1HXVA

Ppiase domain of the mycoplasma genitalium trigger factor
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
85
structure length
85
Chain Sequence
KLANGDIAIIDFTGIVDNKKLASASAQNYELTIGSNSFIKGFETGLIAMKVNQKKTLALTFPSDYHVKELQSKPVTFEVVLKAIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR solution structure and dynamics of the peptidyl-prolyl cis-trans isomerase domain of the trigger factor from Mycoplasma genitalium compared to FK506-binding protein.
pubmed doi rcsb
molecule keywords TRIGGER FACTOR
source organism Mycoplasma genitalium
molecule tags Chaperone
total genus 8
structure length 85
sequence length 85
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2001-01-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1hxvA00
3O5JA 2LPVA 2ZQUA 1PINA 4QT2A 1Y0OA 1YATA 2RUDA 2PV2A 4DRHA 2M08A 2XP4A 4U86A 1R9HA 5HW6A 1FKLA 3KZ7A 4R0XA 2IF4A 2OFNA 2XP7A 3ODKA 3OOBA 2RURA 3TC5A 2FKEA 2KR7A 4G50A 3TCZA 1N1AA 3O5PA 2RSEA 4DRPA 1FKJA 4DRQA 2M2AA 2PPOA 3NRKA 2UZ5A 4TW7A 4QIBA 3KACA 4DH0A 2LGOA 2ZQTA 1W26A 4O2TA 5GPGA 2RQSA 3UI6A 3O5DA 3UQIA 5D75A 4IQCA 1EQ3A 3O5FA 1ROTA 2PPNA 3UQAA 4G2PA 3UQBA 1FD9A 1FKKA 4IPXA 5B8IC 2Q5AA 3RGCA 3TDBA 3JXVA 4TYOA 1ROUA 3MDYB 1T11A 1ZCNA 2N87A 3FAPA 2KGJA 3O5RA 5DITA 5HW8A 5HUAA 4TNSA 1F8AB 1M5YA 2LKNA 1EYMA 2VN1A 2ZR6A 4J4OA 5J6EA 2AWGA 1FKTA 3KAHA 4ODPA 3KAIA 4QT3A 4LAXA 3O5LA 2PV1A 3JYMA 1Q6IA 4U84A 1TCOC 2PBCA 1HXVA 2K8IA 4ODNA 2ZQSA 1QPFA 4DT4A 1FKFA 1FKIA 2KFWA 2MNTA 2RUQA 2F4EA 1FAPA 4U85A 1D7HA 3CGMA 1JNTA 1YW5A 1Q6UA 2F2DA 3EY6A 3O5EA 3O5MA 4LAVA 2KE0A 2ZR4A 4ODMA 4W9OA 5HWBA 4J4NA 3IK8A 1A7XA 1FKGA 4DRMA 4FAPA 1D7JA 4ODOA 2PPPA 5DIVA 5I98A 2M1IA 5HW7A 1QZ2A 3PRDA 1NSGA 2DG3A 5HWCA 2MF9A 2XP9A 2MLZA 2RUCA 1P5QA 4LAWA 2ZQVA 4DRIA 4IQ2A 2VCDA 4MGVA 2PV3A 3KCEA 1Q1CA 1KT0A 3H9RB 5BXJA 3NTPA 1F40A 1L1PA 1D7IA 3CGNA 2XP3A 2XP8A 3O5GA 1FKHA 4ODQA 2Y78A 2LJ4A 4JFIA 5DIUA 4GIVA 4W9PA 2ZR5A 1J4RA 1J4HA 1QPLA 3GPKA 4JFLA 3KAGA 3VAWA 2DG9A 1D6OA 2XP5A 2FAPA 2XPAA 5HKGA 4DIPA 3JYJA 3IKGA 3O5QA 3RFWA 4DROA 2XPBA 4ITZA 4LAYA 1JNSA 1Q6HA 4TW6A 4DRKA 1FKBA 2JZVA 3O5OA 3PRBA 1J4IA 1B6CA 2MLYA 3IKDA 4TW8A 4TX0A 4BF8A 3O5KA 1BKFA 3NI6A 3UI4A 4GGQA 4NNRA 1ZK6A 2D9FA 4W9QA 1NMWA 1FKRA 1C9HA 2F21A 3UF8A 4DRNA 4DZ3A 3KABA 4JFMA 3O5IA 4ODLA 3B7XA 2KI3A 4JYSA 4N19A 5HT1A 5HTGA 1JVWA 1NMVA 1BL4A 1FJDA 1J6YA 3UI5A 4DRJA 3KAFA 4DZ2A 4ODKA 3I6CA 1PBKA 2MLXA 2KO7A 3KADA 1KT1A 4ODRA 3WH0A 2DG4A 4JFKA 2ITKA 4FN2A 1FKDA 2L2SA 4MSPA 2MPHA 1FKSA 4JFJA 4C02B 3PA7A 3IHZA 2XP6A 3LUOA 1U79A
chains in the Genus database with same CATH superfamily
3O5JA 4W5UA 1VF8A 1FFQA 2AOSA 4Z2GA 1W1TA 4WJXA 1JCHB 3WD1A 3B9AA 4R0XA 3WL0A 1WNOA 3ODKA 3OOBA 4R5EA 4G50A 3TCZA 4AY1A 4DRPA 4LGXA 2M2AA 2PPOA 1ZBWA 4DH0A 2ZQTA 4MNKA 1EQ3A 5D75A 4G2PA 3WD2A 4QZVB 4IPXA 3AROA 4P8WA 3TDBA 3JXVA 4TYOA 3MDYB 2ESCA 5HUAA 2WLYA 1F8AB 5J6EA 2AWGA 3KAHA 1W9VA 4U85A 4WIWA 1LL4A 3CGMA 1Q6UA 3ARSA 1E6RA 2QF8A 4ODOA 2WM0A 1QZ2A 3GU0A 2DG3A 1LL7A 4DWSD 2RUCA 4DRIA 3ARVA 4IQ2A 4IT4A 3H9RB 1W1VA 1HJVA 1H0IA 4ZPTR 2ZR5A 1J4RA 3KAGA 2DG9A 2O92A 1D6OA 5HKGA 2EULA 3ARZA 1FKBA 1LL6A 1WB0A 2DT1A 1KFWA 1NWSA 3IKDA 4NSBA 3BMBA 3NI6A 1JNEA 3KABA 3O5IA 4JYSA 5HT1A 3FXYA 1FJDA 4MNJA 2A3AA 2MLXA 2WK2A 3CZ8A 3WH0A 4JFKA 1EIBA 4FN2A 4MSPA 2MPHA 4UDMA 1E6PA 1HKKA 3IHZA 1LQ0A 1U79A 3O5MA 4Z2HA 1D2KA 2DSVA 2ZQUA 4S3JA 2M08A 1R9HA 2F23A 5HW6A 2A3EA 2IF4A 1CTNA 2FKEA 3OA5A 1LJYA 1N1AA 3O5PA 1W9UA 1FKJA 4QIBA 4P8XA 5GPGA 2RQSA 3UI6A 2OLHA 3UQIA 3UQBA 1FD9A 1FKKA 1WAWA 2Q5AA 3RGCA 3CHDA 1ROUA 1UR9A 1T11A 1W1PA 4HBEA 3FAPA 2KGJA 3FY1A 1ZL1A 1EYMA 1FKTA 2DPEA 2PV1A 2YBTA 1Q6IA 4MNLA 1HXVA 3ARTA 1FKFA 1FKIA 2MNTA 2RUQA 2F4EA 3B9DA 3EY6A 5HWBA 3ALFA 1E6ZA 3ARYA 3IK8A 4MTVA 3PRDA 1NSGA 1ZBKA 1ZBVA 3CHCA 2MLZA 1OGGA 4P8VA 1P5QA 2DT2A 2ZQVA 2VCDA 4MGVA 3KCEA 3RM4A 4Q7NA 4ODQA 3RM9A 3O5GA 1FKHA 3QOKA 5DIUA 1OWQA 1HJWA 4JFLA 1GUVA 2XP5A 2FAPA 1NWUA 4DROA 5DEZA 3EIPA 4TW6A 4HBOA 1J4IA 5JH8A 1GPFA 2B5UB 4GGQA 1E9LA 1ZK6A 5HBFA 1K9TA 1C9HA 4DZ3A 1LG1A 1HKMA 5HTGA 1JVWA 4ZPVR 1BL4A 3AS2A 1ZU8A 2P4VA 4Q22A 2PI6A 3UI5A 4DZ2A 1RD6A 1PBKA 2G41A 2KO7A 4ODRA 1X6NA 1FKDA 2L2SA 1H0GA 1FKSA 2B31A 1XRVA 1NH6A 2LPVA 4DRHA 3CH9A 1YATA 2XP4A 4U86A 3ALGA 1FKLA 3KZ7A 4DWSB 2XP7A 2RURA 2KR7A 2A3BA 2RSEA 3WD0A 3NRKA 2UZ5A 4TW7A 3KACA 2LGOA 4Z2KA 3PR9A 1W26A 2PN0A 3WL1A 1HKIA 3GTYX 2DT0A 4IQCA 3O5FA 1ROTA 3UQAA 4ZPWR 5B8IC 1E44A 4DWSC 1ZB5A 2N87A 5HW8A 4WK9A 4ZS6A 4TNSA 1M5YA 1UR8A 2LKNA 2ZR6A 3B9EA 3ARPA 1LG2A 1GRJA 1NWRA 1X6LA 4ODPA 3O5LA 4WKFA 3JYMA 1TCOC 2PBCA 4ODNA 2ETNA 4MAVA 4DT4A 2DSUA 2KFWA 1D7HA 1JNTA 2F2DA 1TFVA 3O5EA 5I98A 2KE0A 1E15A 1IX5A 4J4NA 1D7JA 4P8UA 2M1IA 3WKZA 3AQUA 2XP9A 1NWTA 4LAWA 4Z2LA 3CHEA 1SR0A 2PV3A 1F40A 3ARUA 1ZBCA 2Y78A 4XAKA 2LJ4A 1GOIA 1J4HA 1E6NA 1HJXA 1QPLA 3GPKA 4ML4A 4L3NA 2XPAA 4DIPA 3JYJA 3O5QA 3W4RA 4ITZA 4LAYA 1JNSA 2FDMA 4IT6A 4DRKA 3AS1A 4MNMA 1FFRA 3O5OA 1XHGA 3PRBA 4TX0A 4TW8A 2MLYA 4KQZA 2DSZA 4S3KA 1JNDA 3UI4A 4W9QA 3WQVA 1NMWA 1W1YA 2F21A 4DRNA 4JFMA 2IUZA 4ODLA 2KI3A 3WIJA 4DRJA 3KAFA 2WLZA 3ARQA 3I6CA 4DWSA 1SYTA 2A3CA 1KT1A 1EDQA 2DG4A 2ITKA 4JFJA 4C02B 2XP6A 1PINA 4QT2A 1Y0OA 2RUDA 3G6MA 2PV2A 3WQWA 3AS0A 2OFNA 3TC5A 1EHNA 4DRQA 4O2TA 3ARRA 3WD4A 3O5DA 2PPNA 3RMEA 4HARA 4Z2JA 1ZCNA 3ARWA 5DO2A 1ITXA 3AS3A 3O5RA 5DITA 2VN1A 4J4OA 3KAIA 4QT3A 4LAXA 5DF0A 4U84A 2K8IA 4NZCA 2ZQSA 1QPFA 1FAPA 1YW5A 4LAVA 4W9OA 4ODMA 2ZR4A 3CHFA 1A7XA 1FKGA 4KR0B 4DRMA 4FAPA 4WKAA 2PPPA 5DIVA 5HW7A 5HWCA 2MF9A 3WD3A 1W9PA 4PTMA 1Q1CA 1KT0A 5BXJA 3NTPA 2DSWA 1D7IA 1L1PA 3CGNA 2XP3A 2XP8A 4JFIA 4Z2IA 4GIVA 4W9PA 2YBUA 3BXWA 3VAWA 5GPRA 1HKJA 3IKGA 3RFWA 2XPBA 1Q6HA 1OGBA 2JZVA 3G6LA 1O6IA 1B6CA 4BF8A 3O5KA 1BKFA 3B8SA 4NNRA 2D9FA 1FKRA 3RM8A 2G8ZA 3UF8A 4L72B 3B7XA 4N19A 1NMVA 4URIA 3PRAA 1J6YA 2DT3A 4ODKA 3KADA 2O9OA 4MPKA 3ARXA 4WKHA 3PA7A 5GQBA 3LUOA
chains in the Genus database with same CATH topology
3O5JA 4W5UA 1VF8A 1FFQA 2AOSA 4Z2GA 1W1TA 4WJXA 3WD1A 3B9AA 4R0XA 3WL0A 1WNOA 3ODKA 3OOBA 4R5EA 4G50A 3TCZA 4AY1A 4DRPA 4LGXA 2M2AA 2PPOA 1ZBWA 4DH0A 2ZQTA 4MNKA 1EQ3A 5D75A 4G2PA 3WD2A 4QZVB 4IPXA 3AROA 4P8WA 3TDBA 3JXVA 4TYOA 3MDYB 2ESCA 5HUAA 2WLYA 1F8AB 5J6EA 2AWGA 3KAHA 1W9VA 4U85A 4WIWA 1LL4A 3CGMA 1Q6UA 3ARSA 1E6RA 2QF8A 4ODOA 2WM0A 1QZ2A 2DG3A 1LL7A 4DWSD 2RUCA 4DRIA 3ARVA 4IQ2A 4IT4A 3H9RB 1W1VA 1HJVA 1H0IA 4ZPTR 2ZR5A 1J4RA 3KAGA 2DG9A 2O92A 1D6OA 5HKGA 3ARZA 1FKBA 1LL6A 1WB0A 2DT1A 1KFWA 1NWSA 3IKDA 4NSBA 3NI6A 1JNEA 3KABA 3O5IA 4JYSA 5HT1A 3FXYA 1FJDA 4MNJA 2A3AA 2MLXA 2WK2A 3CZ8A 3WH0A 4JFKA 1EIBA 4FN2A 4MSPA 2MPHA 1E6PA 1HKKA 3IHZA 1LQ0A 3O5MA 1U79A 4Z2HA 1D2KA 2DSVA 2ZQUA 4S3JA 2M08A 1R9HA 5HW6A 2A3EA 2IF4A 1CTNA 2FKEA 3OA5A 1LJYA 1N1AA 3O5PA 1W9UA 1FKJA 4QIBA 4P8XA 5GPGA 2RQSA 3UI6A 2OLHA 3UQIA 3UQBA 1FD9A 1FKKA 1WAWA 2Q5AA 3RGCA 3CHDA 1ROUA 1UR9A 1T11A 1W1PA 4HBEA 3FAPA 2KGJA 3FY1A 1ZL1A 1EYMA 1FKTA 2DPEA 2PV1A 2YBTA 1Q6IA 4MNLA 1HXVA 3ARTA 1FKFA 1FKIA 2MNTA 2RUQA 2F4EA 3B9DA 3EY6A 5HWBA 3ALFA 1E6ZA 3ARYA 3IK8A 4MTVA 3PRDA 1NSGA 1ZBKA 1ZBVA 3CHCA 2MLZA 1OGGA 4P8VA 1P5QA 2DT2A 2ZQVA 2VCDA 4MGVA 3KCEA 3RM4A 4Q7NA 4ODQA 3RM9A 3O5GA 1FKHA 3QOKA 5DIUA 1OWQA 1HJWA 4JFLA 1GUVA 2XP5A 2FAPA 1NWUA 4DROA 5DEZA 4TW6A 4HBOA 1J4IA 5JH8A 1GPFA 4GGQA 1E9LA 1ZK6A 5HBFA 1K9TA 1C9HA 4DZ3A 1LG1A 1HKMA 5HTGA 1JVWA 4ZPVR 1BL4A 3AS2A 1ZU8A 4Q22A 2PI6A 3UI5A 4DZ2A 1RD6A 1PBKA 2G41A 2KO7A 4ODRA 1X6NA 1FKDA 2L2SA 1H0GA 1FKSA 2B31A 1XRVA 1NH6A 2LPVA 4DRHA 3CH9A 1YATA 2XP4A 4U86A 3ALGA 1FKLA 3KZ7A 4DWSB 2XP7A 2RURA 2KR7A 2A3BA 2RSEA 3WD0A 3NRKA 2UZ5A 4TW7A 3KACA 2LGOA 4Z2KA 3PR9A 1W26A 3WL1A 1HKIA 2DT0A 4IQCA 3O5FA 1ROTA 3UQAA 4ZPWR 5B8IC 4DWSC 1ZB5A 2N87A 5HW8A 4WK9A 4ZS6A 4TNSA 1M5YA 1UR8A 2LKNA 2ZR6A 3B9EA 3ARPA 1LG2A 1NWRA 1X6LA 4ODPA 3O5LA 4WKFA 3JYMA 1TCOC 2PBCA 4ODNA 4MAVA 4DT4A 2DSUA 2KFWA 1D7HA 1JNTA 2F2DA 1TFVA 3O5EA 5I98A 2KE0A 1E15A 1IX5A 4J4NA 1D7JA 4P8UA 2M1IA 3WKZA 3AQUA 2XP9A 1NWTA 4LAWA 4Z2LA 3CHEA 1SR0A 2PV3A 1F40A 3ARUA 1ZBCA 2Y78A 4XAKA 2LJ4A 1GOIA 1J4HA 1E6NA 1HJXA 1QPLA 3GPKA 4ML4A 4L3NA 2XPAA 4DIPA 3JYJA 3O5QA 3W4RA 4ITZA 4LAYA 1JNSA 2FDMA 4IT6A 4DRKA 3AS1A 4MNMA 1FFRA 3O5OA 1XHGA 3PRBA 4TX0A 4TW8A 2MLYA 4KQZA 2DSZA 4S3KA 1JNDA 3UI4A 4W9QA 3WQVA 1NMWA 1W1YA 2F21A 4DRNA 4JFMA 2IUZA 4ODLA 2KI3A 3WIJA 4DRJA 3KAFA 2WLZA 3ARQA 3I6CA 4DWSA 1SYTA 2A3CA 1KT1A 1EDQA 2DG4A 2ITKA 4JFJA 4C02B 2XP6A 1PINA 4QT2A 1Y0OA 2RUDA 3G6MA 2PV2A 3WQWA 3AS0A 2OFNA 3TC5A 1EHNA 4DRQA 4O2TA 3ARRA 3WD4A 3O5DA 2PPNA 3RMEA 4HARA 4Z2JA 1ZCNA 3ARWA 5DO2A 1ITXA 3AS3A 3O5RA 5DITA 2VN1A 4J4OA 3KAIA 4QT3A 4LAXA 5DF0A 4U84A 2K8IA 4NZCA 2ZQSA 1QPFA 1FAPA 1YW5A 4LAVA 4W9OA 4ODMA 2ZR4A 3CHFA 1A7XA 1FKGA 4KR0B 4DRMA 4FAPA 4WKAA 2PPPA 5DIVA 5HW7A 5HWCA 2MF9A 3WD3A 1W9PA 4PTMA 1Q1CA 1KT0A 5BXJA 3NTPA 2DSWA 1D7IA 1L1PA 3CGNA 2XP3A 2XP8A 4JFIA 4Z2IA 4GIVA 4W9PA 2YBUA 3BXWA 3VAWA 5GPRA 1HKJA 3IKGA 3RFWA 2XPBA 1Q6HA 1OGBA 2JZVA 3G6LA 1O6IA 1B6CA 4BF8A 3O5KA 1BKFA 3B8SA 4NNRA 2D9FA 1FKRA 3RM8A 2G8ZA 3UF8A 4L72B 3B7XA 4N19A 1NMVA 4URIA 3PRAA 1J6YA 2DT3A 4ODKA 3KADA 2O9OA 4MPKA 3ARXA 4WKHA 3PA7A 5GQBA 3LUOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O5J A;  2LPV A;  2ZQU A;  1PIN A;  4QT2 A;  1Y0O A;  1YAT A;  2RUD A;  2PV2 A;  4DRH A;  2M08 A;  2XP4 A;  4U86 A;  1R9H A;  5HW6 A;  1FKL A;  3KZ7 A;  4R0X A;  2IF4 A;  2OFN A;  2XP7 A;  3ODK A;  3OOB A;  2RUR A;  3TC5 A;  2FKE A;  2KR7 A;  4G50 A;  3TCZ A;  1N1A A;  3O5P A;  2RSE A;  4DRP A;  1FKJ A;  4DRQ A;  2M2A A;  2PPO A;  3NRK A;  2UZ5 A;  4TW7 A;  4QIB A;  3KAC A;  4DH0 A;  2LGO A;  2ZQT A;  1W26 A;  4O2T A;  5GPG A;  2RQS A;  3UI6 A;  3O5D A;  3UQI A;  5D75 A;  4IQC A;  1EQ3 A;  3O5F A;  1ROT A;  2PPN A;  3UQA A;  4G2P A;  3UQB A;  1FD9 A;  1FKK A;  4IPX A;  5B8I C;  2Q5A A;  3RGC A;  3TDB A;  3JXV A;  4TYO A;  1ROU A;  3MDY B;  1T11 A;  1ZCN A;  2N87 A;  3FAP A;  2KGJ A;  3O5R A;  5DIT A;  5HW8 A;  5HUA A;  4TNS A;  1F8A B;  1M5Y A;  2LKN A;  1EYM A;  2VN1 A;  2ZR6 A;  4J4O A;  5J6E A;  2AWG A;  1FKT A;  3KAH A;  4ODP A;  3KAI A;  4QT3 A;  4LAX A;  3O5L A;  2PV1 A;  3JYM A;  1Q6I A;  4U84 A;  1TCO C;  2PBC A;  1HXV A;  2K8I A;  4ODN A;  2ZQS A;  1QPF A;  4DT4 A;  1FKF A;  1FKI A;  2KFW A;  2MNT A;  2RUQ A;  2F4E A;  1FAP A;  4U85 A;  1D7H A;  3CGM A;  1JNT A;  1YW5 A;  1Q6U A;  2F2D A;  3EY6 A;  3O5E A;  3O5M A;  4LAV A;  2KE0 A;  2ZR4 A;  4ODM A;  4W9O A;  5HWB A;  4J4N A;  3IK8 A;  1A7X A;  1FKG A;  4DRM A;  4FAP A;  1D7J A;  4ODO A;  2PPP A;  5DIV A;  5I98 A;  2M1I A;  5HW7 A;  1QZ2 A;  3PRD A;  1NSG A;  2DG3 A;  5HWC A;  2MF9 A;  2XP9 A;  2MLZ A;  2RUC A;  1P5Q A;  4LAW A;  2ZQV A;  4DRI A;  4IQ2 A;  2VCD A;  4MGV A;  2PV3 A;  3KCE A;  1Q1C A;  1KT0 A;  3H9R B;  5BXJ A;  3NTP A;  1F40 A;  1L1P A;  1D7I A;  3CGN A;  2XP3 A;  2XP8 A;  3O5G A;  1FKH A;  4ODQ A;  2Y78 A;  2LJ4 A;  4JFI A;  5DIU A;  4GIV A;  4W9P A;  2ZR5 A;  1J4R A;  1J4H A;  1QPL A;  3GPK A;  4JFL A;  3KAG A;  3VAW A;  2DG9 A;  1D6O A;  2XP5 A;  2FAP A;  2XPA A;  5HKG A;  4DIP A;  3JYJ A;  3IKG A;  3O5Q A;  3RFW A;  4DRO A;  2XPB A;  4ITZ A;  4LAY A;  1JNS A;  1Q6H A;  4TW6 A;  4DRK A;  1FKB A;  2JZV A;  3O5O A;  3PRB A;  1J4I A;  1B6C A;  2MLY A;  3IKD A;  4TW8 A;  4TX0 A;  4BF8 A;  3O5K A;  1BKF A;  3NI6 A;  3UI4 A;  4GGQ A;  4NNR A;  1ZK6 A;  2D9F A;  4W9Q A;  1NMW A;  1FKR A;  1C9H A;  2F21 A;  3UF8 A;  4DRN A;  4DZ3 A;  3KAB A;  4JFM A;  3O5I A;  4ODL A;  3B7X A;  2KI3 A;  4JYS A;  4N19 A;  5HT1 A;  5HTG A;  1JVW A;  1NMV A;  1BL4 A;  1FJD A;  1J6Y A;  3UI5 A;  4DRJ A;  3KAF A;  4DZ2 A;  4ODK A;  3I6C A;  1PBK A;  2MLX A;  2KO7 A;  3KAD A;  1KT1 A;  4ODR A;  3WH0 A;  2DG4 A;  4JFK A;  2ITK A;  4FN2 A;  1FKD A;  2L2S A;  4MSP A;  2MPH A;  1FKS A;  4JFJ A;  4C02 B;  3PA7 A;  3IHZ A;  2XP6 A;  3LUO A;  1U79 A; 
#chains in the Genus database with same CATH topology
 3O5J A;  4W5U A;  1VF8 A;  1FFQ A;  2AOS A;  4Z2G A;  1W1T A;  4WJX A;  1JCH B;  3WD1 A;  3B9A A;  4R0X A;  3WL0 A;  1WNO A;  3ODK A;  3OOB A;  4R5E A;  4G50 A;  3TCZ A;  4AY1 A;  4DRP A;  4LGX A;  2M2A A;  2PPO A;  1ZBW A;  4DH0 A;  2ZQT A;  4MNK A;  1EQ3 A;  5D75 A;  4G2P A;  3WD2 A;  4QZV B;  4IPX A;  3ARO A;  4P8W A;  3TDB A;  3JXV A;  4TYO A;  3MDY B;  2ESC A;  5HUA A;  2WLY A;  1F8A B;  5J6E A;  2AWG A;  3KAH A;  1W9V A;  4U85 A;  4WIW A;  1LL4 A;  3CGM A;  1Q6U A;  3ARS A;  1E6R A;  2QF8 A;  4ODO A;  2WM0 A;  1QZ2 A;  3GU0 A;  2DG3 A;  1LL7 A;  4DWS D;  2RUC A;  4DRI A;  3ARV A;  4IQ2 A;  4IT4 A;  3H9R B;  1W1V A;  1HJV A;  1H0I A;  4ZPT R;  2ZR5 A;  1J4R A;  3KAG A;  2DG9 A;  2O92 A;  1D6O A;  5HKG A;  2EUL A;  3ARZ A;  1FKB A;  1LL6 A;  1WB0 A;  2DT1 A;  1KFW A;  1NWS A;  3IKD A;  4NSB A;  3BMB A;  3NI6 A;  1JNE A;  3KAB A;  3O5I A;  4JYS A;  5HT1 A;  3FXY A;  1FJD A;  4MNJ A;  2A3A A;  2MLX A;  2WK2 A;  3CZ8 A;  3WH0 A;  4JFK A;  1EIB A;  4FN2 A;  4MSP A;  2MPH A;  4UDM A;  1E6P A;  1HKK A;  3IHZ A;  1LQ0 A;  1U79 A;  3O5M A;  4Z2H A;  1D2K A;  2DSV A;  2ZQU A;  4S3J A;  2M08 A;  1R9H A;  2F23 A;  5HW6 A;  2A3E A;  2IF4 A;  1CTN A;  2FKE A;  3OA5 A;  1LJY A;  1N1A A;  3O5P A;  1W9U A;  1FKJ A;  4QIB A;  4P8X A;  5GPG A;  2RQS A;  3UI6 A;  2OLH A;  3UQI A;  3UQB A;  1FD9 A;  1FKK A;  1WAW A;  2Q5A A;  3RGC A;  3CHD A;  1ROU A;  1UR9 A;  1T11 A;  1W1P A;  4HBE A;  3FAP A;  2KGJ A;  3FY1 A;  1ZL1 A;  1EYM A;  1FKT A;  2DPE A;  2PV1 A;  2YBT A;  1Q6I A;  4MNL A;  1HXV A;  3ART A;  1FKF A;  1FKI A;  2MNT A;  2RUQ A;  2F4E A;  3B9D A;  3EY6 A;  5HWB A;  3ALF A;  1E6Z A;  3ARY A;  3IK8 A;  4MTV A;  3PRD A;  1NSG A;  1ZBK A;  1ZBV A;  3CHC A;  2MLZ A;  1OGG A;  4P8V A;  1P5Q A;  2DT2 A;  2ZQV A;  2VCD A;  4MGV A;  3KCE A;  3RM4 A;  4Q7N A;  4ODQ A;  3RM9 A;  3O5G A;  1FKH A;  3QOK A;  5DIU A;  1OWQ A;  1HJW A;  4JFL A;  1GUV A;  2XP5 A;  2FAP A;  1NWU A;  4DRO A;  5DEZ A;  3EIP A;  4TW6 A;  4HBO A;  1J4I A;  5JH8 A;  1GPF A;  2B5U B;  4GGQ A;  1E9L A;  1ZK6 A;  5HBF A;  1K9T A;  1C9H A;  4DZ3 A;  1LG1 A;  1HKM A;  5HTG A;  1JVW A;  4ZPV R;  1BL4 A;  3AS2 A;  1ZU8 A;  2P4V A;  4Q22 A;  2PI6 A;  3UI5 A;  4DZ2 A;  1RD6 A;  1PBK A;  2G41 A;  2KO7 A;  4ODR A;  1X6N A;  1FKD A;  2L2S A;  1H0G A;  1FKS A;  2B31 A;  1XRV A;  1NH6 A;  2LPV A;  4DRH A;  3CH9 A;  1YAT A;  2XP4 A;  4U86 A;  3ALG A;  1FKL A;  3KZ7 A;  4DWS B;  2XP7 A;  2RUR A;  2KR7 A;  2A3B A;  2RSE A;  3WD0 A;  3NRK A;  2UZ5 A;  4TW7 A;  3KAC A;  2LGO A;  4Z2K A;  3PR9 A;  1W26 A;  2PN0 A;  3WL1 A;  1HKI A;  3GTY X;  2DT0 A;  4IQC A;  3O5F A;  1ROT A;  3UQA A;  4ZPW R;  5B8I C;  1E44 A;  4DWS C;  1ZB5 A;  2N87 A;  5HW8 A;  4WK9 A;  4ZS6 A;  4TNS A;  1M5Y A;  1UR8 A;  2LKN A;  2ZR6 A;  3B9E A;  3ARP A;  1LG2 A;  1GRJ A;  1NWR A;  1X6L A;  4ODP A;  3O5L A;  4WKF A;  3JYM A;  1TCO C;  2PBC A;  4ODN A;  2ETN A;  4MAV A;  4DT4 A;  2DSU A;  2KFW A;  1D7H A;  1JNT A;  2F2D A;  1TFV A;  3O5E A;  5I98 A;  2KE0 A;  1E15 A;  1IX5 A;  4J4N A;  1D7J A;  4P8U A;  2M1I A;  3WKZ A;  3AQU A;  2XP9 A;  1NWT A;  4LAW A;  4Z2L A;  3CHE A;  1SR0 A;  2PV3 A;  1F40 A;  3ARU A;  1ZBC A;  2Y78 A;  4XAK A;  2LJ4 A;  1GOI A;  1J4H A;  1E6N A;  1HJX A;  1QPL A;  3GPK A;  4ML4 A;  4L3N A;  2XPA A;  4DIP A;  3JYJ A;  3O5Q A;  3W4R A;  4ITZ A;  4LAY A;  1JNS A;  2FDM A;  4IT6 A;  4DRK A;  3AS1 A;  4MNM A;  1FFR A;  3O5O A;  1XHG A;  3PRB A;  4TX0 A;  4TW8 A;  2MLY A;  4KQZ A;  2DSZ A;  4S3K A;  1JND A;  3UI4 A;  4W9Q A;  3WQV A;  1NMW A;  1W1Y A;  2F21 A;  4DRN A;  4JFM A;  2IUZ A;  4ODL A;  2KI3 A;  3WIJ A;  4DRJ A;  3KAF A;  2WLZ A;  3ARQ A;  3I6C A;  4DWS A;  1SYT A;  2A3C A;  1KT1 A;  1EDQ A;  2DG4 A;  2ITK A;  4JFJ A;  4C02 B;  2XP6 A;  1PIN A;  4QT2 A;  1Y0O A;  2RUD A;  3G6M A;  2PV2 A;  3WQW A;  3AS0 A;  2OFN A;  3TC5 A;  1EHN A;  4DRQ A;  4O2T A;  3ARR A;  3WD4 A;  3O5D A;  2PPN A;  3RME A;  4HAR A;  4Z2J A;  1ZCN A;  3ARW A;  5DO2 A;  1ITX A;  3AS3 A;  3O5R A;  5DIT A;  2VN1 A;  4J4O A;  3KAI A;  4QT3 A;  4LAX A;  5DF0 A;  4U84 A;  2K8I A;  4NZC A;  2ZQS A;  1QPF A;  1FAP A;  1YW5 A;  4LAV A;  4W9O A;  4ODM A;  2ZR4 A;  3CHF A;  1A7X A;  1FKG A;  4KR0 B;  4DRM A;  4FAP A;  4WKA A;  2PPP A;  5DIV A;  5HW7 A;  5HWC A;  2MF9 A;  3WD3 A;  1W9P A;  4PTM A;  1Q1C A;  1KT0 A;  5BXJ A;  3NTP A;  2DSW A;  1D7I A;  1L1P A;  3CGN A;  2XP3 A;  2XP8 A;  4JFI A;  4Z2I A;  4GIV A;  4W9P A;  2YBU A;  3BXW A;  3VAW A;  5GPR A;  1HKJ A;  3IKG A;  3RFW A;  2XPB A;  1Q6H A;  1OGB A;  2JZV A;  3G6L A;  1O6I A;  1B6C A;  4BF8 A;  3O5K A;  1BKF A;  3B8S A;  4NNR A;  2D9F A;  1FKR A;  3RM8 A;  2G8Z A;  3UF8 A;  4L72 B;  3B7X A;  4N19 A;  1NMV A;  4URI A;  3PRA A;  1J6Y A;  2DT3 A;  4ODK A;  3KAD A;  2O9O A;  4MPK A;  3ARX A;  4WKH A;  3PA7 A;  5GQB A;  3LUO A; 
#chains in the Genus database with same CATH homology
 3O5J A;  4W5U A;  1VF8 A;  1FFQ A;  2AOS A;  4Z2G A;  1W1T A;  4WJX A;  3WD1 A;  3B9A A;  4R0X A;  3WL0 A;  1WNO A;  3ODK A;  3OOB A;  4R5E A;  4G50 A;  3TCZ A;  4AY1 A;  4DRP A;  4LGX A;  2M2A A;  2PPO A;  1ZBW A;  4DH0 A;  2ZQT A;  4MNK A;  1EQ3 A;  5D75 A;  4G2P A;  3WD2 A;  4QZV B;  4IPX A;  3ARO A;  4P8W A;  3TDB A;  3JXV A;  4TYO A;  3MDY B;  2ESC A;  5HUA A;  2WLY A;  1F8A B;  5J6E A;  2AWG A;  3KAH A;  1W9V A;  4U85 A;  4WIW A;  1LL4 A;  3CGM A;  1Q6U A;  3ARS A;  1E6R A;  2QF8 A;  4ODO A;  2WM0 A;  1QZ2 A;  2DG3 A;  1LL7 A;  4DWS D;  2RUC A;  4DRI A;  3ARV A;  4IQ2 A;  4IT4 A;  3H9R B;  1W1V A;  1HJV A;  1H0I A;  4ZPT R;  2ZR5 A;  1J4R A;  3KAG A;  2DG9 A;  2O92 A;  1D6O A;  5HKG A;  3ARZ A;  1FKB A;  1LL6 A;  1WB0 A;  2DT1 A;  1KFW A;  1NWS A;  3IKD A;  4NSB A;  3NI6 A;  1JNE A;  3KAB A;  3O5I A;  4JYS A;  5HT1 A;  3FXY A;  1FJD A;  4MNJ A;  2A3A A;  2MLX A;  2WK2 A;  3CZ8 A;  3WH0 A;  4JFK A;  1EIB A;  4FN2 A;  4MSP A;  2MPH A;  1E6P A;  1HKK A;  3IHZ A;  1LQ0 A;  3O5M A;  1U79 A;  4Z2H A;  1D2K A;  2DSV A;  2ZQU A;  4S3J A;  2M08 A;  1R9H A;  5HW6 A;  2A3E A;  2IF4 A;  1CTN A;  2FKE A;  3OA5 A;  1LJY A;  1N1A A;  3O5P A;  1W9U A;  1FKJ A;  4QIB A;  4P8X A;  5GPG A;  2RQS A;  3UI6 A;  2OLH A;  3UQI A;  3UQB A;  1FD9 A;  1FKK A;  1WAW A;  2Q5A A;  3RGC A;  3CHD A;  1ROU A;  1UR9 A;  1T11 A;  1W1P A;  4HBE A;  3FAP A;  2KGJ A;  3FY1 A;  1ZL1 A;  1EYM A;  1FKT A;  2DPE A;  2PV1 A;  2YBT A;  1Q6I A;  4MNL A;  1HXV A;  3ART A;  1FKF A;  1FKI A;  2MNT A;  2RUQ A;  2F4E A;  3B9D A;  3EY6 A;  5HWB A;  3ALF A;  1E6Z A;  3ARY A;  3IK8 A;  4MTV A;  3PRD A;  1NSG A;  1ZBK A;  1ZBV A;  3CHC A;  2MLZ A;  1OGG A;  4P8V A;  1P5Q A;  2DT2 A;  2ZQV A;  2VCD A;  4MGV A;  3KCE A;  3RM4 A;  4Q7N A;  4ODQ A;  3RM9 A;  3O5G A;  1FKH A;  3QOK A;  5DIU A;  1OWQ A;  1HJW A;  4JFL A;  1GUV A;  2XP5 A;  2FAP A;  1NWU A;  4DRO A;  5DEZ A;  4TW6 A;  4HBO A;  1J4I A;  5JH8 A;  1GPF A;  4GGQ A;  1E9L A;  1ZK6 A;  5HBF A;  1K9T A;  1C9H A;  4DZ3 A;  1LG1 A;  1HKM A;  5HTG A;  1JVW A;  4ZPV R;  1BL4 A;  3AS2 A;  1ZU8 A;  4Q22 A;  2PI6 A;  3UI5 A;  4DZ2 A;  1RD6 A;  1PBK A;  2G41 A;  2KO7 A;  4ODR A;  1X6N A;  1FKD A;  2L2S A;  1H0G A;  1FKS A;  2B31 A;  1XRV A;  1NH6 A;  2LPV A;  4DRH A;  3CH9 A;  1YAT A;  2XP4 A;  4U86 A;  3ALG A;  1FKL A;  3KZ7 A;  4DWS B;  2XP7 A;  2RUR A;  2KR7 A;  2A3B A;  2RSE A;  3WD0 A;  3NRK A;  2UZ5 A;  4TW7 A;  3KAC A;  2LGO A;  4Z2K A;  3PR9 A;  1W26 A;  3WL1 A;  1HKI A;  2DT0 A;  4IQC A;  3O5F A;  1ROT A;  3UQA A;  4ZPW R;  5B8I C;  4DWS C;  1ZB5 A;  2N87 A;  5HW8 A;  4WK9 A;  4ZS6 A;  4TNS A;  1M5Y A;  1UR8 A;  2LKN A;  2ZR6 A;  3B9E A;  3ARP A;  1LG2 A;  1NWR A;  1X6L A;  4ODP A;  3O5L A;  4WKF A;  3JYM A;  1TCO C;  2PBC A;  4ODN A;  4MAV A;  4DT4 A;  2DSU A;  2KFW A;  1D7H A;  1JNT A;  2F2D A;  1TFV A;  3O5E A;  5I98 A;  2KE0 A;  1E15 A;  1IX5 A;  4J4N A;  1D7J A;  4P8U A;  2M1I A;  3WKZ A;  3AQU A;  2XP9 A;  1NWT A;  4LAW A;  4Z2L A;  3CHE A;  1SR0 A;  2PV3 A;  1F40 A;  3ARU A;  1ZBC A;  2Y78 A;  4XAK A;  2LJ4 A;  1GOI A;  1J4H A;  1E6N A;  1HJX A;  1QPL A;  3GPK A;  4ML4 A;  4L3N A;  2XPA A;  4DIP A;  3JYJ A;  3O5Q A;  3W4R A;  4ITZ A;  4LAY A;  1JNS A;  2FDM A;  4IT6 A;  4DRK A;  3AS1 A;  4MNM A;  1FFR A;  3O5O A;  1XHG A;  3PRB A;  4TX0 A;  4TW8 A;  2MLY A;  4KQZ A;  2DSZ A;  4S3K A;  1JND A;  3UI4 A;  4W9Q A;  3WQV A;  1NMW A;  1W1Y A;  2F21 A;  4DRN A;  4JFM A;  2IUZ A;  4ODL A;  2KI3 A;  3WIJ A;  4DRJ A;  3KAF A;  2WLZ A;  3ARQ A;  3I6C A;  4DWS A;  1SYT A;  2A3C A;  1KT1 A;  1EDQ A;  2DG4 A;  2ITK A;  4JFJ A;  4C02 B;  2XP6 A;  1PIN A;  4QT2 A;  1Y0O A;  2RUD A;  3G6M A;  2PV2 A;  3WQW A;  3AS0 A;  2OFN A;  3TC5 A;  1EHN A;  4DRQ A;  4O2T A;  3ARR A;  3WD4 A;  3O5D A;  2PPN A;  3RME A;  4HAR A;  4Z2J A;  1ZCN A;  3ARW A;  5DO2 A;  1ITX A;  3AS3 A;  3O5R A;  5DIT A;  2VN1 A;  4J4O A;  3KAI A;  4QT3 A;  4LAX A;  5DF0 A;  4U84 A;  2K8I A;  4NZC A;  2ZQS A;  1QPF A;  1FAP A;  1YW5 A;  4LAV A;  4W9O A;  4ODM A;  2ZR4 A;  3CHF A;  1A7X A;  1FKG A;  4KR0 B;  4DRM A;  4FAP A;  4WKA A;  2PPP A;  5DIV A;  5HW7 A;  5HWC A;  2MF9 A;  3WD3 A;  1W9P A;  4PTM A;  1Q1C A;  1KT0 A;  5BXJ A;  3NTP A;  2DSW A;  1D7I A;  1L1P A;  3CGN A;  2XP3 A;  2XP8 A;  4JFI A;  4Z2I A;  4GIV A;  4W9P A;  2YBU A;  3BXW A;  3VAW A;  5GPR A;  1HKJ A;  3IKG A;  3RFW A;  2XPB A;  1Q6H A;  1OGB A;  2JZV A;  3G6L A;  1O6I A;  1B6C A;  4BF8 A;  3O5K A;  1BKF A;  3B8S A;  4NNR A;  2D9F A;  1FKR A;  3RM8 A;  2G8Z A;  3UF8 A;  4L72 B;  3B7X A;  4N19 A;  1NMV A;  4URI A;  3PRA A;  1J6Y A;  2DT3 A;  4ODK A;  3KAD A;  2O9O A;  4MPK A;  3ARX A;  4WKH A;  3PA7 A;  5GQB A;  3LUO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...