1HXS4

Crystal structure of mahoney strain of poliovirus at 2.2a resolution
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
68
structure length
68
Chain Sequence
GAQVSSQKVGAHENSNRAYGGSTINYTTINYYRDSASNAASKQDFSQDPSKFTEPIKDVLIKTAPMLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GENOME POLYPROTEIN, COAT PROTEIN VP1
publication title Ab initio phasing of high-symmetry macromolecular complexes: successful phasing of authentic poliovirus data to 3.0 A resolution.
pubmed doi rcsb
molecule tags Virus
total genus 4
structure length 68
sequence length 68
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2001-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
4 PF02226 Pico_P1A Picornavirus coat protein (VP4)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.80.10 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 Picornavirus coat protein VP4 1hxs400
1VBE4 1RMU4 3JBG4 1COV4 1BEV4 1NA1D 1RUG4 1RUH4 1RUI4 2X5ID 1HRI4 1OOPD 1RUJ4 1RVF4 1AR84 1Z7S4 2RS34 4Q4V4 1VBD4 1PO14 1VRH4 4Q4W4 2RR14 1PVC4 1POV0 1MQTD 2RS54 2R074 1RUE4 1AL24 2R044 4PDWD 3J8F4 2RM24 1RUC4 1D4M4 1AR74 1HXS4 1PO24 4RHV4 1EAH4 1RUF4 2R064 1VBA4 1EV14 1VBC4 3JD74 1AR64 1H8TD 2RMU4 2RS14 1R084 1RUD4 4GB34 1PIV4 1K5MD 2HWC4 1RHI4 1NCQD 1AR94 2PLV4 1VBB4 2HWB4 4Q4Y4 1HRV4 1ASJ4 4Q4X4 1R094
chains in the Genus database with same CATH superfamily
3JBG4 1NA1D 1RUH4 1RUJ4 3SFDA 1VRH4 1PVC4 1MQTD 2RS54 2R074 4PDWD 1AL24 2H88A 1YQ3A 3VR9A 1PO24 4RHV4 1VBA4 1VBC4 3P4RA 4YSZA 2FBWA 2R7FA 1R084 1RHI4 1VBB4 4YT0A 3SFEA 5C3JA 1KF6A 1COV4 1BEV4 3AE7A 2PZSA 3CIRA 1Z7S4 4Q4V4 1VBD4 2WS3A 1POV0 1XHXA 3AEAA 3J8F4 2RM24 3VRAA 3AEDA 1YQ4A 4KX6A 1RUF4 2R064 3ABVA 3AEFA 3VRBA 2WDRA 3FI7A 3JD74 1H8TD 1KFYA 3AECA 2WU5A 1PIV4 1K5MD 3SUCA 1NCQD 2WQYA 2HWB4 4Q4X4 1R094 1XHZA 2WP9A 1RUG4 1RUI4 3AEGA 3VR8A 1RVF4 1AR84 2H89A 1PO14 2PW9A 4Q4W4 3AE3A 1RUE4 2WU2A 2R044 3AE9A 2PYJA 1RUC4 4YTPA 1AR74 3AE1A 1AR64 1NEKA 3P4PA 3P4SA 1RUD4 3AEBA 1XI1A 2HWC4 3GQKA 4YTMA 5C2TA 4Q4Y4 1ASJ4 2PYLA 2B76A 3AE5A 1VBE4 1RMU4 2X5ID 1HRI4 1OOPD 2RS34 1ZP0A 3AE2A 2RR14 3AEEA 4YSYA 3AE4A 2ACZA 2WDQA 1D4M4 1HXS4 2EX3A 1EAH4 3GQHA 1EV14 1NENA 4YSXA 1ZOYA 3P4QA 2RMU4 2RS14 4YXDA 2WDVA 4GB34 2PY5A 3AE6A 1AR94 2PLV4 1L0VA 4YTNA 1HRV4 3AE8A
chains in the Genus database with same CATH topology
1VBE4 1RMU4 3JBG4 1COV4 1BEV4 1NA1D 1RUG4 1RUH4 1RUI4 2X5ID 1HRI4 1OOPD 1RUJ4 1RVF4 1AR84 1Z7S4 2RS34 4Q4V4 1VBD4 1PO14 1VRH4 4Q4W4 2RR14 1PVC4 1POV0 1MQTD 2RS54 2R074 1RUE4 1AL24 2R044 4PDWD 3J8F4 2RM24 1RUC4 1D4M4 1AR74 1HXS4 1PO24 4RHV4 1EAH4 1RUF4 2R064 1VBA4 1EV14 1VBC4 3JD74 1AR64 1H8TD 2RMU4 2RS14 1R084 1RUD4 4GB34 1PIV4 1K5MD 2HWC4 1RHI4 1NCQD 1AR94 2PLV4 1VBB4 2HWB4 4Q4Y4 1HRV4 1ASJ4 4Q4X4 1R094
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VBE 4;  1RMU 4;  3JBG 4;  1COV 4;  1BEV 4;  1NA1 D;  1RUG 4;  1RUH 4;  1RUI 4;  2X5I D;  1HRI 4;  1OOP D;  1RUJ 4;  1RVF 4;  1AR8 4;  1Z7S 4;  2RS3 4;  4Q4V 4;  1VBD 4;  1PO1 4;  1VRH 4;  4Q4W 4;  2RR1 4;  1PVC 4;  1POV 0;  1MQT D;  2RS5 4;  2R07 4;  1RUE 4;  1AL2 4;  2R04 4;  4PDW D;  3J8F 4;  2RM2 4;  1RUC 4;  1D4M 4;  1AR7 4;  1HXS 4;  1PO2 4;  4RHV 4;  1EAH 4;  1RUF 4;  2R06 4;  1VBA 4;  1EV1 4;  1VBC 4;  3JD7 4;  1AR6 4;  1H8T D;  2RMU 4;  2RS1 4;  1R08 4;  1RUD 4;  4GB3 4;  1PIV 4;  1K5M D;  2HWC 4;  1RHI 4;  1NCQ D;  1AR9 4;  2PLV 4;  1VBB 4;  2HWB 4;  4Q4Y 4;  1HRV 4;  1ASJ 4;  4Q4X 4;  1R09 4; 
#chains in the Genus database with same CATH topology
 3JBG 4;  1NA1 D;  1RUH 4;  1RUJ 4;  3SFD A;  1VRH 4;  1PVC 4;  1MQT D;  2RS5 4;  2R07 4;  4PDW D;  1AL2 4;  2H88 A;  1YQ3 A;  3VR9 A;  1PO2 4;  4RHV 4;  1VBA 4;  1VBC 4;  3P4R A;  4YSZ A;  2FBW A;  2R7F A;  1R08 4;  1RHI 4;  1VBB 4;  4YT0 A;  3SFE A;  5C3J A;  1KF6 A;  1COV 4;  1BEV 4;  3AE7 A;  2PZS A;  3CIR A;  1Z7S 4;  4Q4V 4;  1VBD 4;  2WS3 A;  1POV 0;  1XHX A;  3AEA A;  3J8F 4;  2RM2 4;  3VRA A;  3AED A;  1YQ4 A;  4KX6 A;  1RUF 4;  2R06 4;  3ABV A;  3AEF A;  3VRB A;  2WDR A;  3FI7 A;  3JD7 4;  1H8T D;  1KFY A;  3AEC A;  2WU5 A;  1PIV 4;  1K5M D;  3SUC A;  1NCQ D;  2WQY A;  2HWB 4;  4Q4X 4;  1R09 4;  1XHZ A;  2WP9 A;  1RUG 4;  1RUI 4;  3AEG A;  3VR8 A;  1RVF 4;  1AR8 4;  2H89 A;  1PO1 4;  2PW9 A;  4Q4W 4;  3AE3 A;  1RUE 4;  2WU2 A;  2R04 4;  3AE9 A;  2PYJ A;  1RUC 4;  4YTP A;  1AR7 4;  3AE1 A;  1AR6 4;  1NEK A;  3P4P A;  3P4S A;  1RUD 4;  3AEB A;  1XI1 A;  2HWC 4;  3GQK A;  4YTM A;  5C2T A;  4Q4Y 4;  1ASJ 4;  2PYL A;  2B76 A;  3AE5 A;  1VBE 4;  1RMU 4;  2X5I D;  1HRI 4;  1OOP D;  2RS3 4;  1ZP0 A;  3AE2 A;  2RR1 4;  3AEE A;  4YSY A;  3AE4 A;  2ACZ A;  2WDQ A;  1D4M 4;  1HXS 4;  2EX3 A;  1EAH 4;  3GQH A;  1EV1 4;  1NEN A;  4YSX A;  1ZOY A;  3P4Q A;  2RMU 4;  2RS1 4;  4YXD A;  2WDV A;  4GB3 4;  2PY5 A;  3AE6 A;  1AR9 4;  2PLV 4;  1L0V A;  4YTN A;  1HRV 4;  3AE8 A; 
#chains in the Genus database with same CATH homology
 1VBE 4;  1RMU 4;  3JBG 4;  1COV 4;  1BEV 4;  1NA1 D;  1RUG 4;  1RUH 4;  1RUI 4;  2X5I D;  1HRI 4;  1OOP D;  1RUJ 4;  1RVF 4;  1AR8 4;  1Z7S 4;  2RS3 4;  4Q4V 4;  1VBD 4;  1PO1 4;  1VRH 4;  4Q4W 4;  2RR1 4;  1PVC 4;  1POV 0;  1MQT D;  2RS5 4;  2R07 4;  1RUE 4;  1AL2 4;  2R04 4;  4PDW D;  3J8F 4;  2RM2 4;  1RUC 4;  1D4M 4;  1AR7 4;  1HXS 4;  1PO2 4;  4RHV 4;  1EAH 4;  1RUF 4;  2R06 4;  1VBA 4;  1EV1 4;  1VBC 4;  3JD7 4;  1AR6 4;  1H8T D;  2RMU 4;  2RS1 4;  1R08 4;  1RUD 4;  4GB3 4;  1PIV 4;  1K5M D;  2HWC 4;  1RHI 4;  1NCQ D;  1AR9 4;  2PLV 4;  1VBB 4;  2HWB 4;  4Q4Y 4;  1HRV 4;  1ASJ 4;  4Q4X 4;  1R09 4; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...