1HXTA

Ompf porin mutant nqaaa
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
340
structure length
340
Chain Sequence
b'AEIYNKDGNKVDLYGKAVGLHYFSKGNGENSYGGNGDMTYAALGFKGETQINSDLTGYGQWEYNFQGNNSEGADAQTGNKTALAFAGLKYADVGSFDYGRNYGVVYDALGYTNMLPQFGGDTAYSDDFFVGAVGGVATYRNSNFFGLVDGLNFAVQYLGKNERDTARRSNGDGVGGSISYEYEGFGIVGAYGAADRTNLQEAQPLGNGKKAEQWATGLKYDANNIYLAANYGETRNATPITNKFTNTSGFANKTQDVLLVAQYQFDFGLRPSIAYTKSKAKDVEGIGDVDLVNYFEVGATYYFNKNMSTYVDYIINQIDSDNKLGVGSDDTVAVGIVYQF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords OUTER MEMBRANE PROTEIN F
publication title Role of charged residues at the OmpF porin channel constriction probed by mutagenesis and simulation.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Membrane protein
total genus 103
structure length 340
sequence length 340
ec nomenclature
pdb deposition date 2001-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00267 Porin_1 Gram-negative porin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 1hxtA00
2FGRA 1GFOA 5DL7A 3HWBA 3O0EA 1GFNA 3VZTX 3SY7A 3SZDA 4GCSA 4GCQA 5DL8A 1HXXA 1E54A 1PRNA 1PHOA 3HW9A 4LSFA 4RJXA 2XE3A 2XE2A 3PORA 3SYBA 4AUIA 4KR8A 4D64A 1BT9A 1GFMA 3T24A 4C69X 2J4UP 3POXA 2Y0KA 4FRXA 1BH3A 2PRNA 2XE1A 1GFPA 1HXTA 3VY8X 2ODJA 1HXUA 3UU2A 2XE5A 3WI4A 5JDPA 4BUMX 8PRNA 3EMNX 3A2SX 1GFQA 1MPFA 5DL5A 4KRAA 3VZWX 2OMFA 2O4VA 4KR4A 2FGQX 4GCPA 3FYXA 4FT6A 2QTKA 4FMSA 4LSEA 4FRTA 1OPFA 4FOZA 3SZVA 5DL6A 4D5UA 2ZFGA 3PRNA 3T20A 3UPGA 3SY9A 2K4TA 3NSGA 4FSOA 3JTYA 4D65A 4JFBA 4LSHA 6PRNA 3POQA 2Y0LA 2Y2XA 4LSIA 1H6S1 2PORA 2XG6A 2ZLDA 5FVNA 7PRNA 4FSPA 1OSMA 5PRNA 3VY9X 3K19A 3WI5A 3VZUX 3POUA 3SYSA 2Y0HA 2J1NA 3T0SA 4RJWA
chains in the Genus database with same CATH superfamily
4N74A 1T1LA 2N2MA 2W80C 4JCHA 2FGRA 1GFOA 5DL7A 4F4BA 3LK2B 3HWBA 1ZHXA 3GP6A 2X9KA 2R4NA 2XTQA 3O0EA 3PF1A 1GFNA 4FZNA 2IWVA 4FZLA 4PR7A 2LHFA 3SY7A 3VZTX 4AKRB 3JCUO 5GV0A 3WU2O 4O4XA 3SZDA 5EE2A 4AZLA 4GCSA 4K3CA 3DA3A 3HOLA 4K3BA 4GCQA 5DL8A 1HXXA 5ADXL 3PGUA 1E54A 3AA6B 1PRNA 4RL9A 4FQEA 5D5DA 1P4TA 1MM5A 3AA7B 4UB8O 1PHOA 4AYDC 1Q9FA 3HW9A 3LK42 1BXWA 4LSFA 3AA1A 4RJXA 4C4VB 2XE3A 3PQUA 2XE2A 2MNHA 2F1TA 3DWNA 3DZMA 3PORA 5G3AA 3QRAA 3SYBA 4KR8A 3AAEA 5E79O 3AA0B 3A0HO 4AUIA 4D64A 5AFUK 1GFMA 2R8AA 3T24A 3LK41 4C69X 2J4UP 3POXA 1QJPA 5GTHO 4E1TA 1MM4A 1Q9GA 2WJRA 2Y0KA 1BH3A 4FRXA 2R4PA 4G75A 4IL6O 2PRNA 2XE1A 4O49A 1GFPA 3VE2A 4AYMC 2N2LA 1ZHZA 1YS5A 4AYID 1HXTA 3VY8X 2F1VA 2KXPA 2ODJA 2KZ7A 4QQ1A 1THQA 3KVDD 1HXUA 2WJQA 3KZIO 3UU2A 2JMMA 3BS0A 2XE5A 4O3XB 3WI4A 4RJWA 4O4UA 5JDPA 4BUMX 2KC0A 8PRNA 3EMNX 2WVPA 5T5FA 4O3ZA 5G38A 3A2SX 3PQSA 1IZNA 1GFQA 4XNLA 1MPFA 4Z3TA 5DL5A 4KRAA 4AKRA 3DWOX 4RLCA 4O3YA 5AFUL 1T16A 2XTRA 2AXTO 3QRCA 2R4OA 4UB6O 4N58A 3VZWX 2IWWA 2OMFA 2O4VA 4FUVA 4KR4A 4AKMA 3PGRA 2FGQX 4GCPA 2K0LA 4RLBA 2LFUA 3FYXA 4FT6A 2QTKA 2M07A 3AA7A 3LK3B 4XNKA 5G26A 3AAAA 4C4VA 4GHBA 4FMSA 4LSEA 2Y7SA 3NJTA 4U9CA 2F1CX 3PGSA 4FRTA 4N75A 2KDYA 1OPFA 4FOZA 3SZVA 2GE4A 1ORMA 5DL6A 4G76A 4GF4A 4C00A 4D5UA 2JQYA 3G7GA 3VE1A 2ZFGA 3PRNA 5TISO 3T20A 5G39A 4B61A 2M06A 2KXPB 3LK2A 3UPGA 4PJ0O 3C5OA 4N59A 3SY9A 2K4TA 2X27X 3NSGA 3BRYA 4O3WA 4FSOA 5IYUA 5GTIO 3A0BO 3V8UA 5B5EO 1ZHYA 3HOEA 2R88A 3JTYA 4FZMA 1QJ9A 4D65A 4JFBA 1IZNB 4LSHA 5KAFO 6PRNA 2XMXA 3TZGA 2W81C 3POQA 3AA1B 2MHLA 3AA6A 4AFKA 4AYEC 1S5LO 3DA4A 2Y0LA 2Y2XA 5KAIO 3UAQA 3AAEB 4LSIA 5H2FO 3RBHA 1H6S1 2YNKA 5B66O 2PORA 2XG6A 2YPVA 4AYNA 3AA0A 2R4LA 1QJ8A 2ZLDA 1ZHWA 5ADXK 1G90A 5FVNA 4E1SA 7PRNA 2R89A 4FSPA 1OSMA 1ZHTA 3AAAB 5PRNA 3VY9X 3K19A 3WI5A 4CTDA 3LK3A 2ERVA 3POUA 3VZUX 3SYSA 2KZ7B 2Y0HA 4PUXA 3BRZA 2J1NA 3T0SA 4FESA 1BT9A
chains in the Genus database with same CATH topology
2N2MA 2W80C 4JCHA 2FGRA 1GFOA 5DL7A 4F4BA 3LK2B 3HWBA 1ZHXA 3GP6A 2XTQA 3O0EA 4FZNA 4FZLA 4AYDC 1GFNA 3VZTX 3SY7A 2LHFA 4AKRB 5GV0A 4O4XA 3SZDA 5EE2A 4AZLA 4GCSA 3DA3A 3HOLA 4GCQA 5DL8A 1HXXA 5ADXL 1E54A 3AA6B 1PRNA 4RL9A 5D5DA 1P4TA 1MM5A 3AA7B 1PHOA 1Q9FA 3HW9A 3LK42 1BXWA 4LSFA 3AA1A 4RJXA 2XE3A 3PQUA 2XE2A 2MNHA 2F1TA 5AFUK 3PORA 3SYBA 3QRAA 4AUIA 4KR8A 3AAEA 3AA0B 4D64A 1GFMA 3T24A 3LK41 4C69X 2J4UP 3POXA 1QJPA 4E1TA 1MM4A 1Q9GA 2Y0KA 4FRXA 1BH3A 4G75A 4O49A 2PRNA 2XE1A 3VE2A 1GFPA 4AYMC 2N2LA 1ZHZA 1YS5A 4AYID 1HXTA 3VY8X 2F1VA 2KXPA 2ODJA 2KZ7A 4QQ1A 1THQA 3KVDD 1HXUA 3UU2A 2JMMA 2XE5A 4O3XB 3WI4A 4RJWA 4O4UA 5JDPA 4BUMX 2KC0A 8PRNA 3EMNX 5T5FA 4O3ZA 3A2SX 3PQSA 1IZNA 1GFQA 4XNLA 1MPFA 4Z3TA 5DL5A 4KRAA 4AKRA 4RLCA 4O3YA 5AFUL 2XTRA 3QRCA 3VZWX 4N58A 2OMFA 2O4VA 4FUVA 4KR4A 4AKMA 2FGQX 4GCPA 2K0LA 4RLBA 2LFUA 3FYXA 4FT6A 2M07A 2QTKA 3AA7A 3LK3B 4XNKA 5G26A 3AAAA 4GHBA 4FMSA 4LSEA 2Y7SA 4U9CA 4FRTA 2KDYA 1OPFA 4FOZA 3SZVA 2GE4A 1ORMA 5DL6A 4G76A 4GF4A 4D5UA 3VE1A 3G7GA 2ZFGA 3PRNA 3T20A 4B61A 2M06A 2KXPB 3LK2A 3UPGA 3C5OA 4N59A 3SY9A 2K4TA 2X27X 3NSGA 4O3WA 4FSOA 5IYUA 3V8UA 1ZHYA 3HOEA 3JTYA 4D65A 4FZMA 1QJ9A 4JFBA 1IZNB 4LSHA 6PRNA 2XMXA 3TZGA 2W81C 3POQA 3AA1B 2MHLA 3AA6A 4AFKA 4AYEC 3DA4A 2Y0LA 2Y2XA 3UAQA 3AAEB 4LSIA 3RBHA 1H6S1 2YNKA 2PORA 2XG6A 2YPVA 4AYNA 3AA0A 1QJ8A 2ZLDA 1ZHWA 5ADXK 1G90A 5FVNA 4E1SA 7PRNA 4FSPA 1OSMA 1ZHTA 3AAAB 5PRNA 3VY9X 3K19A 3WI5A 3LK3A 2ERVA 3POUA 3VZUX 3SYSA 2KZ7B 2Y0HA 4PUXA 2J1NA 3T0SA 4FESA 1BT9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FGR A;  1GFO A;  5DL7 A;  3HWB A;  3O0E A;  1GFN A;  3VZT X;  3SY7 A;  3SZD A;  4GCS A;  4GCQ A;  5DL8 A;  1HXX A;  1E54 A;  1PRN A;  1PHO A;  3HW9 A;  4LSF A;  4RJX A;  2XE3 A;  2XE2 A;  3POR A;  3SYB A;  4AUI A;  4KR8 A;  4D64 A;  1BT9 A;  1GFM A;  3T24 A;  4C69 X;  2J4U P;  3POX A;  2Y0K A;  4FRX A;  1BH3 A;  2PRN A;  2XE1 A;  1GFP A;  1HXT A;  3VY8 X;  2ODJ A;  1HXU A;  3UU2 A;  2XE5 A;  3WI4 A;  5JDP A;  4BUM X;  8PRN A;  3EMN X;  3A2S X;  1GFQ A;  1MPF A;  5DL5 A;  4KRA A;  3VZW X;  2OMF A;  2O4V A;  4KR4 A;  2FGQ X;  4GCP A;  3FYX A;  4FT6 A;  2QTK A;  4FMS A;  4LSE A;  4FRT A;  1OPF A;  4FOZ A;  3SZV A;  5DL6 A;  4D5U A;  2ZFG A;  3PRN A;  3T20 A;  3UPG A;  3SY9 A;  2K4T A;  3NSG A;  4FSO A;  3JTY A;  4D65 A;  4JFB A;  4LSH A;  6PRN A;  3POQ A;  2Y0L A;  2Y2X A;  4LSI A;  1H6S 1;  2POR A;  2XG6 A;  2ZLD A;  5FVN A;  7PRN A;  4FSP A;  1OSM A;  5PRN A;  3VY9 X;  3K19 A;  3WI5 A;  3VZU X;  3POU A;  3SYS A;  2Y0H A;  2J1N A;  3T0S A;  4RJW A; 
#chains in the Genus database with same CATH topology
 4N74 A;  1T1L A;  2N2M A;  2W80 C;  4JCH A;  2FGR A;  1GFO A;  5DL7 A;  4F4B A;  3LK2 B;  3HWB A;  1ZHX A;  3GP6 A;  2X9K A;  2R4N A;  2XTQ A;  3O0E A;  3PF1 A;  1GFN A;  4FZN A;  2IWV A;  4FZL A;  4PR7 A;  2LHF A;  3SY7 A;  3VZT X;  4AKR B;  3JCU O;  5GV0 A;  3WU2 O;  4O4X A;  3SZD A;  5EE2 A;  4AZL A;  4GCS A;  4K3C A;  3DA3 A;  3HOL A;  4K3B A;  4GCQ A;  5DL8 A;  1HXX A;  5ADX L;  3PGU A;  1E54 A;  3AA6 B;  1PRN A;  4RL9 A;  4FQE A;  5D5D A;  1P4T A;  1MM5 A;  3AA7 B;  4UB8 O;  1PHO A;  4AYD C;  1Q9F A;  3HW9 A;  3LK4 2;  1BXW A;  4LSF A;  3AA1 A;  4RJX A;  4C4V B;  2XE3 A;  3PQU A;  2XE2 A;  2MNH A;  2F1T A;  3DWN A;  3DZM A;  3POR A;  5G3A A;  3QRA A;  3SYB A;  4KR8 A;  3AAE A;  5E79 O;  3AA0 B;  3A0H O;  4AUI A;  4D64 A;  5AFU K;  1GFM A;  2R8A A;  3T24 A;  3LK4 1;  4C69 X;  2J4U P;  3POX A;  1QJP A;  5GTH O;  4E1T A;  1MM4 A;  1Q9G A;  2WJR A;  2Y0K A;  1BH3 A;  4FRX A;  2R4P A;  4G75 A;  4IL6 O;  2PRN A;  2XE1 A;  4O49 A;  1GFP A;  3VE2 A;  4AYM C;  2N2L A;  1ZHZ A;  1YS5 A;  4AYI D;  1HXT A;  3VY8 X;  2F1V A;  2KXP A;  2ODJ A;  2KZ7 A;  4QQ1 A;  1THQ A;  3KVD D;  1HXU A;  2WJQ A;  3KZI O;  3UU2 A;  2JMM A;  3BS0 A;  2XE5 A;  4O3X B;  3WI4 A;  4RJW A;  4O4U A;  5JDP A;  4BUM X;  2KC0 A;  8PRN A;  3EMN X;  2WVP A;  5T5F A;  4O3Z A;  5G38 A;  3A2S X;  3PQS A;  1IZN A;  1GFQ A;  4XNL A;  1MPF A;  4Z3T A;  5DL5 A;  4KRA A;  4AKR A;  3DWO X;  4RLC A;  4O3Y A;  5AFU L;  1T16 A;  2XTR A;  2AXT O;  3QRC A;  2R4O A;  4UB6 O;  4N58 A;  3VZW X;  2IWW A;  2OMF A;  2O4V A;  4FUV A;  4KR4 A;  4AKM A;  3PGR A;  2FGQ X;  4GCP A;  2K0L A;  4RLB A;  2LFU A;  3FYX A;  4FT6 A;  2QTK A;  2M07 A;  3AA7 A;  3LK3 B;  4XNK A;  5G26 A;  3AAA A;  4C4V A;  4GHB A;  4FMS A;  4LSE A;  2Y7S A;  3NJT A;  4U9C A;  2F1C X;  3PGS A;  4FRT A;  4N75 A;  2KDY A;  1OPF A;  4FOZ A;  3SZV A;  2GE4 A;  1ORM A;  5DL6 A;  4G76 A;  4GF4 A;  4C00 A;  4D5U A;  2JQY A;  3G7G A;  3VE1 A;  2ZFG A;  3PRN A;  5TIS O;  3T20 A;  5G39 A;  4B61 A;  2M06 A;  2KXP B;  3LK2 A;  3UPG A;  4PJ0 O;  3C5O A;  4N59 A;  3SY9 A;  2K4T A;  2X27 X;  3NSG A;  3BRY A;  4O3W A;  4FSO A;  5IYU A;  5GTI O;  3A0B O;  3V8U A;  5B5E O;  1ZHY A;  3HOE A;  2R88 A;  3JTY A;  4FZM A;  1QJ9 A;  4D65 A;  4JFB A;  1IZN B;  4LSH A;  5KAF O;  6PRN A;  2XMX A;  3TZG A;  2W81 C;  3POQ A;  3AA1 B;  2MHL A;  3AA6 A;  4AFK A;  4AYE C;  1S5L O;  3DA4 A;  2Y0L A;  2Y2X A;  5KAI O;  3UAQ A;  3AAE B;  4LSI A;  5H2F O;  3RBH A;  1H6S 1;  2YNK A;  5B66 O;  2POR A;  2XG6 A;  2YPV A;  4AYN A;  3AA0 A;  2R4L A;  1QJ8 A;  2ZLD A;  1ZHW A;  5ADX K;  1G90 A;  5FVN A;  4E1S A;  7PRN A;  2R89 A;  4FSP A;  1OSM A;  1ZHT A;  3AAA B;  5PRN A;  3VY9 X;  3K19 A;  3WI5 A;  4CTD A;  3LK3 A;  2ERV A;  3POU A;  3VZU X;  3SYS A;  2KZ7 B;  2Y0H A;  4PUX A;  3BRZ A;  2J1N A;  3T0S A;  4FES A;  1BT9 A; 
#chains in the Genus database with same CATH homology
 2N2M A;  2W80 C;  4JCH A;  2FGR A;  1GFO A;  5DL7 A;  4F4B A;  3LK2 B;  3HWB A;  1ZHX A;  3GP6 A;  2XTQ A;  3O0E A;  4FZN A;  4FZL A;  4AYD C;  1GFN A;  3VZT X;  3SY7 A;  2LHF A;  4AKR B;  5GV0 A;  4O4X A;  3SZD A;  5EE2 A;  4AZL A;  4GCS A;  3DA3 A;  3HOL A;  4GCQ A;  5DL8 A;  1HXX A;  5ADX L;  1E54 A;  3AA6 B;  1PRN A;  4RL9 A;  5D5D A;  1P4T A;  1MM5 A;  3AA7 B;  1PHO A;  1Q9F A;  3HW9 A;  3LK4 2;  1BXW A;  4LSF A;  3AA1 A;  4RJX A;  2XE3 A;  3PQU A;  2XE2 A;  2MNH A;  2F1T A;  5AFU K;  3POR A;  3SYB A;  3QRA A;  4AUI A;  4KR8 A;  3AAE A;  3AA0 B;  4D64 A;  1GFM A;  3T24 A;  3LK4 1;  4C69 X;  2J4U P;  3POX A;  1QJP A;  4E1T A;  1MM4 A;  1Q9G A;  2Y0K A;  4FRX A;  1BH3 A;  4G75 A;  4O49 A;  2PRN A;  2XE1 A;  3VE2 A;  1GFP A;  4AYM C;  2N2L A;  1ZHZ A;  1YS5 A;  4AYI D;  1HXT A;  3VY8 X;  2F1V A;  2KXP A;  2ODJ A;  2KZ7 A;  4QQ1 A;  1THQ A;  3KVD D;  1HXU A;  3UU2 A;  2JMM A;  2XE5 A;  4O3X B;  3WI4 A;  4RJW A;  4O4U A;  5JDP A;  4BUM X;  2KC0 A;  8PRN A;  3EMN X;  5T5F A;  4O3Z A;  3A2S X;  3PQS A;  1IZN A;  1GFQ A;  4XNL A;  1MPF A;  4Z3T A;  5DL5 A;  4KRA A;  4AKR A;  4RLC A;  4O3Y A;  5AFU L;  2XTR A;  3QRC A;  3VZW X;  4N58 A;  2OMF A;  2O4V A;  4FUV A;  4KR4 A;  4AKM A;  2FGQ X;  4GCP A;  2K0L A;  4RLB A;  2LFU A;  3FYX A;  4FT6 A;  2M07 A;  2QTK A;  3AA7 A;  3LK3 B;  4XNK A;  5G26 A;  3AAA A;  4GHB A;  4FMS A;  4LSE A;  2Y7S A;  4U9C A;  4FRT A;  2KDY A;  1OPF A;  4FOZ A;  3SZV A;  2GE4 A;  1ORM A;  5DL6 A;  4G76 A;  4GF4 A;  4D5U A;  3VE1 A;  3G7G A;  2ZFG A;  3PRN A;  3T20 A;  4B61 A;  2M06 A;  2KXP B;  3LK2 A;  3UPG A;  3C5O A;  4N59 A;  3SY9 A;  2K4T A;  2X27 X;  3NSG A;  4O3W A;  4FSO A;  5IYU A;  3V8U A;  1ZHY A;  3HOE A;  3JTY A;  4D65 A;  4FZM A;  1QJ9 A;  4JFB A;  1IZN B;  4LSH A;  6PRN A;  2XMX A;  3TZG A;  2W81 C;  3POQ A;  3AA1 B;  2MHL A;  3AA6 A;  4AFK A;  4AYE C;  3DA4 A;  2Y0L A;  2Y2X A;  3UAQ A;  3AAE B;  4LSI A;  3RBH A;  1H6S 1;  2YNK A;  2POR A;  2XG6 A;  2YPV A;  4AYN A;  3AA0 A;  1QJ8 A;  2ZLD A;  1ZHW A;  5ADX K;  1G90 A;  5FVN A;  4E1S A;  7PRN A;  4FSP A;  1OSM A;  1ZHT A;  3AAA B;  5PRN A;  3VY9 X;  3K19 A;  3WI5 A;  3LK3 A;  2ERV A;  3POU A;  3VZU X;  3SYS A;  2KZ7 B;  2Y0H A;  4PUX A;  2J1N A;  3T0S A;  4FES A;  1BT9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...