AA 1SBNE 2JAXA 2CB9A 1ZYUA 5KHLB 5ITZA 3GWGA 3JY6A 1XZHA 5JT1A 3TOZA 1QP0A 1AUXA 1BS1A 3K1YA 3C87A 3H1AA 3N8KA 4RMGA 1E89A 3DMTC 1D0IA 2OFWA 2HNAA 3JZIA 4KOAA 4V0SA 2QTGA 2F67A 4B46A 4YDQA 1GY8A 1LDGA 1Q1EA 2FPXA 4J3NA 3ZHCA 2YMLA 4DC9A 3U61B 3VKVA 1L7OA 5IKXA 3LQRA 4BLPA 3IQEA 3UZUA 2C88A 5FAKA 1XALA 1RJ9B 1NHGA 2ZIEA 3LPDA 2R6GA 1IBRA 2Y8EA 4PX9A 4TYNA 1R8XA 3DOEA 5AFSA 1U90A 2VYVA 4K46A 3OCWA 4TS4A 4ZEOA 1XROA 4M53A 1OB5A 1WUTA 1M83A 2QAGA 2RGWA 1PZGA 4BJ1A 4EB0A 5A0TA 3EXIA 4M7RA 3NBAA 2BJVA 2W2KA 1OKKD 1VHLA 1HYEA 2JKZA 2ZBFA 3GFQA 3PHCA 4P9NA 3TLCA 2XDAA 3DWIA 1GXSA 2YUIA 1DQPA 3WL6A 4OKIA 3N5KA 4I4TB 4K8OA 3K0KA 3C3AA 1T9GR 3ESQA 4B3XA 4C2UA 3IELA 1ZNXA 2YR0A 4S0ZA 1BQ3A 4DG5A 4ILKA 4MI1A 3KDAA 4EKGA 1PDVA 4LJ6A 2ZJ2A 2RAFA 5ITVA 3E4CA 1VKNA 4FXOA 2XOKA 4X6UA 1FXSA 3PEUA 1QH8B 3EA5A 4R3NA 2WWWA 1JKJB 3TIVA 1RAEA 1UM9B 3W9UA 3EA4A 3OZTA 4MWEA 3F4LA 3C41J 1WUYA 4JLMA 3E3LA 1A4XA 3GHYA 1E1MA 3KOYA 2ZCUA 2GRAA 1BOOA 5K3OA 1DC4A 4RIHA 4Q0MA 5FBVB 4WBNB 4XKJA 5G4LA 2HNKA 2Z6AA 2WVGA 3ROMA 5I9LA 3IT3A 3TRIA 3O73A 2FETA 1TW2A 3LK6A 1R8QA 4P5PA 3FPJA 2E21A 1NYTA 1TC1A 3OT4A 3IKJA 2ZULA 2B1IA 4BKPA 4KITB 2AL7A 4OSEA 4QYXA 1XR3A 2QNRA 1KP9A 4M1TA 4B9AA 3RAGA 4RA6A 4AWBA 5FOQA 1GCGA 2OZVA 1DAPA 4L73A 2EBUA 2YS6A 1MKYA 4MO9A 1NZFA 1YS2X 2QJTA 3KHTA 5B1IA 4GDFA 1Q74A 1JLHA 1KBZA 2VBCA 1ZD9A 2F59A 4YWHA 1R10A 1NW3A 2AWOA 3HBJA 4LZPA 2QVXX 3NNDA 4BNUA 5MN4A 3QLEA 2HPVA 1QOQB 3QKWA 1BX3A 2FSHA 2G5CA 1Z38A 3HSSA 1ZHFA 5K51A 4C3OB 1P77A 1ZD2P 2MSNA 3OHPA 3IP8A 4UM9B 2X0RA 4YRNA 1YGPA 2DUMA 4DBVO 3LOQA 1UUFA 2N47A 5E8RA 4BNNA 4S1NA 4KYVA 3M6AA 5K05A 2IH5A 1MQAA 2TYSB 3BCUA 2IHUA 3P0JA 3ZJYA 3E9CA 5JSQA 2C31A 4KRYA 1KY4A 4L0DA 1WF3A 4WERA 5DHTA 3OOEA 5F9MA 1G16A 3R7BA 3T3EA 4C4PA 2RG1A 3B20A 5FBQB 1GL6A 3PQ3A 2ONJA 1QZTA 4KXMA 1HA3A 3ZKAA 4LWQA 2QJFA 3UAXA 4OJYA 4RV5A 3P4XA 4MUFA 4EFMA 1JG2A 4BMZA 3U16A 2VJPA 2FR0A 1U4NA 1MR3F 3WZLA 2EZUA 1L8QA 1K5DA 3TDMA 4JV5B 2L2QA 3VPAA 4LY3A 3W5CA 6ADHA 4I1PA 4G5OA 5K4HA 4D8VA 2J48A 4YAGA 2NVWA 1V37A 2NW6A 4O4IF 3TVDA 2CGEA 5I01A 5F5XA 2XBUA 2SBTA 3GD7A 3IBYA 3O9ZA 3FBGA 3GMSA 2VPXA 3WMGA 2P5TB 2B34A 2C9YA 1T26A 2I34A 3OCUA 4RVFA 4YJ2B 4RFVA 5IJWA 3OMLA 2LVBA 1M5RA 3FBTA 2JIPA 4G65A 5B3LA 4QHTA 4G89A 4L5BA 4AULA 1Z4MA 4NNPA 5IFKA 4GX5A 3QX3A 1A9XA 5AK6A 1PEYA 3HKDA 1YVUA 1CR1A 1WQ4A 4HAYA 3B8HA 4MCHA 1LSOA 3ZE0B 1J39A 3SE7A 1JSLA 4XWWA 3U3OA 3NBQA 4RY9A 3SJBA 3MTDA 2ZR8A 1SZCA 1NRXA 3HDQA 3V1NA 3WZ2A 5HOEA 1BGWA 4H6WA 5JALA 1N3IA 4HNHA 4YCLA 3EOBI 4P84A 2WMOB 2PQ2A 4PIVA 5BOSA 4FQ5A 3VKWA 4PR0A 1HUQA 3GEBA 4HX9A 4WKBA 3BMNA 2B78A 1T9ZA 4I9NA 1SAYA 4MWBA 4OL0A 1KYZA 1NXXA 5ECGC 3CA8A 3BAZA 5EQDA 1ORHA 3AL3A 3UFBA 3E2IA 1T1JA 1U9IA 4BN0A 1E1CA 2QNBA 3JTEA 4OLJA 3R6GA 4KBGA 3UJ6A 4RTLA 1BDBA 2QTBA 1WUIS 3GFBA 3ZN2A 2Y0DA 4EAAA 4MAAA 5ESDA 5JAMA 4PAWA 5FB3A 1Y82A 4FD3A 3VBCA 3PXXA 4DIMA 2GA8A 1JEEA 1RWBA 2R1UA 3EHDA 5TEWA 1N1MA 2BOVA 3WK5A 5KDLA 1VCMA 1SCJA 4BNMA 4CJXA 1BA3A 3A04A 2HXYA 2W6PA 3KDPA 4A0FA 2TS1A 4U00A 5SZJA 2W6OA 2YZGA 2QRLA 4BQSA 4BVHA 4R40A 5AHOA 4BBPA 2AT1A 3QK7A 5LMCA 4FHGA 1U4OA 4WJLA 2H54A 3EEYA 3IPLA 4QWWA 5A02A 3YASA 2F3PA 4J43A 4RL4A 3ORYA 2RGXA 2BIFA 2OT3B 2Z6QA 4FP9A 1T3HA 2P79A 3KQLA 3VYWA 1E7SA 1DAGA 1J7KA 3FB4A 5DW3A 4YV0A 2IHTA 2OY0A 1UDWA 2GAOA 4KFTA 4YCDA 4ESOA 1CR4A 3LRTA 4OBEA 3RHFA 5F5NA 4MLDA 5DEIA 1DEKA 4N7JA 4Q02A 3RVQA 1CUCA 1ENYA 5BNTA 3MMXA 3IBTA 3Q2KA 1RPTA 2JFZA 5H9WA 1T1SA 3F7NA 2XKBA 4CKWB 1IN4A 3GFPA 2GXSA 4P4SB 3BQMB 3CEHA 1LA2A 4HZUA 1E5XA 4IIEA 3ZNNA 1ADCA 1KK3A 4QAQA 5C8DA 5EEHA 1PL8A 1VYTA 2VNKA 1PYOA 3ECCA 4GECA 4Q16A 4WZAB 5D3ZA 2J30A 5EIBC 3URMA 1XI2A 1T3ZA 5REQB 2KLBA 3ZWOA 1KFBB 4N48A 2BFWA 1U3WA 2H07A 4MB6A 4QBHA 2X42A 4R5HA 4XXHA 1AKTA 5AHXA 4ZAZA 1JTFA 3RUIA 4KUEA 3KEQA 1YKGA 2YRWA 1TCBA 3DE5X 3FAZA 1IQ0A 1CVLA 3N53A 3QX8A 3IOYA 4I9UA 3HCPA 5E6RB 3DZDA 3CG4A 4FGSA 2Q3JA 1V16B 4JLSA 4L8VA 5BN4B 4RFSB 2XMDA 2QW0X 2DHDA 1PJLA 2FN7A 4O5OA 1ZH6A 3DA8A 3D4PA 4AQ7A 2E5WA 4ZA2A 1PFWA 4N0EA 1S8FA 1NULA 2B36A 2HMAA 2PN1A 3L6DA 2VJKA 4P3KA 3VVBA 2HDHA 3DW3X 1BHQ1 4AUKA 1B14A 1RW4A 2P9YA 4W8OA 1DLIA 4KE8A 1JJFA 1D07A 2H00A 4IQ4A 4UM7A 4FK8A 1B3RA 2XWSA 4C4TA 3EXG2 2PD6A 4UHFA 4PC3A 1K3UB 1UCFA 1Y7LA 3AL2A 4MUBA 1TEVA 5DNYB 3ASUA 2Z3ZA 3VSDA 3LJKA 3N0TA 2VA9A 4X93A 4NHOA 4B2PA 5KTKA 3M1LA 2NLOA 2OAEA 1EQUA 1JQKA 2B1QA 4EG8A 3JVVA 4U9HS 5B3KA 1GSIA 1LRJA 3H2KA 5FPTA 3HU3A 2HZBA 2GJAA 721PA 1Z0DA 1DIGA 4NV0A 3B5EA 3DD5A 1K8ZB 1RM0A 1K27A 1O2DA 2YZ2A 4ENVA 3CR7A 1SVIA 3FNGA 4QBGB 1P5RA 1CIPA 5DKFA 4QG7A 1ZM9A 2XAAA 4KPGA 3R74A 2YCBA 3RCBA 4H6PA 1OSNA 5EP1A 5HSGA 4V3CA 1TCCA 2OHJA 1GQYA 4GX2A 3C7KA 1G3RA 4DNXA 2Z30A 2DECA 3C7TA 4BO5A 4KE6A 5LCXA 4N47A 2BCEA 2WOJA 3O91A 3UVEA 2ZWIA 5J2UA 4YHHB 4F5WA 2QTFA 5LQCA 3U1BA 3HVUA 1SXJB 1GFWA 3PYXA 2O54A 5CU7A 4ASUD 5UKDA 4CUJA 5KNDD 1PV4A 1DHRA 2WVHA 4L8GA 2Z6UA 1HL3A 3CWCA 3DB1A 3O0TA 5EE3A 5F7OA 1YOVB 1MTZA 3OT1A 2HC9A 2QRZA 5CVCA 3THSA 1Z28A 1GV0A 3LQQA 2OQVA 3UTCA 4BMSA 4EX7A 3LY7A 1V4NA 1P9NA 5IAJA 3W9SA 4NBKA 4N65A 1REQB 2NIPA 3TINA 1D9XA 2AD1A 2ISSD 5A5DA 4RJKA 5HBGA 5IVKA 1WP4A 3X2EA 2R44A 1XCGB 3L8GA 1CJTC 4KXFB 1D1PA 1P2GA 4YGXB 4C9BA 3KPJA 2HLDD 3C85A 3DT6A 1JW9B 1O6GA 2ZVPX 4L6IA 3GGSA 4N3AA 3TTXA 2HXSA 4F2GA 5FBZA 1Q3TA 1DKQA 1BXRA 2XHZA 1R4AA 2OAGA 2ZUBA 4PZEA 2O8BA 2FZLA 3RG2A 2IKSA 4QNNA 3TNFA 2EJTA 2YJ3A 3S2FA 4LJ7A 2A9QA 4AT1A 1FYXA 1AKEA 5MF6A 4F56A 4GE0A 1MO6A 2E4UA 1ZSNA 2D1YA 2IF2A 1Z5WA 1ZVQA 5JNWA 3FMPB 3EGWA 3TNLA 2CMHA 2XQKA 1SBCA 2P6NA 4NVRA 5AOAA 5DASA 1SOMA 4EELA 4MJXA 4BVFA 3KAKA 1ABFA 1IOLA 4LQCA 5LQDA 1KFJB 4RD4A 1S8OA 2B4QA 3G8AA 3PR1A 2YJ5A 4PNZA 2QAGB 3OZUA 1RKQA 4TRRA 2VAPA 4MW2A 4EEZA 2ECPA 3PWTA 3EXIB 1PJAA 4HB2A 1NWCA 1W87A 1D04A 2W2KB 3JWEA 4RF4A 5TSDA 5KVAA 3TW0A 1COZA 2Q9AA 3JQEA 4GSKA 5EE1A 5I7UA 1GXSB 2C3YA 4OJNA 4BV9A 3K6SA 2X0NA 4INJA 3TQIA 2WE7A 3GJ7A 4Z4QA 4FINA 4HG2A 1L4LA 3RAPR 5JAUA 1CDOA 1NW9B 1O5OA 2NO0A 1XZBA 1ORTA 4PX5A 4TYPA 1PS9A 2Z4TA 2PZKA 1KI7A 3ZS9A 2ZRNA 1YK0A 4TTPA 3D2CA 4XCXA 3SZUA 4F04A 5ICMA 3LKZA 2ZJBA 1D1SA 2POCA 2X6QA 3TR6A 4XGNA 4XYLA 1TXGA 1ZC4A 1J9GA 2I1QA 2WUDA 1CUSA 1SK9A 1NM5A 1LUAA 1E9RA 3Q9SA 4JC0A 4DDUA 4G5FA 4MLPA 2QTZA 3DPIA 3RT1A 4J7CA 1KRWA 2P41A 1NDHA 5H4HA 2INGX 3HBNA 3SDBA 1AH2A 1OXMA 4RA6B 1W5TA 2Q6IA 4YJ3F 1FTQA 3RVLA 3ZE2B 2AG6A 4D9GA 3GFOA 3RAEC 4LS3A 7AT1A 3ACBA 4DN6A 2AJTA 1MEJA 2GZ2A 2I3DA 2X23A 3F5FA 4FDTA 3J81A 1X7YA 1C0IA 2KWIA 3FKSD 4XD7A 4QICA 2QUIA 2QVLA 4LXIA 1DMSA 5JDIC 3IHTA 4BNTA 2DBQA 1C4OA 2ZUDA 3UGTA 1OFIA 4I5GA 4P0TA 3VNAA 4C7KA 4EA8A 4ZU6X 3V4RA 1MHTA 3NWOA 3E9MA 5G1PA 2JHFA 2RONA 2CSXA 3NWEA 4H4EA 3H6KA 4K9OA 4TQGA 3VU9A 4CETA 3MTJA 4HAZA 2NZXA 4PINA 1I80A 4CNBA 5KVSA 1I14A 4WXMA 3DJFA 3K0CC 3FWZA 3UMMA 5B7QA 1KMQA 3IP9A 4QOJA 1BNCA 3FM9A 4M0DA 3FUCA 2I33A 1QYIA 5HYVA 1V7ZA 1JAIA 4E03A 5KNDA 3L18A 4Y2YA 1BMQA 4LDAA 1UIMA 3MAAC 4HMPA 3OSUA 4B8YA 1CPYA 2JB9A 1EFTA 1GR1A 2A5GA 3TBHA 2DYKA 4BL5A 1ZVMA 4TS9A 2IX3A 2AS0A 4IIYA 1BVUA 1DMRA 4QUHA 1PJ2A 1YB7A 2VWGA 4PQRA 1DCTA 3AVVA 2XIJA 1XJWA 2PJDA 2OFXA 3OQPA 3A6ZA 2XE7A 4YMIA 3OZVA 1G0OA 1FSZA 4HOYA 1ZI8A 1ZDMA 4YP6A 5K2MA 5M29A 4JGGA 1YVRA 3N2IA 2QVCA 4P3OA 2HLDA 1OFUA 2QXTA 1JU4A 2FH5B 1E1NA 3TGPA 4DSNA 2V7QA 1MOPA 3CKMA 4MUXA 5CDYA 3OPYI 3GX1A 5DP2A 3MERA 4ID3A 5DTEA 2DP4E 3MUFA 4BO7A 1J99A 1JECA 3CCCA 1CJMA 3C8ZA 2B1RA 3MD0A 3MTEA 3QPUA 1R27A 4JD5A 4WK6A 5F78A 1CR6A 4BAUA 1MB4A 3W2IA 4BQQA 3KZXA 3KV3O 1GAQA 3A4IA 3LUAA 1G19A 1USVA 3AUYA 3DE3X 1JAYA 3GQVA 4JJ6A 3I62A 4BCCA 1JBQA 1QK4A 4LNHA 5FI1B 1QH1A 3OQIA 4NHEA 3F8TA 3HKDB 1W85A 2BLNA 4G1VA 4GWKA 4Y6RA 1XEAA 3I52A 3RTGA 4CRWB 1SKMA 1D7OA 5D3KA 4OYHA 2FPIA 5DGTA 2L0XA 3O31A 3SNKA 3TQFA 4A0GA 1SMKA 3BUSA 1LBIA 1B41A 1SHLA 2BONA 3WRWA 1RI5A 3C98A 3KAPA 4BWVA 3GG2A 5BQXA 2PLFA 4Z7JA 1Y4UA 3BXEA 4QUKA 2FQYA 5BOSB 1CY8A 5DYTA 3BE5A 2DKNA 2IP1A 1JE1A 3BMNB 3GJ3A 4NE2A 2H7VA 1FLVA 3L4SO 2A0XA 2QYOA 3VU3A 5EMHA 3VJRA 4YBZA 4JS0A 1M7GA 4M76B 4M1KA 5F1OA 3L4KA 2CL6X 4KX3A 3CV3A 4HAWA 5A3QA 3SBDA 3OIWA 4IF4A 4US1R 4C21A 1OQAA 1E1CB 1R3UA 4B9EA 1I1HA 5KWIA 4Y6GB 1KQPA 3N1UA 4C7OA 1C9JA 4TN1A 4EKYA 5KC9A 1XYGA 2V4MA 3M34A 1T13A 1T8PA 4HWRA 1JT9A 3I9LA 4JU9A 5K03A 2QM0A 3G2NA 1PAUA 2O2JA 1G4AE 3DDHA 3KPUA 4IDAA 1W4AA 1YB6A 2DCMA 2Q8QA 4L74A 4XFJA 2CHQA 5TF4A 2FSPA 1UBLS 3L6CA 2EBHX 4HEA1 3NYRA 5CLQA 4W5RA 3COWA 3DBLA 3L7LA 2FSVC 4IRMA 2W7TA 1JG6A 1EXWA 1XPUA 5F2EA 3S5JA 1F0PA 2A5YB 5BWBA 2GTIA 3PHIA 5JSFA 1FX0A 3PGLA 4DOMA 5LVAA 3WA6A 5TDHA 3DAHA 1S0UA 2PFSA 2JVIA 3U4HA 3FKSA 3CX7A 3KQSA 5FUXA 2O5CA 4UMFA 3DC7A 1F60A 1D4FA 4LXHA 2HCTA 4HZIA 3E7XA 4EUSA 1Y9JA 1LJUA 2CUKA 2FFQA 2V3WA 2VCYA 2XYQA 2Y99A 3COSA 2P0EA 4R1QA 3UUWA 1A04A 5FV4A 5L3VA 3ZR4B 3PNOA 1AS0A 1H5UA 1MT3A 3E5NA 4ND4A 1A71A 3JVIA 1SCUA 4P4NA 4CIAA 4UHBA 1CV2A 3BRCA 2CLMB 3UTDA 1IN1A 2CDNA 4E6EA 1M8KA 3ZVKA 1X15A 2BZSA 1PD0A 5ALMA 1IY9A 4KE9A 4CDGA 3G9TA 5FHQA 3SI7A 1XCBA 3TRKA 2DFVA 5JPCA 1UEXC 2UUPA 3CH5A 5D5QA 4TSRA 5TVGA 3R44A 3EFBA 1B6GA 2R8YA 1IN6A 2OD2A 4AG3A 4HZUB 3HJNA 2O3TA 3FVRA 3SG0A 4LJ5A 5J4HA 2EF1A 4JU8A 4YRTA 1NW4A 4Y2JA 3DKRA 1LD3A 1Q0UA 3RVBA 4BFSA 1QLJA 2GZ1A 2R8XA 1RXYA 2Z83A 1ZW6A 3NAGA 1R0SA 3I1YA 3DZFA 3OLCX 3WVNA 1MLDA 3SD7A 5J2TF 3KSBC 3RSHA 4UNSA 2WWVD 1KI9A 4JJEA 1NAHA 3CCBA 4ESVA 4HYTA 1RQLA 5H02A 1GARA 3FDZA 2BTEA 4C6HA 1ONOA 2NACA 1B0ZA 2BM9A 2WPDA 5BW5A 3EHEA 1BWPA 1CJVC 3EIEA 1N2EA 4XQGA 3R6LA 4EUKA 3A28A 2AXPA 4YAFA 8GPBA 4MRMB 4B6GA 2UXDB 1A96A 1WULS 6NULA 2DC1A 3DZKA 4ZYWA 1UDRA 3PBKA 4S35A 3LL7A 4BRUA 2DQSA 5LXTF 2PMWB 3QUTA 5EHGA 1XF1A 4M0EA 1SBQA 2I3GA 1T29A 3DEIA 5DULA 4AJJA 5MFZA 3KJFA 4WKCA 4CG1A 3IA2A 1E3JA 2IVZA 1MA0A 3NTRA 4CU2A 3B52X 4D0SA 2NM0A 1NX9A 1OWLA 3T99A 3TFQA 5HX7A 4PSUA 2VPIA 3UC5A 2W6JA 3VGJA 4B48A 1PJ4A 4PNHA 2JIQA 2CHEA 2DTXA 3V3TA 4LDZA 3F7OA 4C14A 2CSUA 5JWRA 1NDQA 3WSVA 2Q3DA 2B2XA 1A9QA 3R5JA 5EQJB 3L4JA 2VCHA 5JBIA 4N7RA 3RNLA 1ZOIA 1R66A 3FZGA 2NV6A 2G80A 2R8RA 3M1YA 4I14A 4LXGA 3Q3VA 1T6BY 4TSFD 4CF6A 2GBGA 4Q9KA 1WAMA 3OWOA 5U4XA 1WZIA 1UAYA 2YNMD 1JKIA 3IR7A 1D9ZA 3ITDA 1W0KD 1GPWB 2EHJA 2PRZA 1KMIY 3RC9A 1Z0AA 5J58A 2PZMA 3M7IA 2C03A 3SX4A 3KQTA 1JH9A 2E0IA 2P5YA 1G9SA 4DS3A 2NTVA 3IEKA 4RMHA 3VR2D 4JJ8A 3LC0A 5KQPA 1DG1G 1DJOA 1JGTA 3H1TA 3LYAA 1HYHA 5A0VA 1VQ1A 2BZGA 4IDHA 4ZO7A 5J2UB 2XMQA 1EG7A 2O0JA 3NVKI 3A1DA 4QTXA 4IIUA 2X0JA 2REXB 4R9SA 4AAYA 2QTMA 4XIJA 3SX2A 2OM6A 2QV7A 2FQXA 1VLMA 3FCAA 5EP4A 1H4SA 1KDOA 1LX7A 1EBFA 1LF5A 4J8PA 4NZ9A 3E5MA 1X7WA 3OT1B 4M83A 5DZSA 3RFCA 3BKWA 2ZWPA 4D1YA 3GEGA 3WLRA 2OAQ1 2CXOA 3WDSA 3UEOA 4F91B 5C5IA 1Z0SA 1PKXA 2D1TA 1CQZA 3ETNA 1NBAA 4NH4A 1GWNA 1FDVA 1T1IA 2ZI6A 4RF5A 2IUUA 1X6VA 2EP7A 5DNAA 5JD3A 2QJRA 1A4IA 2R6DA 3PPWA 4FYKA 3O26A 5K9ZA 1Z0UA 3CE6A 4JIGA 4BYMA 3GZJA 4U2BA 3P27A 2JRLA 2ATXA 3CPSA 3FYUC 1T10A 1U3TA 2WJWA 4F84A 1N5RA 1BXRB 1VG9B 2G4VA 1XRMA 2Y3IA 1DBVO 3JR3A 5K0BA 2O8BB 1VGQA 1T9CA 2C61A 1EDBA 3HKBA 5DISB 3PC2A 2IWHA 3V4PB 1WMSA 4DA4A 3EXFA 5KNDH 5D86A 4RORA 1EZZA 4AS1A 3U44A 3A06A 3G88A 4YP7A 1JSCA 1P5FA 4RABA 4TUYF 1HGXA 2AFRA 2GYWA 3ZCQA 3CONA 2OXTA 2A5DA 3TAHA 1ZJJA 3K9WA 5GV7A 3ESYA 3MSCA 1JKXA 1TQ6A 2HA7A 4QDKA 3MMPA 3IDAA 1SA0A 4OOFA 1EUDA 2F2TA 2YIMA 3CEMA 2RAPA 3FNQA 3IUMA 3X1WA 3U3KA 4AURA 5TJ9A 1T0PA 1UBGA 1YDHA 1NBHA 2RIPA 1BWRA 3OWHA 4Q3BA 2WB4A 2W2XA 5CEEA 5IF9A 3HJFA 1HZZC 3VNVA 1OZGA 4U02A 3MFQA 4L5AA 4HNVA 3QVMA 1CZKA 3SC4A 3UKJA 1AQJA 4Z99A 2FCAA 1V8OA 3LX5A 5IAGA 3SKVA 3K6SB 5ARBA 1FDIA 3B12A 3VR6D 3KXKA 2DFLA 2FZ4A 1CS0A 2PGJA 5BVHA 1CJBA 1CR2A 4DR7B 3O6VA 1EK1A 2ID9A 2EGHA 3OM1A 4YRAA 1N2BA 3EVDA 3HBMA 3Q4GA 4EL0A 1ORVA 5ALNA 1FYVA 1EINA 1H94A 1U2GA 4M7PA 4LVNA 3ZYCA 5JRDS 1H9CA 4LJ9A 4NZMA 4D0LB 2O2XA 4PSDA 3B82A 4UPVA 2WWXA 4Y2XA 5AK5A 5HEKA 2QMOA 3DMYA 4EI7A 1XCMA 1CQWA 1JQ3A 2FG6C 4MQFA 1WB4A 4TTAA 3ZTWA 5BV7A 2VPYA 4B84A 3ZHXA 1TCUA 5EVJA 4NK4A 1ZNWA 3MOGA 4IHJA 4YDHB 1E2MA 1G8PA 2W6ID 3H18A 3RQSA 3ZCUA 4FI3C 2YYZA 4GOND 4P2GA 5LQMA 1E2QA 2OV8A 5AM1A 1EGHA 2WR8A 4XYMA 3RANA 1Z74A 3H2JA 4QJ3A 2ZJAA 1OBVA 3WYNA 1BFKA 1Y37A 3RRNA 4PQYA 2FX2A 3EUFA 4QGAA 1X19A 4O2AA 4WXEA 3F5SA 1T2EA 2H4ZA 1QK5A 3OCZA 2P1DA 4FMDF 4UBNA 1GPMA 5C53B 1LQTA 3C7AA 1VCHA 4NPAA 4B6JA 2WU1A 3I1JA 4ZQBA 1E2KA 2C98A 2X76A 4L4ZA 3UXHA 1NQWA 4ZOLA 4M8NE 4QYIB 2BSAA 3ZWDA 1HEYA 1KZ6A 4O1IA 3KLNA 1HQKA 2F4NA 1NBOA 3VU9B 4DQLA 1I7QB 2SKDA 3RH0A 3I64A 2OCGA 3I2FA 5DLQC 4DZZA 1PKEA 2C99A 2HQSA 4INAA 1T2CA 1JLRA 4OMUA 4CEJB 3VR2A 3PIIA 5IBPA 1I7NA 1JPNA 1M10A 3GXBA 4PTYA 4ES6A 2WKSA 1KIFA 4R01A 5JDIA 3E22A 1S9DA 1U0LA 3K0BA 1GRCA 4EB8A 1T9AA 1ZZEA 1NMSA 2KX7A 4GPTA 1JR3E 2PO7A 1VG8A 3A2MA 4QQ8A 5SZKB 5ULLA 3TI9A 4YX9A 4YV7A 2HMUA 2WJGA 3G3EA 3I2GA 3HJTA 3INGA 4Q1DA 3WLOA 3R7SA 3ZCXA 1WXWA 4E32A 4E94A 3WKAA 2HU5A 1KDYA 3RRFA 2VVTA 1MENA 2R97A 4MSUA 1ORDA 2VRCA 3K0CA 4G41A 1IXYA 1P6QA 1P7YA 5K0GA 5JCXA 1BE6A 3HB7A 3PYLA 3GLFA 3OX3A 1B16A 1ZUD1 2FOXA 3P1JA 1O54A 3KZCA 1PG5A 4H15A 5DBEX 4EUNA 3I6ZA 4FQ8A 2D4HA 5PNTA 3ZGZA 4RX1A 3TTWA 4D99A 2AJDA 4IH4A 3RC2A 3P2YA 3SGLA 4RK1A 3WGGA 2NTEA 1I3NA 3HDTA 2VI5A 2H1CA 3OUZA 4MXDA 3GMTA 4PLYA 4Y8VA 5ESRA 1J21A 3X1XA 3D8BA 4PHGA 2QDKA 3F78A 4AKHA 3CW2A 2Q6VA 3S27A 2IPNA 2PX4A 2OHOA 1H93A 2OTCA 1JYFA 3ESAA 4X0EA 4D9JA 3VR4D 1L6IA 1T1GA 2BMDA 2XNKA 3VDRA 1IATA 3KUUA 2XUGA 4COKA 4PBTA 1BHSA 1PZEA 3I5AA 1QH1B 2IPLA 3OQIB 3BH7A 4QREA 5B55A 5D85A 1V95A 3L9WA 1W85B 3T3GA 3G5TA 3HY6A 1MAAA 5HUJA 3JQ7A 1DFGA 5FJJA 2FPIB 2FZGA 1U99A 4JI8B 4JROA 2WF5A 4CMCA 3LUDA 2GN4A 1U0GA 4L7QA 3WKEA 2XVZA 1JV2B 1RYEA 4PZAA 2ST1A 2PRKA 3O38A 4NE7A 1T3LA 4C01A 4B2YA 3MUEA 4OGKA 1XSEA 1YZYA 3KJZA 3E81A 4AMYA 1QANA 4JX8A 1WTAA 4JVNA 1KIAA 1EHYA 2H9IA 4WESA 5IZCC 2XGSA 3R9XA 1Z6QA 3C24A 2O5VA 4P92A 1FFHA 2XEDA 4IDGA 4FSHA 3WS7A 1F12A 2G67A 1ZQ9A 3D7NA 1E63A 1SULA 1DRJA 4ITVA 4YRDA 4FFMA 1ZLXA 4YACA 4O6VA 2QJWA 5A03A 3MT7A 4ND1A 5B7NA 2FGKA 1TJPB 2D54A 5IUJC 4PEVA 3MA0A 1P1FA 2PJZA 1OY1A 1XDUA 4TL8A 2BTQA 4IV0A 5EIAA 5GPBA 1ZN9A 3SSOA 3VAAA 3VKFA 3BHMA 4C7OB 4RLQA 1AA9A 2J07A 3L0IB 4DJ5X 1E5VA 3G5LA 4GMGA 3KSUA 5B2FA 3ADBA 1I3LA 5FPYA 4A8PA 1KE1A 2REBA 2YIVX 3QIAA 3CUYA 4GKAA 4KSCA 3OWXA 5BV1A 2XQFA 2IJGX 2W6IA 5HCNA 1W1UA 2BL4A 1MORA 1X13A 1NWHA 3L7IA 1K92A 3DBLB 3IO5A 2EBWA 3FN4A 3SKYA 2PX0A 1FX0B 1VLLA 3LXUX 1ADYA 1L6RA 1MB2A 1TUEA 2O8CA 4ENQA 1MHPA 3HCDA 4L5CA 4AN0A 1RMQA 3LUGA 3WGMA 1OPXA 2Q21A 1RABA 1UL1X 1NLMA 2QM7A 2RGGA 2ZETA 3A6LA 1Q1ZA 1S1MA 4HGZA 4KV7A 3RS4A 3T38A 3W2TA 1SB9A 5KTRA 1ZBDA 5ALRA 1EVEA 3BGOS 3D3NA 2M9MA 3DTYA 1TU0A 1DCKA 1WDLA 1UAAA 3G5MA 2ONCA 4RNDB 3U0BA 4O63O 4DCGA 2A7XA 5BRAA 2XNDA 4ITRC 3L4BC 4Z1OA 3SYMA 1JLKA 4BHTA 1D6SA 1N8NA 4KIUA 3AB8A 4B4VA 3KJNA 4X71A 2WINI 3VPGA 5C46F 5M2QA 2JLWA 3PXGA 2H1LA 1WO8A 1Q1NA 2HYDA 4FR5A 1BCRA 3PRYA 1FPQA 4MW0A 2Q2VA 2X1VA 2OGZA 2V7TA 1O9HA 3OF2A 3AGPA 1IUOA 2HGSA 4G0UA 4JBGA 2M1XA 4MB0A 3ZLBA 2QUKA 2ZKLA 3AI3A 3QYJA 1ZJYA 1RKUA 3D4IA 1O8CA 4NU6A 1T5BA 2MYNA 2CWWA 2D7JA 2ZIUB 4G0VA 3ZK9A 4QHSA 4D0RA 4FYXA 2W37A 3FDZB 5M5BA 2X2FA 3Q1LA 3FCOA 4UEWA 1CUWA 2QTWB 1D2MA 2RGYA 1C8BA 1OI2A 1WSBA 2P4QA 1C3OA 4GOOD 4O8CA 4RQTA 5AK3A 4C4OA 5L3SA 3KIPA 1N0IA 3IO3A 3RSZA 3D4OA 2WWRA 3AHFA 3P0IA 3KCQA 1NF9A 2WEKA 3SQNA 3UMJA 1HX7A 5ALKA 1KS9A 5LBTA 2VF5X 4AKEA 5J4VA 2B7CA 2JD2A 3LM8A 1RYZA 2Z9DA 4HATA 4PR3A 4UASA 2G9RA 1GYQA 2FW7A 2IT1A 3GOQA 4KR0A 3ERCA 1WUHS 2WTBA 1SU4A 3EPHA 1NJ5A 4JLDA 2GN1A 2B98A 2R6R1 1NQUA 4FZVA 4WLVA 4XVUA 5K6AA 2B5VA 3IV9A 3B53X 4AO7A 5B6PA 3TUIC 1DJMA 4MV6A 3M9WA 1EHIA 3EWIA 2CDCA 1Z7YA 5EE0A 3ZCVA 4EQ6B 4I66A 5KYKA 4LRYA 4AK9A 2XXAA 2ZRKA 3Q7EA 1RWMA 5LMUB 3U1VA 3O94A 1Y3CE 4XWTA 3GRFA 1E5LA 3ET4A 4W6ZA 4AZ3A 1HEIA 1UMDA 1VL2A 3NC1C 3QOWA 3IQZA 5H16A 2AKYA 3RSLA 3G1UA 1EDEA 4GM1A 2MR5A 1YTUA 1EVQA 1DRWA 3ZI7A 2KS6A 4PTZA 2FN3A 2VT2A 4BJ5A 2J6HA 4GQBA 2VT3A 5GWXA 4KNVA 4HQOA 3ZE8A 4BFUA 3ANLA 1IUKA 3JQDA 2A58A 4XZ3A 4BE7B 1QIJA 5FLKA 1PZNA 2J08A 3VDNB 4UJ3A 2F8LA 3QKIA 4V3BA 4HWGA 1UADA 1UANA 2HSGA 1XJCA 3NBYC 4DJFC 4K0KB 3CWZA 3MWEA 4I4TF 4X8LA 4G1FA 3I4LA 4B3CA 5CLJA 1SD2A 1N9GA 1ZX1A 3CR8A 3L77A 1H85A 1KWKA 3NIGB 4QPNA 4FWBA 3EDYA 4MI3A 3ZV7A 2KI5A 1V4VA 4TTQA 3SKXA 4D4MA 1X7WB 1PQWA 2BYTA 5I4BA 4ZV4A 2C83A 3MZ0A 1YNOA 2JGKA 4WGFA 4H6XA 1DFHA 4F4JA 2ZCJA 1QIEA 4WWHA 2XVAA 3N87A 4Y2HA 5DU2A 1LDNA 3WLJA 3WYAA 1YCDA 4UU7A 3D7KA 3MRSA 3C5WP 3NHMA 2G40A 1HE8B 2J8ZA 2P3SA 3DW1X 3IA7A 4FE3A 3PFGA 4NBWA 1E1QD 1MQ9A 2IXAA 3K2QA 5D00A 5EUCA 3EC1A 2GCOA 4WBNF 3U7GA 1WPRA 3JYNA 3BTSA 4PG6A 5IJ0A 4BFCA 3L49A 2WU3A 5EXPA 2VFAA 3AEQA 2P40A 3SAJA 4B7UA 2HJSA 1OE0A 2RGBA 3D6NB 4A7PA 2DFNA 1IHYA 3GNQA 4RMIA 3BWMA 3HKBB 5HF9A 5KB3A 1OZFA 1OMOA 4LY6A 2HT6A 3EXFB 4MWZA 1HDXA 2L17A 3CNEA 3S7ZA 4LHEA 2DGDA 3ZU4A 3U44B 5A4KA 3I0MA 3R6DA 2J3HA 3K6KA 4XDYA 3E3AA 1RBYA 3NNSA 5I9IA 3PWZA 1PFYA 4B3BA 3ZJVA 1R2QA 1NFRA 1SA0B 1EUDB 1UBOS 2YV1A 1GAXA 1GLNA 1CDEA 2WD7A 5IH3A 8ADHA 1SQSA 4G97A 1ZSVA 3CM0A 3VZCA 1M2VA 3JZFA 2BF4A 5FO1A 3LP8A 2OVFA 1GN9A 1A27A 3L01A 4IV8A 3KTDA 2JG3A 2YX1A 1OIVA 2F62A 2A14A 2LGJA 3CH7A 1P1KA 4YRCA 2B99A 3T41A 1VL8A 1P2UA 1GCOA 5BVHB 4ALKA 1QG6A 1JSXA 1ZINA 4NBUA 2XTAA 4RK7A 2W22A 3EIOA 1G98A 5AI6A 3EARA 3OM8A 4BKQA 5KNLA 1X1EA 1HURA 1NFFA 4Q19A 2O7SA 2LNDA 4Q4CA 4QM7A 1TT5A 4D4KA 3DLIA 3QEJA 3QNUA 1Y5MA 3AF5A 1UZLA 2MSLA 1ZWKA 4DKXA 1LS1A 2NZVG 5HK8A 2JGAA 3IOMA 3BE6A 3GEIA 1HFEL 3OZWA 5CTJA 5BMOA 4E3ZA 4RD3A 3MFYA 4Q39A 4OAOA 4MQFB 2C1XA 3E0XA 4EYGA 5DYWA 4YRJA 3WMFA 2ERCA 1Q1AA 1GSAA 4UU8A 4ZDKA 2ZBVA 1GQSA 1OR8A 1Q3HA 2IHJA 3NNNA 2OB1A 4YQZA 1R64A 2HHAA 2YQ5A 2D06A 3Q72A 4C5CA 4JBXA 1HTBA 5LDGA 3TLJA 2RI6A 4MHTA 1Z2EA 2NZYA 3ECSA 2IYZA 1NMQA 2Q3HA 3G2JA 4GICA 3I61A 5KX5B 1FSPA 3ABQB 2ACKA 4KQCA 2COEA 4O2AB 5BR7A 2Y1GA 4IX9A 4KMMA 2Q1UA 4JYCA 2Q5FA 2P8SA 4BMDA 4G9GA 4ZOLB 2HA5A 2LCQA 3E05A 4EYEA 5KYUA 1URPA 1G9XA 3VU0A 4AJHA 1TQ4A 1DOHA 1R0LA 2W6QA 1W48A 3PJDA 1T2UA 4H59A 4I55B 4RIGA 4KR7A 3G9QA 3IILA 1AQNA 5AIAA 2DQ4A 2ZXEA 3KJEA 3VHXA 2G0NA 2HU2A 1PQPA 2ZBPA 3MTGA 3TLEA 2ENUA 2Q27A 1NBME 3E22B 4IVQA 4JC4A 5I9MA 2N0SA 6LDHA 3H05A 1P62B 1VBKA 4BNHA 2YIJA 3BILA 1FFYA 3IKMB 1H23A 4UQOA 1KE2A 3AHJA 4Q3EA 4CW7A 4X1YA 4XIYA 4HXGA 3RDPA 4UNPA 2D0PB 1GGFA 1VXRA 4QXRA 4X41A 5F12A 3RV3A 3STWA 3MJFA 5LD2B 2XYPA 3COPA 3L04A 1WSAA 1XCPA 1DT5A 1DVRA 1MOSA 2BEWB 3V8RA 4DDMA 4LJAA 2V6IA 1Z0KA 2XRFA 3GLFB 3PK0A 2WDPA 5COAA 4E1BA 1GKIA 4ZKDA 5BNZA 4ZT2A 4AQDA 3TD9A 5B37A 1M5TA 2VHYA 2XITA 5EZ6B 2B6NA 2XKKA 2H5LA 2X1MA 3AT1A 3DEJA 3PNKA 5DV9A 4ZAWA 3DGEC 4CM9D 2BKXA 2XUQA 2TMKA 3R41A 3DKKA 1HSOA 1LDBA 2JCGA 3P9KA 2A0UA 2P6UA 2JLCA 3AP1A 4GPEA 3V2IA 9LDBA 1H5QA 1RWWA 2VH1A 5B6IA 2QUHA 1B8UA 1FSSA 3T3MB 1PK8A 1RZ3A 1Q0RA 2MIIA 1Y4AE 3KZKA 4LHXA 1U0HC 4HR7A 1D2GA 1L1EA 3PQ4A 2XVMA 2RHOA 1XGKA 2JIZA 2QX8A 4G1BA 4ZYTA 1GAJA 1GEEA 4BMPB 3JQ7B 1PHPA 1XZNA 4R1OA 2XCTB 6ABPA 3LLVA 2FW1A 2BDUA 4DEYA 5K1ZA 4DLXA 5C52B 3SR4A 5KSYA 3KL2A 4J9UE 2EATA 1LFDB 3NOQA 3SE0A 4PRZA 3V32A 4DBLE 1WCIA 4GPZA 1VG1A 5FLXA 4JYMA 1E6MA 4WESB 4HQ6A 5LP1A 4URWR 5E1BA 1HNZB 2PMFA 4YPOA 3R9XB 4MLCA 2XA9A 1KKLA 5IM4A 1Y8ZA 2BFOA 2JHGA 3T1QA 4CMJA 1R0KA 3QEAZ 4G9EA 1KO7A 4RS4A 1G41A 1HT3A 1PV1A 2WP0A 3RSFA 4E46A 2DXIA 4R2XA 3LCMA 4MCJA 3BSFA 3OJEA 4DXAA 1Q1QA 2BTQB 2GEUA 3OTIA 4MGEA 2JLAA 2I54A 3BWVA 1EFVA 1RAAA 2I8AA 1VYUA 3R6WA 2DHRA 1TPYA 1SVMA 1TCAA 2AVNA 2WU8A 2BJHA 4L72A 4OHCA 4U1RA 9MHTA 2AK2A 4X7BA 3IUQA 4PQFA 3AB3A 3WTBA 3VAYA 1ZIOA 4Q82A 4DCJA 5C1DA 1OH7A 1O8BA 4KGVA 3JALA 1NN3A 3EFEA 3CLRD 2PS0A 3BXPA 4GKKB 3ZDZB 4EGAA 3EDOA 2CYBA 4ZOQI 1TECE 1A4RA 1V1JA 2G7MC 3D6VA 3SC2A 3VI3B 2O8CB 3DQPA 4OHMA 3FROA 1EB9A 2VP5A 1O96A 1U65A 3B51X 3FUXA 4L7VA 1SCDA 5IC5A 2VSFA 1J06A 1ULSA 1THGA 3FJOA 3PZBA 3S81A 4G8DA 5DSXA 1WXHA 1IWOA 1H1LA 1TJ5A 3W78A 1TGVA 2AEJA 3UOGA 3PC4A 2OAP1 1EFLA 2P2GA 2RHDA 4M7OA 4NJMA 4BB9A 4CVNA 1ADFA 1GU7A 1C3JA 4CMGA 2JARA 4LSGA 2XGGA 2ZOSA 2YJNA 1R74A 3R6TA 1XAIA 2DJIA 3DYIA 3PD1A 4BFYA 4DA8A 3RRJA 3DCJA 1ZK1A 4LXQA 3HHEA 2IZ7A 1HEUA 5ADUS 2Q2WA 3NAQA 1KY3A 3LT5A 3BWBA 5FCDA 5LU9A 4S2UA 2O3SA 3GRKA 1YVEI 2OCLA 3D8TA 1BCRB 1CC1S 5CXXA 1L8OA 4OY3A 4DMHA 4KXUA 4M60A 3MLEA 1IK6A 3LBIA 1BKSB 2H1SA 2Q5OA 3ND6A 3P9PA 2C82A 3VUFA 1THMA 3SZ3A 3TGWA 4DRYA 5FYQA 4HK4A 3WBJA 1H8ED 4YQFA 3H16A 4UZFA 4XCQA 4XGQA 3O2JA 3WAKA 3EMKA 1KORA 1YASA 1VA4A 2PA0A 2PK3A 3ELUA 3GJYA 3LRPA 3SEZA 3WO0A 1EUQA 2QHXA 3O4FA 4MVJD 1OJLA 4ALNA 1IHXA 2ATEA 3KSDO 3MC1A 2X3YA 2P3OA 4JZYA 3V9PA 3WE7A 3D1JA 3WLSA 1GA4A 2VWPA 1BW9A 4L76A 1PJQA 4PLHA 4N6NA 1Z6GA 5DXAA 4KQGA 1WD7A 4B3IA 2RGCA 1C3OB 1LNSA 3QBVA 1JWLA 4NH0A 4R69A 4KV9A 3TR0A 4CM9A 2PS3A 2D62A 2QMZA 3B13B 4KLNA 1D8AA 4B6EA 5L3SB 2CV1A 2HF8A 5CW1A 3PPXA 3GGCA 1OD6A 2XXJA 3DXYA 4FC7A 5B1SA 3SU8A 3TCXB 3FR8A 3WL4A 1RFGE 3OD5A 4LZJA 4A91A 3CNHA 1JXOA 3JATA 1GZ6A 1RI3A 2AQHA 4KOEC 4O29A 2JLVA 4HNRA 4BJHB 5AM3A 1P60A 3K6JA 5LA6A 1V26A 2AKAB 5DI3A 3LO8A 4EFDA 1S4MA 4F06A 3DV0A 3KHKA 1I33A 3PQEA 4PIPA 2ODTX 4JT8A 2Y1CA 2ZTHA 4KIGA 1PW7A 2H1WA 4W4TA 2HBRA 5FOWA 4IV5A 2XXAB 3L8EA 2CE7A 2HF9A 4XX0A 3TEMA 5AVTA 5J5AA 2FPKA 4CV3A 3F67A 3D5EA 5DTJA 1N6KA 2QTLA 3ZXSA 4AZ3B 3FRHA 4PS1A 3L9XA 1UMDB 4C43A 5KWJA 4XSHA 1Z4IA 1XAHA 1L2TA 2VKQA 4U2CA 5E95A 4ZVTA 3W79A 4A73A 5LDHA 1QRUA 1MEOA 3TZ6A 5JMTA 1MD9A 5CD1A 3B6JA 1J25A 2JPDA 2DR2A 3H8SA 3T5TA 4J1TC 1FY2A 2JHCA 1QXSA 3ZWXA 2FAXA 3C4QA 2HZ7A 3MS4A 3Q98A 4ND6A 4BIIA 3I2JA 5GJWC 1CUHA 1I5RA 4UHHA 5CVTA 1ZR2A 2X6TA 1ZGZA 5BUSA 3ABRB 1YRAA 2WHEA 4YJGA 1LF0A 4FGWA 2IW1A 1CFJA 4UBMA 3WJ1A 3JWIA 1B8PA 1N9GB 2HEGA 4KXQA 2IY8A 3AEXA 3T9EA 4RSMA 4N12A 4BQFA 4FW9A 3CLHA 6Q21A 3RFUA 2DEUA 3L7JA 4HQRA 3I6IA 2PZBA 1L5NA 4L4UA 3ZHOA 1XZDA 4F96A 3ANXA 1HG1A 2R86A 1KF0A 1GTVA 1T3TA 2ATIA 4CCSA 4GO1A 2OE2A 1X1TA 3PG5A 3PSHA 4X7MA 1K6XA 2DKOA 2LPMA 4JN6B 5I5GA 2F64A 4K6FA 1G42A 5FWXA 2CXTA 5AVOA 4DBLC 4GI2A 3DOCA 3AI7A 2YN2A 3B1WA 4KN5A 4ER0A 1G8KA 1U2TA 2GCOB 3TNDA 5KNCD 5IJ0B 3F0TA 3GEDA 3AEQB 5LP6C 4PLFA 4PAQA 3WAGA 1FP4A 1KJJA 4HS9A 3JYPA 4MMZB 3VGPA 5C1OA 1FP6A 3ZWNA 2WZDA 3K1TA 4WNYA 1I9GA 1AS3A 1QGAA 3IR5A 3BD7A 4S0XA 3RODA 4OHZA 2GT1A 3HVHA 1EIZA 4ENTA 4XVCA 1J2EA 2WFAA 5C5CA 4UAJA 4CGYA 1DAKA 3IAAA 1L8LA 1NGSA 3FTDA 3L6EA 3OI7A 1C4KA 4JP5A 1HM5A 3S99A 1ZGCA 1NQ5A 2IYQA 3OLXA 4GIBA 5DHUA 3ZHVA 5A5GA 5CFLA 4R1NA 3GZNA 4HWOA 2RHTA 4ZHSA 2WJPA 1WZ2A 4DGSA 2WD7B 1PUIA 3ZDCA 2FE4A 2FG7C 1P5JA 3RB8A 1M2VB 1NLUA 1UBCA 2NYVA 4K3UA 4TXLA 5EQFA 2AOVA 5F7XA 3U6BA 4NCAA 2GF9A 2J3JA 4KGZA 1MN6A 3PQFA 1LVUA 2XMPA 2P6MA 2ZJZA 4XUGB 2AF4C 1HOXA 3W2HA 4M0MA 1H8EA 1CDDA 4R9UC 3SYTA 5IASA 1V47A 1NJFA 5JD4A 1LBTA 3EOAI 1DBRA 3S5UA 2IZ6A 2OD7A 5L6MB 3ZHZA 3U3RA 4BGVA 4O1MA 4RLFA 4CYMA 3CVWA 2CJYA 2PKWA 3BGDA 3TZQA 2G76A 2Q49A 2QS9A 5K8JB 1TT5B 3LYLA 3L1HA 1T4MA 4PZDA 1EBBA 1QS0A 2R2GA 4MWDA 3ZWYA 3DVQX 5A9SA 1MGOA 3RSOA 2C3UA 2Q5HA 5EOVA 5F33A 3G0HA 4G4SO 2EW8A 3EW7A 2HCBA 3MJRA 2EIXA 4K9MA 4PPGA 3GLKA 4BKRA 5BORA 1PJ8A 3R23A 3EH2A 3I76A 1ZXBA 1F06A 5JRZA 3L8ZA 3T9BA 1R9GA 1JEYA 2BGGA 4IL5A 3VZSA 3ZGXA 1PEDA 1Q3KA 1UM8A 2W2OA 1QCZA 3GGPA 5TMBA 2Q2OA 4G3XA 3PRHA 3U31A 2QG9A 3AR8A 1IE3A 1IC6A 4BCDA 3W04A 1VI6A 4HPJB 1DWOA 4YJ2A 1KR5A 2OKGA 4K6OA 4BJ6A 4C08A 4GVLA 1E6LA 4OSPA 3A10A 5DGIA 3BWEA 3HGQA 1SPXA 1KETA 1N9ZA 1T2AA 2K5UA 1CZUA 4BNKA 4P3PA 5A4MS 1LTQA 3QUAA 1C1YA 1QPGA 1RZVA 1XPJA 2ZQZA 2WUGA 3DPSA 4LTDA 3T3DA 4WCVA 5A5VA 2XD4A 1PQUA 1RYFA 3A1TA 5IN4A 1BKDR 1IHUA 1S7CA 1YZUA 1IM2A 4ISBA 4KLRA 1ZJZA 4OHYA 3LT4A 4TV9B 4UZSA 5AKIA 1C7ZA 1OYYA 3B2NA 1PJCA 3ZXIA 4GZ3A 5KYUB 3EZYA 2Q4RA 3GARA 2H48A 3IKTA 1XX6A 2IEYA 2JGLA 1U8AA 5K2OA 3HWSA 5I8PA 4YY3B 4QM6A 4X84A 1EK2A 3L0PA 3VHXB 1Q7BA 3ZCPA 4W9NC 5G0VA 3QP9A 2HWUA 1K88A 3OLVA 4QFCA 3T5MA 4H0FA 4BQIA 2W98A 2GZDA 3ICPA 2NSYA 1KQGA 2BHTA 4X1YB 4YGYA 5IW8A 1CNFA 3WLAA 2QR5A 1N6OA 4B71A 2NUTA 3NM4A 2YFHA 1SVNA 4V38A 4MPJA 4R8SA 5I7AA 2RKWA 3HDGA 1QOPB 1ZKMA 5FUYA 3WLMA 4YT8A 2NO5A 1BAPA 3FR7A 3JYQA 1QTIA 1N2CA 2FEAA 2LCIA 4P7BA 1NVVR 4R7ZA 4X5OA 3WB9A 3SJCA 1YH3A 2PO5A 4OCZA 4YQEA 4ZAGA 5TNXA 1E99A 1XTSA 5KNCA 3RK0A 3TLMA 1QQ6A 1VPTA 4X60A 2F1IA 2WW8A 3GA7A 1IN5A 1FE8A 1NR5A 2NV0A 5FT9A 2GZSA 1WMAA 3IP7A 3GUVA 1HLGA 2GEDA 3MUNA 2A33A 5JVDB 4ZJZA 1Z8DA 3O8OA 1YBHA 1Q57A 2GJSA 4RTSA 4BQNA 4GG1A 1NXQA 4KO8A 5IC4A 1BH2A 3RJ5A 3N6XA 1IB6A 4K05A 2AG8A 2VZLA 1FW8A 3LVQE 3DG9A 3L5KA 2VNHA 2AX3A 2JI8A 5D3MB 1JHPA 1CK4A 4B31A 2C4HA 4CQMD 1NOJA 2V6FA 3PNLA 1TJ4A 2F8MA 3KEOA 3LNTA 3R4CA 2FNAA 5H4GA 2WFZA 1UJ5A 1UDXA 2C5LA 3C48A 3UAOA 2CBXA 1KMCA 4C87A 5MN5A 3MJ4A 3VTKA 1WCIB 4WBSA 4DIFA 5ADHA 3SEAA 2Y1FA 1TO2E 2Y67A 1T2FA 1F48A 4L9SA 3WXBA 1G1MA 2LCFA 2HRBA 2F17A 1ZIDA 3NTVA 2FZEA 4RE5A 3RIEA 3UV3A 1TM5E 4F8EA 1EWVA 5IDVA 3KSAC 2J5KA 4ZV7A 1RHKA 3OFND 2PEYA 4G9BA 3W77A 2A9OA 4EF6A 5JD6A 1Z4LA 2C2WA 2C7OA 3UB2A 2Q8NA 1YFLA 2JZOA 3FFAA 4YT5A 1J70A 3QE0A 3MELA 4LF8B 3DOHA 4DIUA 1AV7A 2GAJA 3DTTA 1WW2A 4UUBA 4HWKA 4W82A 4Q4DA 1CHDA 3FRIA 5JI2E 2PR2A 2QZSA 5AJXA 2C4NA 1PBNA 2HO5A 2IE0A 1CRQA 2A1TR 2QD1A 3JALB 3KXIA 3BWCA 2C7GA 3NHPA 4KTVE 1O3YA 2O6LA 2VSNA 4WCFB 1UC8A 4LZOA 3EQ8A 1EXMA 2QA5A 3SC2B 3T94A 1NXTA 3LLUA 1NI4A 1BJTA 1RBMA 3H11A 3W2FA 2AW5A 4LN1A 1I8TA 1O96B 2QGFA 3T1HB 4CN8A 2E3JA 4TV8A 1OC2A 4KN6A 4U7GA 4Z5XA 5K3CA 3FCXA 4B87A 1UR5A 3Q9LA 1PU2A 5E6SA 1ZIXA 3C4JA 3ND7A 2PWYA 3QYFA 4L5IA 4LCBA 3T95A 1H1LB 2VUTA 1KEUA 3SYKA 2KLHA 4AUMA 4YMGA 3O4GA 3B6EA 1GU0A 4NJMB 1XEFA 4NULA 2ANBA 5FI5A 4CR7A 5I9BA 1JPJA 5L4SA 1TJ3A 3RS2A 3ETLA 1UBJS 4U2KA 5L45A 1GQRA 4WEQA 4WDQA 3O9MA 5LB4A 4LYAA 5F4ZA 3HFRA 5KYWA 3MQFA 1H8HA 1P1IA 1Y1RA 1EE1A 2GEVA 2YICA 4KZPA 4URHA 4UNIA 1A8QA 5KEIA 3SN6A 4QUJA 4RPHA 3JQAD 1PT9A 3KU4A 3ZLTA 1T6ZA 2C4WA 3WFIA 1Z3CA 1EDOA 2VRWA 3PP8A 2JLRA 4K2AA 2JI4A 3ZC3A 1Z75A 3TE7A 2NXJA 3DDSA 3QY9A 1NMXA 3QFHA 2AWNA 2G1AA 4OU4A 4TPKA 5U1PA 5LR6A 4MP8A 4HQNA 4IJQA 3K05A 4JGIA 3QW4B 1Z3IX 4XYEA 3H5WA 2FQWA 5LUBA 1B6TA 4LMRA 5J2UF 5HDBB 2DKFA 4JL6A 4C76A 1HDIA 4G37A 1BW9B 1JXQA 3D9QX 4R41A 4EW1A 1E0AA 3OEWA 1U7ZA 1MJGA 1QHSA 4LDQA 4TQ9A 4EOGA 1J8FA 4DG9A 4FMBB 4QYTA 1NG1A 2BGKA 2JFWA 3VR5A 3JATB 2H8GA 4QLOA 1A98A 1DCFA 5LA6B 5IHPA 3H2GA 4KR9A 5DI3B 4CQMA 3WHKA 2YZ7A 3R24A 4EJSC 5ED4A 3DV0B 4FE4A 1GNLA 5B1EA 3U6KA 1RI2A 2DHQA 2NN3C 4DCMA 4L6CA 4BDSA 1DC5A 2MTBA 2VDOB 1DUVG 1EPUA 2XZTA 2ZSJA 3T7EA 3U19A 3K0HA 1N78A 3AHIA 2Q2QA 1QCYA 4Q4JA 4XX0B 3V8BA 1EXVA 4JI2B 2AI2A 4HLDA 4GAEA 3ZD6A 4MV9A 4EAQA 4OO3A 4G0NA 4X3CA 5B3AA 1RU3A 2I6QA 4NESA 5CDHA 1A2BA 2IHBA 2WFLA 3CG0A 3UJHA 4MLZA 1E3IA 4D41A 4YCMA 1XE3A 2JLUA 2HT1A 2OV1A 1ZI6A 3MQ2A 5F51A 4P31A 4UW9A 2XYVA 2VNJA 3F90A 5ICSA 2WMDA 4WXHA 3RWBA 4D5EA 4K9LA 4ZI2A 4DDVA 4UFNA 3BF7A 3OFNA 3Q9UA 1P61B 1JVNA 2FPWA 4BVAA 2CWDA 3EGVA 4FM9A 4KIWA 1EMDA 1EFRD 4YJGB 2RH5A 4X8HA 5JPIA 4HGYA 4YUZA 3TW8A 3F4KA 2A1IA 4XOIA 1GCIA 4XFDA 3MWKA 1G21A 1J0XO 4Z1MD 1JJAA 2HMYB 2I4IA 1L5KA 3SIRA 4MOWA 2C5GA 3F3YA 4AECA 1OVGA 1WY7A 5G4KA 2VQ3A 1D5CA 3TAUA 2OL4A 3LBNA 5A4JA 5NLLA 3JZDA 3QE4A 4OX9Y 1WPQA 3OJFA 5FWXB 3PD0A 3FDFA 4PN3A 1KYYA 1ZNYA 2AZMA 2DWPA 1IMJA 4QNMA 3TRJA 4JT4A 1QO7A 2IYYA 5JY1A 5KSZA 3EZFA 3QY0A 4TXNA 4A0RA 2TECE 2YY6A 1HDCA 4J49A 1FP4B 1IDOA 4B6SA 2WB2A 3UMCA 2BN4A 3KBOA 2NZWA 2HF2A 1RXEA 2X9VA 4A4DA 2QX7A 1PT6A 4IG4A 4KDRA 5DT9A 3INYA 1PEAA 1X1AA 3GNSA 4M37A 4UMDA 4RQAA 2GASA 4Q1AA 2HCRA 2P2CA 4F6CA 5AUOB 3KQNA 1ITZA 1MP0A 1Q44A 3AW8A 2GCPA 4PO9A 3VU8A 3RPEA 4BFTA 3WLNA 4L4YA 2FUCA 1AN0A 2BCJQ 2WJZB 3GZNB 3K1AB 3NIWA 1QMGA 4UC0A 1Y5NA 3H5IA 1G2IA 3EQ9A 2ALJA 1NXPA 1NURA 4LC9A 1QIGA 4EWLA 1U7XA 1JQ5A 1N3LA 1A8IA 2Q3MA 2ONKA 2XD9A 5KNCH 1L5MA 2QX9A 2VXYA 2DY1A 3Q6MA 4QXMA 4XLZA 2YHAA 1WBBA 2RBKA 1ZPDA 2HMWA 4J0DA 2V5AA 2YMPA 3NGMA 2D8AA 1SKAA 4NMWA 4PZYA 1GJRA 2ODEA 3JQ9C 5G0UA 4J16C 4DCTA 5JBQA 4CR8A 3AX6A 1XKXA 1KWGA 3QPAA 5JS1A 4HSEA 3PDJA 3ASYA 3K9NA 4FEAA 1YB4A 3CPEA 4K9RA 2DUJA 4KH0A 4E7PA 4DV2B 1ESEA 1VJGA 3QWFA 4O4HA 3G8DA 3QNWA 1FP1D 4IGEA 1NNUA 1PLKA 4LZWA 1WXFA 4OFBA 3OPVA 2MYUA 3ABOB 3AYXB 3C6QA 2XT9A 1QS0B 3NV7A 4YECA 2F8SA 2ZKIA 2XYHA 3GMDA 3IUEA 5A9SB 5JZOA 2OCYC 3VHQA 1DQZA 1G20E 2J59A 3MAGA 1XB2A 3SHWA 3S2EA 1WTCA 4TSKA 1IONA 1L5WA 1UJBA 2WZBA 1DADA 4PYRA 4DNOA 2C1EA 3QU9A 2VYFA 1IN7A 4FYVA 5C81A 1I32A 4HEJA 2AG0A 2MU1A 3UT5A 1W4RA 2BM1A 4EG3A 4GR9A 4JXJA 1JEYB 4H6VA 1X42A 3WYEA 4DADA 1PDWA 1VA5A 2IE8A 2CYCA 1X0VA 3KOUA 3FWYA 4D8UA 4E22A 3VAZA 2CHUA 3M6IA 4JR1A 2HLPA 2J7PD 3HYTA 3I92A 3MOIA 4HNQA 4MB2A 4QC2A 4EECA 4UNRA 3SC6A 4DCCA 5H0IA 5FNVA 4LE1A 5KWEA 1E3TA 4RWEA 2VG8A 1TOAA 4ZCTA 3HFJA 1EJ0A 1YA6A 1N5JA 4N5HX 1U9CA 4BNVA 5IDYA 4COOA 3BEDA 4YMUA 4TLBA 4DKJA 3AJAA 1B2LA 3O21A 3Q41A 5CIQA 4C0XA 3OP4A 2YKGA 4I99A 2J0SA 2XI4A 3C15C 2GLUA 3Q88A 5P21A 1NSTA 1LQUA 1W9MA 2A9VA 1I4LD 2D13A 2JBAA 3RJMA 4D82A 2EW1A 3L7NA 2XCUA 1G5PA 3WB2A 1UF9A 4WACA 1K75A 1RC0A 4L57A 4YLGA 3SMVA 3NANA 2ZRQA 4Z9FA 3VISA 3Q7RA 1W2WB 3CO0S 4DILA 4CKYA 4H9GA 4N8EA 1IJKA 5LBIA 3TIFA 1YF3A 1W0JA 1WY5A 2XUKA 3JQCA 3QWHA 1CBUA 4B6QA 1RS0A 1DFIA 1PWYE 1GTL1 1RLMA 3ASVA 4Z1MA 3TL3A 2IKQA 4KWIA 5A7GA 4OMFG 2NUTB 2P9BA 4KE7A 2H6EA 4YP9A 1AHIA 1AM4D 1Y1LA 3EPRA 5BQ3A 5KKCA 4N6OA 4X94A 3Q8LA 2CJWA 1N2CB 4ZZ1A 3E58A 3VNRA 1P5HA 3A1CA 2BUAA 2A0YA 1M0WA 1UP4A 2ACWA 4Y9RA 4W9NA 2JCVA 4KQ1A 4OHFA 5KDOA 2R7LA 3B9PA 2C5EA 1AA6A 4XVRA 4DSZA 3UGQA 2QYHA 4XM2A 1TUBA 2YRFA 2CVQA 4TLEA 5BW6B 4B44A 2A0KA 2YN0A 1XKLA 3I12A 2XA1A 5CT8A 3KT6A 3PQDA 4B85A 3O8OB 4MW1A 1VMAA 3EDCA 4LKRA 1Z5UA 2IU0A 3BDIA 2ZJYA 1RRMA 5DHFA 2C4KA 4Q7MB 3OIVA 3V33A 2EX0A 3PTAA 1BXKA 1V2GA 1U1FA 3A4YA 3LU1A 3U7FB 2H2GA 3EZNA 1PD1A 3I30X 5KQMA 1V4BA 4NJOA 3O3OB 1DRVA 3VSBA 1BQ4A 4AJPA 1GDHA 2ET6A 2LWIA 2RGEA 1V1RA 3LWDA 4URYR 1VE3A 4D46A 5JU6A 3B3AA 5B36A 5GOTA 5LN1A 3VDQA 4C29A 1C7IA 2NU7A 5C3UA 1JHAA 4IBOA 3RAFC 3G0GA 4I8IA 4JYPA 1P1RA 2RB4A 4TTVA 4ER3A 3WWCA 2QKYA 4XDZA 1VIYA 1Z73A 1ATZA 3AV0B 3HLTA 1XD8A 1LLCA 4D8WA 3P2KA 5FHRA 1T8WA 4UE2A 3ZV5A 4F4HA 2HFKA 2OHXA 2VJAA 3TTTA 5JC8A 3UF0A 4ZAVA 4B83A 1H0HA 2P9FA 4CT4B 1MC4A 2BEKA 2VRNA 5B4UA 3VR5H 3O8DA 3ZDDA 3RRBA 4M0LA 5IN5A 1ONPA 2WWYA 1TLFA 4UATA 3T5PA 1VB3A 4RGBA 3KEFA 4QOFA 2IGBA 4HZGA 3GZ4A 2P2NA 2MMCA 2RH4A 3QBDA 4KZKA 5FL3A 1WM1A 3MBKA 3KKEA 1UFKA 1BWQA 4FFSA 4WFJA 3HJAA 1NZJA 1XMXA 3BN3A 4N7MA 1W8IA 3TO5A 2Z2XA 2BFPA 3QXJA 3SFZA 1KYIA 3ZD7A 1FFCA 1X1SA 3MW8A 4PAGA 4A3SA 1KEPA 3ON5A 1Z6ZA 1JDPA 2YBDA 2Q4TA 4FOLA 3CJQA 4JXXA 2VK2A 4C6RA 3QMPA 3UBMA 4EGCB 1YNSA 4YMTA 3HUTA 1J23A 2GVNA 3FWPA 1NI4B 3H11B 4RENA 4G5QA 3C45A 5KTNA 3TOCA 3DMRA 5K8VA 3NC0C 4TV8B 1Z29A 1KMMA 3UV7A 1I7SB 3SZGA 5E6SB 3R75A 1JDVA 5C5EA 2XWJI 3RS3A 1KPIA 3A2LA 1IY8A 1ZU5A 4JR2A 1VECA 3OZIA 5GV8A 1HQCA 2BW0A 3I2HA 3EZ2A 3WOHA 3OFSA 5LJIA 1RLIA 1YHZA 4OLBA 3AG6A 5AESA 3TVTA 4NTZA 3SEFA 3P52A 3U9LA 5CDTA 4LYHA 1XL1A 4OXYA 1LB1B 1XYYA 2XUIA 4B33A 5CDSA 3TB6A 4ZVRA 1WDMA 4K9PA 2O1EA 1KJZA 1Q16A 4POOA 1Z82A 4G1UC 4D3SA 3M33A 2FEKA 5AOCA 4IYRA 5TX7A 2R2AA 5JQGA 1NVVQ 1NC3A 2CY0A 3QWAA 5JNSA 2ZJ4A 2DPXA 3DYBA 2CLOB 2DHCA 4YAJA 5ALTA 4AM8A 3N8HA 4ZT5A 2QQFA 2ID7A 3P9IA 5HKKD 3R0IA 2IIPA 4G0ZA 3LGAA 421PA 1TLLA 3R0QA 2NXNA 4P33A 3C8UA 3Q5GA 2OZPA 1DIAA 2JHAA 3V8QA 5H81A 3M1IA 4OLHA 3BA6A 1SVSA 2IDMA 4XQ9A 2C54A 2D5AA 2WAXA 2OSBA 3ABZA 4J3FA 1WBDA 2CXNA 2F6RA 5KVCA 1WD5A 4OIMA 5DLDA 3ST7A 2KSQA 4R1LA 4AJ2A 4LOIA 1RRPA 5T5QA 3VNSA 4QUDA 3HU1A 4PXAA 3W06A 3F1KA 1Z5ZA 3DMDA 1EIWA 1WCWA 3IQXA 1SKBA 4WY8A 3ZZUA 5K01A 2W43A 3K15A 3TOXA 4INPA 1DEHA 1I30A 3AFNA 3IOBA 4LFBB 2P78A 1N8KA 2IZZA 4CQMB 3R0XA 2HFJA 3LDHA 4Y18A 2C20A 2D0DA 2CL5A 3DCIA 5GADl 3KOXA 1CZNA 3ROGA 2R5FA 3DDCA 4Q4JB 2W2VA 4TM8A 4PQGA 1NPYA 3AM4A 1U2ZA 2GAAA 5AH0A 1YWGO 3DFFA 4L78A 4LVOA 3Q0IA 4OG2A 3M0EA 1M8JA 1LEHA 1IBMB 3KKZA 2WFLB 5JCZA 1F3LA 1K4YA 4ZYXA 5FUVA 2P2DA 2QN1A 4GLJA 4P34A 1QHGA 2DG2A 1JKFA 2X0IA 5GGXA 4KWHA 1G8HA 3FTEA 4XGIA 1GCAA 4ODIA 1PE0A 3F1LA 3PNYA 4RVUA 3RC3A 4MJ7A 3L7KA 1A8SA 1EEHA 3BC1A 2BBOA 4KAAA 4F2PA 5JQGF 2V59A 4G36A 2F90A 4N9WA 2JLQA 3KPWA 4IFIA 5A3SA 3TW8B 2C78A 4KUGA 3ZGOA 4N3BA 4CMKA 3GRPA 4JSRA 2J3IA 2CD7A 4OFZA 4ZQIA 1G21B 4WJKB 1EUZA 3ZVLA 5A9RA 4AQYB 4JBHA 1TI7A 2BKAA 4EI9A 3P0EA 4TMYA 2ZYDA 5G4KB 3DBVO 5H68A 3VV3A 3OUTA 2ZR7A 3HUEA 3QMVA 4MHSA 1CERA 1F8GA 1WLYA 2H16A 1F8YA 2C2ZA 3EZ9A 3H5LA 2Q1SA 3JD2A 5F7ZA 3TRHA 1G5TA 4MIEA 3ORRA 1EU1A 2QM8A 4B8ZA 4CTMA 1KFEB 4WGGA 4M89A 4NECA 1DXQA 1KAOA 4IXTA 2D00A 2PKXA 5EP3A 5JTUA 5JVDA 4IR7A 1A9RA 1SZPA 5F7JA 3T7AA 1GL3A 2XWPA 1YQUA 2ZT8A 4NCHA 4UEKA 2BR4A 3HCRA 4D98A 2OD9A 1F2TA 1MO5A 2O4CA 5CPFA 1PHRA 3UWDA 1UWVA 4KQEA 4N9QA 4FC6A 3TGLA 1IQUA 4R8KA 1NQVA 2PMKA 4PYJA 1PL6A 2OEPA 2TSYB 3KVNA 5ILOA 3PKJA 3EXHA 3W8RA 3DZIA 5HF8A 5KX5F 3HY4A 2R7NA 2ZREA 2C2MA 5AM2A 1YI0A 4O2AF 4P7GA 1VHJA 5CHYA 4ZVNA 4JDUA 3K9GA 3H65A 5B7GA 3BIJA 4PPNA 4UFOA 1SH7A 2YFQA 1PT7A 2H92A 3FFBA 4B17A 1U6KA 2O48X 2XUHA 4MGYR 2FPUA 2YY5A 1VPDA 5CT6A 5K4GA 1N7GA 4OGWA 3HWRA 2R7KA 3SSNA 3IQWA 2MHCA 4OXKA 5KJ1A 3LPCA 2ZM6B 1CFZA 1Y0BA 1SBYA 1UQTA 2OR3A 2ZB7A 4RH3A 3UAGA 4Z4HA 5JEDA 4KR2A 1TX4B 1ZL2A 3D3WA 1YJQA 4BLWA 4AX4A 4I55F 2CXPA 4RGVA 4BFXA 3QHQA 2GERA 4W1SA 2PX6A 1XTZA 4PHFA 4IJKA 2Z95A 2ZTVA 3N8GA 5AW4A 4B3TB 2CEKA 3QWBA 4O4HB 4BVBA 3ETJA 2AZDA 4PSVA 4H4CA 1LRKA 3PGA1 4PHHA 3Q3HA 4BWFB 4LRUA 3LXXA 3KYIB 3ZWMA 4BEVA 2FMXA 1NP6A 3HFGA 4INOA 3LWNA 1S4QA 2I0FA 3B3GA 4MKZA 4ZPXA 3QE9Y 2V58A 3TIXB 1KBQA 4IUYA 4MJLA 1I4EB 1V7PC 3NR2A 4A5OA 1DJQA 2HJGA 4YREA 4RM2A 1M2EA 4W5JA 4D4IA 2MINA 2VOJA 1V25A 3PICA 1N6LA 3VYVA 4QGHA 4FX2A 1OASA 1XZLA 1RHRA 4I2NA 1CNEA 2C58A 2VJDA 4HAVA 2QAIA 1ADBA 1CUIA 1Z5VA 3TX6A 5AW9A 4FX5A 3ZW7A 5JXWA 4DV5B 3AQIA 5HIKA 2J0VA 2GCIA 1KSHA 2UKDA 2FJ0A 4PGMA 1E64A 1SKYB 3GF4A 1ST3A 3Q0TA 2WJAA 1AUOA 1C30A 2ZYTX 3O2QB 5FNVB 3T7KA 4B75A 1OYOA 4XPZA 2AMFA 3BS4A 2WHYA 4DLBA 1LK7A 4MVJE 2V0CA 2JJ2D 1YFJA 4LFAB 2W48A 4CLOA 1JQEA 2JGRA 3LNCA 2Q5JA 1DC3A 3IULA 3KUDA 3FSEA 4JYZA 1Y6GA 3UHOA 2KM1A 1ZAKA 2R6ZA 3ZHYA 4FFDA 3EBLA 3PPVA 1HORA 2JBAB 2RSLA 3D8RA 5CB0A 2QI9F 1HY3A 3DEZA 2VP0A 4GT1A 4HAXA 4IAOA 1Q0HA 1UKCA 4S2EA 4UU0A 4UHEA 4ZQEA 4DY6A 1Y89A 4DDWA 4AWXA 1IB0A 1PWEA 2ECKA 2WHRA 1NQOA 4BECA 2I3ZA 3MJHA 3INTA 3H04A 2PGOA 1Z2OX 5JSUA 3CSDA 4KR3A 1OFTA 1T5DX 3BJIC 3FUUA 3KZOA 4X20A 4YRPA 3T4UA 1PVOA 2NUPA 2J6IA 3E2MA 3ZV3A 2R7MA 1E9EA 4KTTE 5IS2A