1HXTA

Ompf porin mutant nqaaa
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
340
structure length
340
Chain Sequence
AEIYNKDGNKVDLYGKAVGLHYFSKGNGENSYGGNGDMTYAALGFKGETQINSDLTGYGQWEYNFQGNNSEGADAQTGNKTALAFAGLKYADVGSFDYGRNYGVVYDALGYTNMLPQFGGDTAYSDDFFVGAVGGVATYRNSNFFGLVDGLNFAVQYLGKNERDTARRSNGDGVGGSISYEYEGFGIVGAYGAADRTNLQEAQPLGNGKKAEQWATGLKYDANNIYLAANYGETRNATPITNKFTNTSGFANKTQDVLLVAQYQFDFGLRPSIAYTKSKAKDVEGIGDVDLVNYFEVGATYYFNKNMSTYVDYIINQIDSDNKLGVGSDDTVAVGIVYQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords OUTER MEMBRANE PROTEIN F
publication title Role of charged residues at the OmpF porin channel constriction probed by mutagenesis and simulation.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Membrane protein
total genus 103
structure length 340
sequence length 340
ec nomenclature
pdb deposition date 2001-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00267 Porin_1 Gram-negative porin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 1hxtA00
2J1NA 5DL8A 5DL7A 2ZFGA 3SZDA 4D5UA 3SZVA 3POXA 4GCSA 4LSIA 5FVNA 4JFBA 3SYSA 4FSOA 2Y0KA 4KR4A 3VY8X 3VY9X 4D64A 2XG6A 4BUMX 1BT9A 4FT6A 1H6S1 4FMSA 4D65A 1GFQA 2PORA 2PRNA 5DL6A 3T24A 4LSHA 1BH3A 6PRNA 3HW9A 2OMFA 3UU2A 2Y0LA 7PRNA 2K4TA 3SY9A 4RJWA 3POQA 3FYXA 3VZWX 4AUIA 3EMNX 3VZTX 3POUA 3UPGA 1GFNA 3O0EA 5JDPA 1HXXA 4KRAA 5DL5A 1HXUA 1GFOA 1MPFA 2Y0HA 2O4VA 1GFMA 3T0SA 4LSEA 2XE3A 3K19A 1PHOA 4FOZA 2XE5A 4GCQA 3NSGA 3HWBA 1E54A 2XE2A 4LSFA 1HXTA 2QTKA 3T20A 2FGQX 4GCPA 3VZUX 4KR8A 1PRNA 1GFPA 3SY7A 4C69X 2ZLDA 2XE1A 8PRNA 3SYBA 5PRNA 3PORA 2ODJA 3WI4A 4FRTA 2Y2XA 2FGRA 4RJXA 1OSMA 1OPFA 3PRNA 4FRXA 3JTYA 2J4UP 3WI5A 4FSPA 3A2SX
chains in the Genus database with same CATH superfamily
2J1NA 5DL8A 5DL7A 5B5EO 2W81C 2ZFGA 3V8UA 4N58A 3AAEA 3SZDA 3A0BO 4D5UA 1ZHWA 2R88A 3PQSA 3A0HO 3SZVA 3VE1A 2R4LA 1BXWA 3POXA 2R8AA 4GCSA 4N74A 4LSIA 5FVNA 4JFBA 4IL6O 3HOEA 4C4VB 2GE4A 2M07A 2W80C 2MHLA 2Y7SA 3SYSA 4B61A 3BS0A 1QJPA 4FSOA 2JMMA 2Y0KA 3AAAA 4N59A 2F1VA 3AA7A 4FQEA 4KR4A 2WJRA 4O3XB 3PGUA 3AAAB 5KAIO 3VE2A 3DWNA 3DWOX 3AA0A 3VY9X 4C00A 1S5LO 3AA1A 4O4XA 1G90A 5G3AA 2XG6A 4FZNA 4BUMX 1ZHZA 4D64A 5GTHO 1BT9A 4FT6A 1H6S1 3PQUA 4FESA 4FMSA 4O4UA 5TISO 2KXPA 4D65A 5GTIO 3TZGA 1GFQA 2PORA 2KZ7B 1QJ8A 2PRNA 4F4BA 5DL6A 3LK41 4AYNA 4AKMA 3T24A 4Z3TA 3LK42 4PUXA 4U9CA 3KVDD 4LSHA 3RBHA 5KAFO 1BH3A 6PRNA 3HW9A 2OMFA 3LK3A 2Y0LA 3UU2A 2XMXA 3PGSA 3AAEB 2KC0A 7PRNA 4O3ZA 5AFUL 4PJ0O 2YPVA 2K4TA 5H2FO 2XTRA 3SY9A 3WU2O 4RJWA 3POQA 3FYXA 2IWVA 3VZWX 4AUIA 3G7GA 4AZLA 2AXTO 2MNHA 2K0LA 2WVPA 3AA7B 3EMNX 3PGRA 3POUA 3VZTX 5ADXK 4O49A 5G39A 5G38A 3UPGA 3AA0B 1IZNA 1QJ9A 1GFNA 1ZHYA 3AA1B 3BRZA 2R4OA 4K3CA 5D5DA 4AKRA 1T16A 2ERVA 3O0EA 4UB6O 4FZLA 2KXPB 5JDPA 5IYUA 1ZHTA 2X27X 3PF1A 2WJQA 3BRYA 4AYEC 4PR7A 3HOLA 1ZHXA 1HXXA 1Q9FA 1THQA 4KRAA 4O3WA 5DL5A 1HXUA 4G76A 4AYID 1GFOA 1MPFA 1MM5A 2R4PA 3DA3A 4AYDC 5GV0A 1T1LA 2Y0HA 4N75A 5T5FA 3UAQA 2IWWA 3LK3B 2O4VA 2YNKA 1GFMA 3T0SA 4LSEA 5B66O 2F1TA 2LFUA 2XE3A 2M06A 1PHOA 1Q9GA 3K19A 2LHFA 2XE5A 3AA6A 4FOZA 3LK2A 2R4NA 4E1TA 4K3BA 3QRCA 3LK2B 4AFKA 4GCQA 1ORMA 5ADXL 2N2LA 3DA4A 3NSGA 5E79O 3HWBA 1E54A 4AYMC 4UB8O 1IZNB 2XE2A 3KZIO 4GF4A 3C5OA 1HXTA 4LSFA 4XNLA 2QTKA 4AKRB 3T20A 4JCHA 2FGQX 1P4TA 4XNKA 4GCPA 3GP6A 4GHBA 3VZUX 4KR8A 4C4VA 1PRNA 3DZMA 1GFPA 1MM4A 4FUVA 3JCUO 3SY7A 2XTQA 4C69X 5AFUK 2ZLDA 2XE1A 8PRNA 3NJTA 4O3YA 4CTDA 4FZMA 3SYBA 5PRNA 3VY8X 2N2MA 3PORA 2ODJA 3WI4A 2R89A 3QRAA 4FRTA 4E1SA 2Y2XA 3AA6B 2FGRA 4G75A 4RJXA 1OPFA 1OSMA 3PRNA 2KZ7A 4RL9A 4FRXA 5G26A 2JQYA 2KDYA 5EE2A 2X9KA 4RLCA 1YS5A 2F1CX 3JTYA 4QQ1A 3WI5A 4RLBA 4FSPA 3A2SX 2J4UP
chains in the Genus database with same CATH topology
2J1NA 5DL8A 5DL7A 2W81C 2ZFGA 3V8UA 4N58A 3AAEA 3SZDA 4D5UA 1ZHWA 3PQSA 3SZVA 3VE1A 1BXWA 3POXA 4GCSA 4LSIA 5FVNA 4JFBA 3HOEA 2GE4A 2M07A 2W80C 2MHLA 2Y7SA 3SYSA 4B61A 1QJPA 4FSOA 2JMMA 2Y0KA 3AAAA 4N59A 2F1VA 3AA7A 4KR4A 4O3XB 3VE2A 3VY8X 3AAAB 3VY9X 1G90A 3AA0A 3AA1A 4O4XA 4D64A 2XG6A 4FZNA 4BUMX 1ZHZA 1BT9A 4FT6A 1H6S1 3PQUA 4FESA 4FMSA 4O4UA 4D65A 2KXPA 3TZGA 1GFQA 2PORA 2KZ7B 1QJ8A 2PRNA 4F4BA 5DL6A 3LK41 4AYNA 4AKMA 3T24A 4Z3TA 3LK42 4PUXA 4U9CA 3KVDD 4LSHA 3RBHA 1BH3A 6PRNA 3HW9A 2OMFA 3LK3A 2Y0LA 3UU2A 2XMXA 3AAEB 2KC0A 7PRNA 4O3ZA 5AFUL 2YPVA 2K4TA 2XTRA 3SY9A 4RJWA 3POQA 3FYXA 3VZWX 4AUIA 3G7GA 4AZLA 2MNHA 2K0LA 3AA7B 3EMNX 3VZTX 5ADXK 3POUA 4O49A 3UPGA 3AA0B 1IZNA 1QJ9A 1GFNA 1ZHYA 3AA1B 5D5DA 4AKRA 2ERVA 3O0EA 4FZLA 2KXPB 5JDPA 5IYUA 1ZHTA 2X27X 4AYEC 3HOLA 1ZHXA 1HXXA 1Q9FA 1THQA 4KRAA 4O3WA 5DL5A 1HXUA 4G76A 4AYID 1GFOA 1MPFA 1MM5A 4AYDC 3DA3A 5GV0A 5T5FA 2Y0HA 3UAQA 3LK3B 2O4VA 2YNKA 1GFMA 3T0SA 4LSEA 2F1TA 2LFUA 2XE3A 2M06A 1PHOA 1Q9GA 3K19A 2LHFA 2XE5A 3AA6A 4FOZA 3LK2A 4E1TA 3QRCA 3LK2B 4AFKA 4GCQA 1ORMA 5ADXL 2N2LA 3DA4A 3NSGA 3HWBA 1E54A 4AYMC 2XE2A 1IZNB 4GF4A 4LSFA 3C5OA 1HXTA 4XNLA 2QTKA 4AKRB 3T20A 4JCHA 2FGQX 1P4TA 4XNKA 4GCPA 3GP6A 4GHBA 3VZUX 4KR8A 1PRNA 1GFPA 1MM4A 4FUVA 3SY7A 4C69X 2XTQA 5AFUK 2ZLDA 2XE1A 8PRNA 4O3YA 4FZMA 3SYBA 5PRNA 2N2MA 3PORA 2ODJA 3WI4A 3QRAA 4FRTA 4E1SA 2Y2XA 3AA6B 2FGRA 4G75A 4RJXA 1OPFA 1OSMA 3PRNA 2KZ7A 4RL9A 4FRXA 5G26A 2KDYA 5EE2A 4RLCA 1YS5A 3JTYA 4QQ1A 3WI5A 2J4UP 4RLBA 4FSPA 3A2SX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J1N A;  5DL8 A;  5DL7 A;  2ZFG A;  3SZD A;  4D5U A;  3SZV A;  3POX A;  4GCS A;  4LSI A;  5FVN A;  4JFB A;  3SYS A;  4FSO A;  2Y0K A;  4KR4 A;  3VY8 X;  3VY9 X;  4D64 A;  2XG6 A;  4BUM X;  1BT9 A;  4FT6 A;  1H6S 1;  4FMS A;  4D65 A;  1GFQ A;  2POR A;  2PRN A;  5DL6 A;  3T24 A;  4LSH A;  1BH3 A;  6PRN A;  3HW9 A;  2OMF A;  3UU2 A;  2Y0L A;  7PRN A;  2K4T A;  3SY9 A;  4RJW A;  3POQ A;  3FYX A;  3VZW X;  4AUI A;  3EMN X;  3VZT X;  3POU A;  3UPG A;  1GFN A;  3O0E A;  5JDP A;  1HXX A;  4KRA A;  5DL5 A;  1HXU A;  1GFO A;  1MPF A;  2Y0H A;  2O4V A;  1GFM A;  3T0S A;  4LSE A;  2XE3 A;  3K19 A;  1PHO A;  4FOZ A;  2XE5 A;  4GCQ A;  3NSG A;  3HWB A;  1E54 A;  2XE2 A;  4LSF A;  1HXT A;  2QTK A;  3T20 A;  2FGQ X;  4GCP A;  3VZU X;  4KR8 A;  1PRN A;  1GFP A;  3SY7 A;  4C69 X;  2ZLD A;  2XE1 A;  8PRN A;  3SYB A;  5PRN A;  3POR A;  2ODJ A;  3WI4 A;  4FRT A;  2Y2X A;  2FGR A;  4RJX A;  1OSM A;  1OPF A;  3PRN A;  4FRX A;  3JTY A;  2J4U P;  3WI5 A;  4FSP A;  3A2S X; 
#chains in the Genus database with same CATH topology
 2J1N A;  5DL8 A;  5DL7 A;  5B5E O;  2W81 C;  2ZFG A;  3V8U A;  4N58 A;  3AAE A;  3SZD A;  3A0B O;  4D5U A;  1ZHW A;  2R88 A;  3PQS A;  3A0H O;  3SZV A;  3VE1 A;  2R4L A;  1BXW A;  3POX A;  2R8A A;  4GCS A;  4N74 A;  4LSI A;  5FVN A;  4JFB A;  4IL6 O;  3HOE A;  4C4V B;  2GE4 A;  2M07 A;  2W80 C;  2MHL A;  2Y7S A;  3SYS A;  4B61 A;  3BS0 A;  1QJP A;  4FSO A;  2JMM A;  2Y0K A;  3AAA A;  4N59 A;  2F1V A;  3AA7 A;  4FQE A;  4KR4 A;  2WJR A;  4O3X B;  3PGU A;  3AAA B;  5KAI O;  3VE2 A;  3DWN A;  3DWO X;  3AA0 A;  3VY9 X;  4C00 A;  1S5L O;  3AA1 A;  4O4X A;  1G90 A;  5G3A A;  2XG6 A;  4FZN A;  4BUM X;  1ZHZ A;  4D64 A;  5GTH O;  1BT9 A;  4FT6 A;  1H6S 1;  3PQU A;  4FES A;  4FMS A;  4O4U A;  5TIS O;  2KXP A;  4D65 A;  5GTI O;  3TZG A;  1GFQ A;  2POR A;  2KZ7 B;  1QJ8 A;  2PRN A;  4F4B A;  5DL6 A;  3LK4 1;  4AYN A;  4AKM A;  3T24 A;  4Z3T A;  3LK4 2;  4PUX A;  4U9C A;  3KVD D;  4LSH A;  3RBH A;  5KAF O;  1BH3 A;  6PRN A;  3HW9 A;  2OMF A;  3LK3 A;  2Y0L A;  3UU2 A;  2XMX A;  3PGS A;  3AAE B;  2KC0 A;  7PRN A;  4O3Z A;  5AFU L;  4PJ0 O;  2YPV A;  2K4T A;  5H2F O;  2XTR A;  3SY9 A;  3WU2 O;  4RJW A;  3POQ A;  3FYX A;  2IWV A;  3VZW X;  4AUI A;  3G7G A;  4AZL A;  2AXT O;  2MNH A;  2K0L A;  2WVP A;  3AA7 B;  3EMN X;  3PGR A;  3POU A;  3VZT X;  5ADX K;  4O49 A;  5G39 A;  5G38 A;  3UPG A;  3AA0 B;  1IZN A;  1QJ9 A;  1GFN A;  1ZHY A;  3AA1 B;  3BRZ A;  2R4O A;  4K3C A;  5D5D A;  4AKR A;  1T16 A;  2ERV A;  3O0E A;  4UB6 O;  4FZL A;  2KXP B;  5JDP A;  5IYU A;  1ZHT A;  2X27 X;  3PF1 A;  2WJQ A;  3BRY A;  4AYE C;  4PR7 A;  3HOL A;  1ZHX A;  1HXX A;  1Q9F A;  1THQ A;  4KRA A;  4O3W A;  5DL5 A;  1HXU A;  4G76 A;  4AYI D;  1GFO A;  1MPF A;  1MM5 A;  2R4P A;  3DA3 A;  4AYD C;  5GV0 A;  1T1L A;  2Y0H A;  4N75 A;  5T5F A;  3UAQ A;  2IWW A;  3LK3 B;  2O4V A;  2YNK A;  1GFM A;  3T0S A;  4LSE A;  5B66 O;  2F1T A;  2LFU A;  2XE3 A;  2M06 A;  1PHO A;  1Q9G A;  3K19 A;  2LHF A;  2XE5 A;  3AA6 A;  4FOZ A;  3LK2 A;  2R4N A;  4E1T A;  4K3B A;  3QRC A;  3LK2 B;  4AFK A;  4GCQ A;  1ORM A;  5ADX L;  2N2L A;  3DA4 A;  3NSG A;  5E79 O;  3HWB A;  1E54 A;  4AYM C;  4UB8 O;  1IZN B;  2XE2 A;  3KZI O;  4GF4 A;  3C5O A;  1HXT A;  4LSF A;  4XNL A;  2QTK A;  4AKR B;  3T20 A;  4JCH A;  2FGQ X;  1P4T A;  4XNK A;  4GCP A;  3GP6 A;  4GHB A;  3VZU X;  4KR8 A;  4C4V A;  1PRN A;  3DZM A;  1GFP A;  1MM4 A;  4FUV A;  3JCU O;  3SY7 A;  2XTQ A;  4C69 X;  5AFU K;  2ZLD A;  2XE1 A;  8PRN A;  3NJT A;  4O3Y A;  4CTD A;  4FZM A;  3SYB A;  5PRN A;  3VY8 X;  2N2M A;  3POR A;  2ODJ A;  3WI4 A;  2R89 A;  3QRA A;  4FRT A;  4E1S A;  2Y2X A;  3AA6 B;  2FGR A;  4G75 A;  4RJX A;  1OPF A;  1OSM A;  3PRN A;  2KZ7 A;  4RL9 A;  4FRX A;  5G26 A;  2JQY A;  2KDY A;  5EE2 A;  2X9K A;  4RLC A;  1YS5 A;  2F1C X;  3JTY A;  4QQ1 A;  3WI5 A;  4RLB A;  4FSP A;  3A2S X;  2J4U P; 
#chains in the Genus database with same CATH homology
 2J1N A;  5DL8 A;  5DL7 A;  2W81 C;  2ZFG A;  3V8U A;  4N58 A;  3AAE A;  3SZD A;  4D5U A;  1ZHW A;  3PQS A;  3SZV A;  3VE1 A;  1BXW A;  3POX A;  4GCS A;  4LSI A;  5FVN A;  4JFB A;  3HOE A;  2GE4 A;  2M07 A;  2W80 C;  2MHL A;  2Y7S A;  3SYS A;  4B61 A;  1QJP A;  4FSO A;  2JMM A;  2Y0K A;  3AAA A;  4N59 A;  2F1V A;  3AA7 A;  4KR4 A;  4O3X B;  3VE2 A;  3VY8 X;  3AAA B;  3VY9 X;  1G90 A;  3AA0 A;  3AA1 A;  4O4X A;  4D64 A;  2XG6 A;  4FZN A;  4BUM X;  1ZHZ A;  1BT9 A;  4FT6 A;  1H6S 1;  3PQU A;  4FES A;  4FMS A;  4O4U A;  4D65 A;  2KXP A;  3TZG A;  1GFQ A;  2POR A;  2KZ7 B;  1QJ8 A;  2PRN A;  4F4B A;  5DL6 A;  3LK4 1;  4AYN A;  4AKM A;  3T24 A;  4Z3T A;  3LK4 2;  4PUX A;  4U9C A;  3KVD D;  4LSH A;  3RBH A;  1BH3 A;  6PRN A;  3HW9 A;  2OMF A;  3LK3 A;  2Y0L A;  3UU2 A;  2XMX A;  3AAE B;  2KC0 A;  7PRN A;  4O3Z A;  5AFU L;  2YPV A;  2K4T A;  2XTR A;  3SY9 A;  4RJW A;  3POQ A;  3FYX A;  3VZW X;  4AUI A;  3G7G A;  4AZL A;  2MNH A;  2K0L A;  3AA7 B;  3EMN X;  3VZT X;  5ADX K;  3POU A;  4O49 A;  3UPG A;  3AA0 B;  1IZN A;  1QJ9 A;  1GFN A;  1ZHY A;  3AA1 B;  5D5D A;  4AKR A;  2ERV A;  3O0E A;  4FZL A;  2KXP B;  5JDP A;  5IYU A;  1ZHT A;  2X27 X;  4AYE C;  3HOL A;  1ZHX A;  1HXX A;  1Q9F A;  1THQ A;  4KRA A;  4O3W A;  5DL5 A;  1HXU A;  4G76 A;  4AYI D;  1GFO A;  1MPF A;  1MM5 A;  4AYD C;  3DA3 A;  5GV0 A;  5T5F A;  2Y0H A;  3UAQ A;  3LK3 B;  2O4V A;  2YNK A;  1GFM A;  3T0S A;  4LSE A;  2F1T A;  2LFU A;  2XE3 A;  2M06 A;  1PHO A;  1Q9G A;  3K19 A;  2LHF A;  2XE5 A;  3AA6 A;  4FOZ A;  3LK2 A;  4E1T A;  3QRC A;  3LK2 B;  4AFK A;  4GCQ A;  1ORM A;  5ADX L;  2N2L A;  3DA4 A;  3NSG A;  3HWB A;  1E54 A;  4AYM C;  2XE2 A;  1IZN B;  4GF4 A;  4LSF A;  3C5O A;  1HXT A;  4XNL A;  2QTK A;  4AKR B;  3T20 A;  4JCH A;  2FGQ X;  1P4T A;  4XNK A;  4GCP A;  3GP6 A;  4GHB A;  3VZU X;  4KR8 A;  1PRN A;  1GFP A;  1MM4 A;  4FUV A;  3SY7 A;  4C69 X;  2XTQ A;  5AFU K;  2ZLD A;  2XE1 A;  8PRN A;  4O3Y A;  4FZM A;  3SYB A;  5PRN A;  2N2M A;  3POR A;  2ODJ A;  3WI4 A;  3QRA A;  4FRT A;  4E1S A;  2Y2X A;  3AA6 B;  2FGR A;  4G75 A;  4RJX A;  1OPF A;  1OSM A;  3PRN A;  2KZ7 A;  4RL9 A;  4FRX A;  5G26 A;  2KDY A;  5EE2 A;  4RLC A;  1YS5 A;  3JTY A;  4QQ1 A;  3WI5 A;  2J4U P;  4RLB A;  4FSP A;  3A2S X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...