1HXVA

Ppiase domain of the mycoplasma genitalium trigger factor
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
85
structure length
85
Chain Sequence
b'KLANGDIAIIDFTGIVDNKKLASASAQNYELTIGSNSFIKGFETGLIAMKVNQKKTLALTFPSDYHVKELQSKPVTFEVVLKAIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRIGGER FACTOR
publication title NMR solution structure and dynamics of the peptidyl-prolyl cis-trans isomerase domain of the trigger factor from Mycoplasma genitalium compared to FK506-binding protein.
pubmed doi rcsb
source organism Mycoplasma genitalium
molecule tags Chaperone
total genus 8
structure length 85
sequence length 85
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2001-01-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1hxvA00
3KABA 4W9PA 5DITA 1FKLA 3O5GA 4C02B 4BF8A 2L2SA 4GIVA 4JFLA 4DROA 2PV1A 4TW8A 5DIVA 1Q1CA 4DZ2A 4U85A 3ODKA 5BXJA 3OOBA 1U79A 4LAYA 2ITKA 3KAGA 4ODQA 2KFWA 2VCDA 2ZR6A 4J4OA 4MSPA 4U86A 4DIPA 1JNSA 3GPKA 3B7XA 1JVWA 2RQSA 2MLZA 5HWBA 4JFKA 1L1PA 2LGOA 3FAPA 3O5MA 5J6EA 1QZ2A 2ZR4A 2XP5A 4IPXA 1EYMA 5HTGA 3IKDA 1BL4A 3MDYB 5I98A 3UQAA 1FKFA 3O5EA 2FKEA 1P5QA 1TCOC 2LJ4A 2PBCA 1ZK6A 1FAPA 2MLYA 3CGMA 3KAFA 5HKGA 5HUAA 4U84A 1J4IA 2ZR5A 4O2TA 3VAWA 4DZ3A 4J4NA 3TDBA 4DRHA 2RUDA 4ODPA 1FJDA 4DH0A 2AWGA 3O5QA 4IQ2A 4W9OA 4G50A 3EY6A 5HW8A 1FKGA 3LUOA 5GPGA 4GGQA 4ODMA 2PPOA 1F8AB 1D6OA 2OFNA 1HXVA 1ROTA 4G2PA 1YW5A 1J6YA 2KR7A 3O5FA 3PRBA 4DRMA 1D7HA 3KADA 2Y78A 3UQBA 2DG9A 2XP3A 4TNSA 3O5DA 1QPLA 2PV3A 4LAVA 3TCZA 2ZQSA 2KO7A 2XP6A 3I6CA 1J4RA 3KAIA 3O5IA 2XP9A 1D7JA 1PINA 4NNRA 3O5LA 3PRDA 1ROUA 1FKKA 1FKSA 1NMWA 3IKGA 2XP8A 2XP4A 3O5PA 5HW7A 5HT1A 4LAXA 2LKNA 5DIUA 2KE0A 4W9QA 1C9HA 4QT2A 1FKDA 1M5YA 1QPFA 1ZCNA 1D7IA 3KZ7A 3RFWA 3UQIA 2PPPA 2VN1A 4JFMA 5HW6A 3JXVA 3RGCA 2XPBA 4DRPA 1JNTA 1FKHA 1FKBA 2DG4A 2RUCA 3WH0A 3O5OA 4MGVA 4DRQA 2F21A 2RSEA 3O5RA 3CGNA 2F4EA 1Q6UA 4N19A 2M2AA 2IF4A 4TYOA 4DRIA 1N1AA 1R9HA 2PV2A 2M08A 1YATA 1BKFA 1FKIA 3JYJA 3PA7A 1FD9A 5B8IC 2XPAA 4R0XA 2ZQVA 2N87A 1W26A 4TW7A 2MF9A 1EQ3A 4QIBA 2UZ5A 1B6CA 3IHZA 4ITZA 3NI6A 4DRNA 4DT4A 2M1IA 2ZQTA 1NMVA 3NRKA 4QT3A 2MLXA 2PPNA 2RUQA 3H9RB 4TX0A 3IK8A 4FAPA 3KCEA 3JYMA 3TC5A 5HWCA 2RURA 2FAPA 3KAHA 2K8IA 4ODOA 2D9FA 4JYSA 2KGJA 2Q5AA 2XP7A 1J4HA 1T11A 1Q6IA 1FKRA 4JFJA 2ZQUA 4TW6A 1FKTA 4FN2A 4IQCA 2KI3A 1F40A 1NSGA 2MPHA 3O5JA 3UI4A 3KACA 3UF8A 2F2DA 3O5KA 4ODLA 4ODKA 4ODRA 4DRKA 1Q6HA 1KT1A 2JZVA 4LAWA 1Y0OA 3NTPA 1KT0A 4JFIA 2DG3A 4ODNA 3UI6A 1A7XA 1FKJA 2MNTA 1PBKA 5D75A 3UI5A 2LPVA 4DRJA
chains in the Genus database with same CATH superfamily
3KABA 3GU0A 3ARWA 3PR9A 4BF8A 1H0IA 1OGGA 3ARPA 5BXJA 2B31A 4LAYA 3KAGA 2KFWA 2ZR6A 3GPKA 2RQSA 1OGBA 4ZPTR 1HKIA 1E6PA 3ARXA 3MDYB 1NWRA 3ARQA 1X6LA 2LJ4A 1ZK6A 2ETNA 3AS1A 1IX5A 2AWGA 4HARA 4L72B 5HW8A 5GPGA 2QF8A 3WL1A 5GQBA 4G2PA 1D7HA 2DG9A 1QPLA 3OA5A 4LAVA 2XP6A 1FFRA 3AQUA 3O5IA 4NNRA 1LJYA 1NWUA 3O5PA 1LG2A 4LAXA 5DIUA 4W9QA 1QPFA 1XRVA 2DSWA 2PPPA 1LG1A 2DSUA 2XPBA 3RGCA 4DRPA 2DPEA 2DG4A 2FDMA 3O5OA 4Z2KA 3O5RA 3CGNA 4ML4A 4ZS6A 2ESCA 4ZPWR 1N1AA 3WD0A 3WKZA 3CHCA 3JYJA 1E6NA 2ZQVA 1ITXA 1GPFA 4TX0A 4L3NA 2O92A 3TC5A 1WNOA 2RURA 2FAPA 3KAHA 3ALGA 2B5UB 4WKAA 3WD2A 1O6IA 1SR0A 2KGJA 4WKFA 1UR8A 4JFJA 1FKTA 2PI6A 2KI3A 1HJWA 3O5JA 2EULA 2WM0A 3O5KA 2OLHA 1KT1A 1LQ0A 1Y0OA 3NTPA 4JFIA 1A7XA 1ZB5A 2Y78A 1PBKA 1E15A 5D75A 2LPVA 3WD4A 3ARTA 5DITA 4ZPVR 4PTMA 4MNLA 4GIVA 4JFLA 1Q1CA 4U85A 1U79A 4QZVB 4ODQA 3BXWA 4J4OA 1W1VA 4MSPA 4DIPA 3B9EA 4LGXA 3B8SA 1JVWA 2WLYA 4XAKA 3O5MA 1QZ2A 2XP5A 5HTGA 1GOIA 3IKDA 5I98A 4WIWA 1TCOC 2PBCA 2MLYA 4J4NA 1W1TA 3TDBA 4DRHA 4HBOA 3AS3A 3ARZA 1ZBKA 3O5QA 3CHFA 4G50A 3LUOA 1NWTA 1WAWA 1NWSA 1F8AB 1HXVA 1ZBWA 1NH6A 3ARVA 3G6LA 1YW5A 3ARUA 3KADA 2XP3A 5GPRA 1W9UA 4TNSA 2KO7A 4MTVA 1J4RA 2XP9A 1D7JA 1X6NA 5HW7A 2XP8A 2AOSA 1W9PA 1LL6A 2WK2A 3CHEA 1FKDA 1CTNA 2P4VA 3KZ7A 3RFWA 1HKKA 4Z2JA 3JXVA 1GUVA 1JNTA 3RM9A 4MNMA 4MGVA 3RM4A 2F21A 2RSEA 2F23A 2M2AA 4W5UA 3AS0A 4WK9A 2PV2A 1BKFA 1FKIA 3ALFA 3GTYX 4AY1A 1FD9A 3PRAA 4QIBA 1ZBCA 3IHZA 1E44A 3ARRA 2ZQTA 2PPNA 3H9RB 3KCEA 1W9VA 4IT4A 2G8ZA 4ODOA 4R5EA 3RM8A 2D9FA 2Q5AA 4Q22A 1D2KA 1HJXA 4MAVA 2MPHA 3UI4A 3KACA 3WD1A 3B9DA 2YBTA 4Q7NA 4LAWA 1JNDA 1KT0A 4DWSD 2DG3A 2WLZA 4ODNA 3WL0A 1FKLA 3O5GA 3B9AA 4P8WA 4TW8A 5DIVA 3ODKA 2A3AA 3OOBA 2DT1A 4S3KA 4U86A 3WQVA 3B7XA 5HWBA 4JFKA 1L1PA 5J6EA 3CZ8A 1EYMA 1LL7A 3O5EA 4MNJA 1P5QA 5HUAA 3WQWA 1FAPA 3CGMA 5HKGA 1J4IA 2ZR5A 2G41A 4ODPA 3QOKA 3WD3A 3EY6A 1FKGA 2PPOA 4KQZA 2KR7A 3O5FA 2A3BA 3RMEA 5JH8A 3O5DA 1HKMA 2ZQSA 4Z2HA 3KAIA 3AROA 3PRDA 1FKKA 1EHNA 3IKGA 3WIJA 4DWSA 2LKNA 1ZL1A 2O9OA 1C9HA 3ARSA 4QT2A 5DO2A 5DEZA 1M5YA 1ZCNA 4S3JA 3UQIA 3BMBA 2VN1A 4JFMA 5HW6A 3G6MA 1RD6A 1FKHA 3WH0A 2RUCA 3EIPA 4IT6A 4NSBA 1E6ZA 1Q6UA 4N19A 2IF4A 4DRIA 1R9HA 1YATA 2DT2A 3PA7A 2XPAA 1JCHB 4R0XA 2N87A 1W26A 4TW7A 1E6RA 3NI6A 4DT4A 2M1IA 1NMVA 1EQ3A 4FAPA 2A3EA 3IK8A 4NZCA 5HWCA 2K8IA 2IUZA 3W4RA 1ZBVA 1WB0A 4JYSA 2XP7A 1J4HA 1FKRA 2ZQUA 4IQCA 3ARYA 1NSGA 3FY1A 4ODRA 4DRKA 1OWQA 1XHGA 1FFQA 4W9PA 4C02B 4DWSB 5DF0A 2L2SA 4DROA 2PV1A 4DZ2A 1EIBA 1HJVA 2ITKA 2DT0A 2VCDA 1JNSA 2MLZA 2LGOA 3FAPA 2ZR4A 4IPXA 2DT3A 4WJXA 1BL4A 3UQAA 1FKFA 1HKJA 1KFWA 2FKEA 4UDMA 3KAFA 4U84A 3VAWA 4O2TA 4DZ3A 1EDQA 2RUDA 1FJDA 4DH0A 1UR9A 4MPKA 4IQ2A 4W9OA 4GGQA 4ODMA 1D6OA 2OFNA 1ROTA 1J6YA 3PRBA 4DRMA 3UQBA 2PV3A 3TCZA 3I6CA 1PINA 3O5LA 1ROUA 1FKSA 1NMWA 1SYTA 2XP4A 3CHDA 4WKHA 1ZU8A 5HT1A 1W1YA 1JNEA 2KE0A 2PN0A 2A3CA 1D7IA 1LL4A 4DWSC 4Z2LA 1FKBA 3AS2A 4DRQA 1W1PA 2F4EA 4URIA 4P8UA 4TYOA 2M08A 4KR0B 5B8IC 2DSVA 5HBFA 2MF9A 2DSZA 2UZ5A 1B6CA 4ITZA 4DRNA 3FXYA 3NRKA 2YBUA 2MLXA 2RUQA 1VF8A 4QT3A 3JYMA 1E9LA 3CH9A 1T11A 1H0GA 1Q6IA 4Z2IA 4TW6A 4MNKA 1GRJA 4FN2A 1TFVA 1K9TA 1F40A 3UF8A 2F2DA 4ODLA 4HBEA 4ODKA 1Q6HA 2JZVA 4P8VA 3UI6A 1FKJA 2MNTA 4P8XA 3UI5A 4Z2GA 4DRJA
chains in the Genus database with same CATH topology
3KABA 3ARWA 3PR9A 4BF8A 1H0IA 1OGGA 3ARPA 5BXJA 2B31A 4LAYA 3KAGA 2KFWA 2ZR6A 3GPKA 2RQSA 1OGBA 4ZPTR 1HKIA 1E6PA 3ARXA 3MDYB 1NWRA 3ARQA 1X6LA 2LJ4A 1ZK6A 3AS1A 1IX5A 2AWGA 4HARA 4L72B 5HW8A 5GPGA 2QF8A 3WL1A 5GQBA 4G2PA 1D7HA 2DG9A 1QPLA 3OA5A 4LAVA 2XP6A 1FFRA 3AQUA 3O5IA 4NNRA 1LJYA 1NWUA 3O5PA 1LG2A 4LAXA 5DIUA 4W9QA 1QPFA 1XRVA 2DSWA 2PPPA 1LG1A 2DSUA 2XPBA 3RGCA 4DRPA 2DPEA 2DG4A 2FDMA 3O5OA 4Z2KA 3O5RA 3CGNA 4ML4A 4ZS6A 2ESCA 4ZPWR 1N1AA 3WD0A 3WKZA 3CHCA 3JYJA 1E6NA 2ZQVA 1ITXA 1GPFA 4TX0A 4L3NA 2O92A 3TC5A 1WNOA 2RURA 2FAPA 3KAHA 3ALGA 4WKAA 3WD2A 1O6IA 1SR0A 2KGJA 4WKFA 1UR8A 4JFJA 1FKTA 2PI6A 2KI3A 1HJWA 3O5JA 2WM0A 3O5KA 2OLHA 1KT1A 1LQ0A 1Y0OA 3NTPA 4JFIA 1A7XA 1ZB5A 2Y78A 1PBKA 1E15A 5D75A 2LPVA 3WD4A 3ARTA 5DITA 4ZPVR 4PTMA 4MNLA 4GIVA 4JFLA 1Q1CA 4U85A 1U79A 4QZVB 4ODQA 3BXWA 4J4OA 1W1VA 4MSPA 4DIPA 3B9EA 4LGXA 3B8SA 1JVWA 2WLYA 4XAKA 3O5MA 1QZ2A 2XP5A 5HTGA 1GOIA 3IKDA 5I98A 4WIWA 1TCOC 2PBCA 2MLYA 4J4NA 1W1TA 3TDBA 4DRHA 4HBOA 3AS3A 3ARZA 1ZBKA 3O5QA 3CHFA 4G50A 3LUOA 1NWTA 1WAWA 1NWSA 1F8AB 1HXVA 1ZBWA 1NH6A 3ARVA 3G6LA 1YW5A 3ARUA 3KADA 2XP3A 5GPRA 1W9UA 4TNSA 2KO7A 4MTVA 1J4RA 2XP9A 1D7JA 1X6NA 5HW7A 2XP8A 2AOSA 1W9PA 1LL6A 2WK2A 3CHEA 1FKDA 1CTNA 3KZ7A 3RFWA 1HKKA 4Z2JA 3JXVA 1GUVA 1JNTA 3RM9A 4MNMA 4MGVA 3RM4A 2F21A 2RSEA 2M2AA 4W5UA 3AS0A 4WK9A 2PV2A 1BKFA 1FKIA 3ALFA 4AY1A 1FD9A 3PRAA 4QIBA 1ZBCA 3IHZA 3ARRA 2ZQTA 2PPNA 3H9RB 3KCEA 1W9VA 4IT4A 2G8ZA 4ODOA 4R5EA 3RM8A 2D9FA 2Q5AA 4Q22A 1D2KA 1HJXA 4MAVA 2MPHA 3UI4A 3KACA 3WD1A 3B9DA 2YBTA 4Q7NA 4LAWA 1JNDA 1KT0A 4DWSD 2DG3A 2WLZA 4ODNA 3WL0A 1FKLA 3O5GA 3B9AA 4P8WA 4TW8A 5DIVA 3ODKA 2A3AA 3OOBA 2DT1A 4S3KA 4U86A 3WQVA 3B7XA 5HWBA 4JFKA 1L1PA 5J6EA 3CZ8A 1EYMA 1LL7A 3O5EA 4MNJA 1P5QA 5HUAA 3WQWA 1FAPA 3CGMA 5HKGA 1J4IA 2ZR5A 2G41A 4ODPA 3QOKA 3WD3A 3EY6A 1FKGA 2PPOA 4KQZA 2KR7A 3O5FA 2A3BA 3RMEA 5JH8A 3O5DA 1HKMA 2ZQSA 4Z2HA 3KAIA 3AROA 3PRDA 1FKKA 1EHNA 3IKGA 3WIJA 4DWSA 2LKNA 1ZL1A 2O9OA 1C9HA 3ARSA 4QT2A 5DO2A 5DEZA 1M5YA 1ZCNA 4S3JA 3UQIA 2VN1A 4JFMA 5HW6A 3G6MA 1RD6A 1FKHA 3WH0A 2RUCA 4NSBA 4IT6A 1E6ZA 1Q6UA 4N19A 2IF4A 4DRIA 1R9HA 1YATA 2DT2A 3PA7A 2XPAA 4R0XA 2N87A 1W26A 4TW7A 1E6RA 3NI6A 4DT4A 2M1IA 1NMVA 1EQ3A 4FAPA 2A3EA 3IK8A 4NZCA 5HWCA 2K8IA 2IUZA 3W4RA 1ZBVA 1WB0A 4JYSA 2XP7A 1J4HA 1FKRA 2ZQUA 4IQCA 3ARYA 1NSGA 3FY1A 4ODRA 4DRKA 1OWQA 1XHGA 1FFQA 4W9PA 4C02B 4DWSB 5DF0A 2L2SA 4DROA 2PV1A 4DZ2A 1EIBA 1HJVA 2ITKA 2DT0A 2VCDA 1JNSA 2MLZA 2LGOA 3FAPA 2ZR4A 4IPXA 2DT3A 4WJXA 1BL4A 3UQAA 1FKFA 1HKJA 1KFWA 2FKEA 3KAFA 4U84A 3VAWA 4O2TA 4DZ3A 1EDQA 2RUDA 1FJDA 4DH0A 1UR9A 4MPKA 4IQ2A 4W9OA 4GGQA 4ODMA 1D6OA 2OFNA 1ROTA 1J6YA 3PRBA 4DRMA 3UQBA 2PV3A 3TCZA 3I6CA 1PINA 3O5LA 1ROUA 1FKSA 1NMWA 1SYTA 2XP4A 3CHDA 4WKHA 1ZU8A 5HT1A 1W1YA 1JNEA 2KE0A 2A3CA 1D7IA 1LL4A 4DWSC 4Z2LA 1FKBA 3AS2A 4DRQA 1W1PA 2F4EA 4URIA 4P8UA 4TYOA 2M08A 4KR0B 5B8IC 2DSVA 5HBFA 2MF9A 2DSZA 2UZ5A 1B6CA 4ITZA 4DRNA 3FXYA 3NRKA 2YBUA 2MLXA 2RUQA 1VF8A 4QT3A 3JYMA 1E9LA 3CH9A 1T11A 1H0GA 1Q6IA 4Z2IA 4TW6A 4MNKA 4FN2A 1TFVA 1K9TA 1F40A 3UF8A 2F2DA 4ODLA 4HBEA 4ODKA 1Q6HA 2JZVA 4P8VA 3UI6A 1FKJA 2MNTA 4P8XA 3UI5A 4Z2GA 4DRJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KAB A;  4W9P A;  5DIT A;  1FKL A;  3O5G A;  4C02 B;  4BF8 A;  2L2S A;  4GIV A;  4JFL A;  4DRO A;  2PV1 A;  4TW8 A;  5DIV A;  1Q1C A;  4DZ2 A;  4U85 A;  3ODK A;  5BXJ A;  3OOB A;  1U79 A;  4LAY A;  2ITK A;  3KAG A;  4ODQ A;  2KFW A;  2VCD A;  2ZR6 A;  4J4O A;  4MSP A;  4U86 A;  4DIP A;  1JNS A;  3GPK A;  3B7X A;  1JVW A;  2RQS A;  2MLZ A;  5HWB A;  4JFK A;  1L1P A;  2LGO A;  3FAP A;  3O5M A;  5J6E A;  1QZ2 A;  2ZR4 A;  2XP5 A;  4IPX A;  1EYM A;  5HTG A;  3IKD A;  1BL4 A;  3MDY B;  5I98 A;  3UQA A;  1FKF A;  3O5E A;  2FKE A;  1P5Q A;  1TCO C;  2LJ4 A;  2PBC A;  1ZK6 A;  1FAP A;  2MLY A;  3CGM A;  3KAF A;  5HKG A;  5HUA A;  4U84 A;  1J4I A;  2ZR5 A;  4O2T A;  3VAW A;  4DZ3 A;  4J4N A;  3TDB A;  4DRH A;  2RUD A;  4ODP A;  1FJD A;  4DH0 A;  2AWG A;  3O5Q A;  4IQ2 A;  4W9O A;  4G50 A;  3EY6 A;  5HW8 A;  1FKG A;  3LUO A;  5GPG A;  4GGQ A;  4ODM A;  2PPO A;  1F8A B;  1D6O A;  2OFN A;  1HXV A;  1ROT A;  4G2P A;  1YW5 A;  1J6Y A;  2KR7 A;  3O5F A;  3PRB A;  4DRM A;  1D7H A;  3KAD A;  2Y78 A;  3UQB A;  2DG9 A;  2XP3 A;  4TNS A;  3O5D A;  1QPL A;  2PV3 A;  4LAV A;  3TCZ A;  2ZQS A;  2KO7 A;  2XP6 A;  3I6C A;  1J4R A;  3KAI A;  3O5I A;  2XP9 A;  1D7J A;  1PIN A;  4NNR A;  3O5L A;  3PRD A;  1ROU A;  1FKK A;  1FKS A;  1NMW A;  3IKG A;  2XP8 A;  2XP4 A;  3O5P A;  5HW7 A;  5HT1 A;  4LAX A;  2LKN A;  5DIU A;  2KE0 A;  4W9Q A;  1C9H A;  4QT2 A;  1FKD A;  1M5Y A;  1QPF A;  1ZCN A;  1D7I A;  3KZ7 A;  3RFW A;  3UQI A;  2PPP A;  2VN1 A;  4JFM A;  5HW6 A;  3JXV A;  3RGC A;  2XPB A;  4DRP A;  1JNT A;  1FKH A;  1FKB A;  2DG4 A;  2RUC A;  3WH0 A;  3O5O A;  4MGV A;  4DRQ A;  2F21 A;  2RSE A;  3O5R A;  3CGN A;  2F4E A;  1Q6U A;  4N19 A;  2M2A A;  2IF4 A;  4TYO A;  4DRI A;  1N1A A;  1R9H A;  2PV2 A;  2M08 A;  1YAT A;  1BKF A;  1FKI A;  3JYJ A;  3PA7 A;  1FD9 A;  5B8I C;  2XPA A;  4R0X A;  2ZQV A;  2N87 A;  1W26 A;  4TW7 A;  2MF9 A;  1EQ3 A;  4QIB A;  2UZ5 A;  1B6C A;  3IHZ A;  4ITZ A;  3NI6 A;  4DRN A;  4DT4 A;  2M1I A;  2ZQT A;  1NMV A;  3NRK A;  4QT3 A;  2MLX A;  2PPN A;  2RUQ A;  3H9R B;  4TX0 A;  3IK8 A;  4FAP A;  3KCE A;  3JYM A;  3TC5 A;  5HWC A;  2RUR A;  2FAP A;  3KAH A;  2K8I A;  4ODO A;  2D9F A;  4JYS A;  2KGJ A;  2Q5A A;  2XP7 A;  1J4H A;  1T11 A;  1Q6I A;  1FKR A;  4JFJ A;  2ZQU A;  4TW6 A;  1FKT A;  4FN2 A;  4IQC A;  2KI3 A;  1F40 A;  1NSG A;  2MPH A;  3O5J A;  3UI4 A;  3KAC A;  3UF8 A;  2F2D A;  3O5K A;  4ODL A;  4ODK A;  4ODR A;  4DRK A;  1Q6H A;  1KT1 A;  2JZV A;  4LAW A;  1Y0O A;  3NTP A;  1KT0 A;  4JFI A;  2DG3 A;  4ODN A;  3UI6 A;  1A7X A;  1FKJ A;  2MNT A;  1PBK A;  5D75 A;  3UI5 A;  2LPV A;  4DRJ A; 
#chains in the Genus database with same CATH topology
 3KAB A;  3GU0 A;  3ARW A;  3PR9 A;  4BF8 A;  1H0I A;  1OGG A;  3ARP A;  5BXJ A;  2B31 A;  4LAY A;  3KAG A;  2KFW A;  2ZR6 A;  3GPK A;  2RQS A;  1OGB A;  4ZPT R;  1HKI A;  1E6P A;  3ARX A;  3MDY B;  1NWR A;  3ARQ A;  1X6L A;  2LJ4 A;  1ZK6 A;  2ETN A;  3AS1 A;  1IX5 A;  2AWG A;  4HAR A;  4L72 B;  5HW8 A;  5GPG A;  2QF8 A;  3WL1 A;  5GQB A;  4G2P A;  1D7H A;  2DG9 A;  1QPL A;  3OA5 A;  4LAV A;  2XP6 A;  1FFR A;  3AQU A;  3O5I A;  4NNR A;  1LJY A;  1NWU A;  3O5P A;  1LG2 A;  4LAX A;  5DIU A;  4W9Q A;  1QPF A;  1XRV A;  2DSW A;  2PPP A;  1LG1 A;  2DSU A;  2XPB A;  3RGC A;  4DRP A;  2DPE A;  2DG4 A;  2FDM A;  3O5O A;  4Z2K A;  3O5R A;  3CGN A;  4ML4 A;  4ZS6 A;  2ESC A;  4ZPW R;  1N1A A;  3WD0 A;  3WKZ A;  3CHC A;  3JYJ A;  1E6N A;  2ZQV A;  1ITX A;  1GPF A;  4TX0 A;  4L3N A;  2O92 A;  3TC5 A;  1WNO A;  2RUR A;  2FAP A;  3KAH A;  3ALG A;  2B5U B;  4WKA A;  3WD2 A;  1O6I A;  1SR0 A;  2KGJ A;  4WKF A;  1UR8 A;  4JFJ A;  1FKT A;  2PI6 A;  2KI3 A;  1HJW A;  3O5J A;  2EUL A;  2WM0 A;  3O5K A;  2OLH A;  1KT1 A;  1LQ0 A;  1Y0O A;  3NTP A;  4JFI A;  1A7X A;  1ZB5 A;  2Y78 A;  1PBK A;  1E15 A;  5D75 A;  2LPV A;  3WD4 A;  3ART A;  5DIT A;  4ZPV R;  4PTM A;  4MNL A;  4GIV A;  4JFL A;  1Q1C A;  4U85 A;  1U79 A;  4QZV B;  4ODQ A;  3BXW A;  4J4O A;  1W1V A;  4MSP A;  4DIP A;  3B9E A;  4LGX A;  3B8S A;  1JVW A;  2WLY A;  4XAK A;  3O5M A;  1QZ2 A;  2XP5 A;  5HTG A;  1GOI A;  3IKD A;  5I98 A;  4WIW A;  1TCO C;  2PBC A;  2MLY A;  4J4N A;  1W1T A;  3TDB A;  4DRH A;  4HBO A;  3AS3 A;  3ARZ A;  1ZBK A;  3O5Q A;  3CHF A;  4G50 A;  3LUO A;  1NWT A;  1WAW A;  1NWS A;  1F8A B;  1HXV A;  1ZBW A;  1NH6 A;  3ARV A;  3G6L A;  1YW5 A;  3ARU A;  3KAD A;  2XP3 A;  5GPR A;  1W9U A;  4TNS A;  2KO7 A;  4MTV A;  1J4R A;  2XP9 A;  1D7J A;  1X6N A;  5HW7 A;  2XP8 A;  2AOS A;  1W9P A;  1LL6 A;  2WK2 A;  3CHE A;  1FKD A;  1CTN A;  2P4V A;  3KZ7 A;  3RFW A;  1HKK A;  4Z2J A;  3JXV A;  1GUV A;  1JNT A;  3RM9 A;  4MNM A;  4MGV A;  3RM4 A;  2F21 A;  2RSE A;  2F23 A;  2M2A A;  4W5U A;  3AS0 A;  4WK9 A;  2PV2 A;  1BKF A;  1FKI A;  3ALF A;  3GTY X;  4AY1 A;  1FD9 A;  3PRA A;  4QIB A;  1ZBC A;  3IHZ A;  1E44 A;  3ARR A;  2ZQT A;  2PPN A;  3H9R B;  3KCE A;  1W9V A;  4IT4 A;  2G8Z A;  4ODO A;  4R5E A;  3RM8 A;  2D9F A;  2Q5A A;  4Q22 A;  1D2K A;  1HJX A;  4MAV A;  2MPH A;  3UI4 A;  3KAC A;  3WD1 A;  3B9D A;  2YBT A;  4Q7N A;  4LAW A;  1JND A;  1KT0 A;  4DWS D;  2DG3 A;  2WLZ A;  4ODN A;  3WL0 A;  1FKL A;  3O5G A;  3B9A A;  4P8W A;  4TW8 A;  5DIV A;  3ODK A;  2A3A A;  3OOB A;  2DT1 A;  4S3K A;  4U86 A;  3WQV A;  3B7X A;  5HWB A;  4JFK A;  1L1P A;  5J6E A;  3CZ8 A;  1EYM A;  1LL7 A;  3O5E A;  4MNJ A;  1P5Q A;  5HUA A;  3WQW A;  1FAP A;  3CGM A;  5HKG A;  1J4I A;  2ZR5 A;  2G41 A;  4ODP A;  3QOK A;  3WD3 A;  3EY6 A;  1FKG A;  2PPO A;  4KQZ A;  2KR7 A;  3O5F A;  2A3B A;  3RME A;  5JH8 A;  3O5D A;  1HKM A;  2ZQS A;  4Z2H A;  3KAI A;  3ARO A;  3PRD A;  1FKK A;  1EHN A;  3IKG A;  3WIJ A;  4DWS A;  2LKN A;  1ZL1 A;  2O9O A;  1C9H A;  3ARS A;  4QT2 A;  5DO2 A;  5DEZ A;  1M5Y A;  1ZCN A;  4S3J A;  3UQI A;  3BMB A;  2VN1 A;  4JFM A;  5HW6 A;  3G6M A;  1RD6 A;  1FKH A;  3WH0 A;  2RUC A;  3EIP A;  4IT6 A;  4NSB A;  1E6Z A;  1Q6U A;  4N19 A;  2IF4 A;  4DRI A;  1R9H A;  1YAT A;  2DT2 A;  3PA7 A;  2XPA A;  1JCH B;  4R0X A;  2N87 A;  1W26 A;  4TW7 A;  1E6R A;  3NI6 A;  4DT4 A;  2M1I A;  1NMV A;  1EQ3 A;  4FAP A;  2A3E A;  3IK8 A;  4NZC A;  5HWC A;  2K8I A;  2IUZ A;  3W4R A;  1ZBV A;  1WB0 A;  4JYS A;  2XP7 A;  1J4H A;  1FKR A;  2ZQU A;  4IQC A;  3ARY A;  1NSG A;  3FY1 A;  4ODR A;  4DRK A;  1OWQ A;  1XHG A;  1FFQ A;  4W9P A;  4C02 B;  4DWS B;  5DF0 A;  2L2S A;  4DRO A;  2PV1 A;  4DZ2 A;  1EIB A;  1HJV A;  2ITK A;  2DT0 A;  2VCD A;  1JNS A;  2MLZ A;  2LGO A;  3FAP A;  2ZR4 A;  4IPX A;  2DT3 A;  4WJX A;  1BL4 A;  3UQA A;  1FKF A;  1HKJ A;  1KFW A;  2FKE A;  4UDM A;  3KAF A;  4U84 A;  3VAW A;  4O2T A;  4DZ3 A;  1EDQ A;  2RUD A;  1FJD A;  4DH0 A;  1UR9 A;  4MPK A;  4IQ2 A;  4W9O A;  4GGQ A;  4ODM A;  1D6O A;  2OFN A;  1ROT A;  1J6Y A;  3PRB A;  4DRM A;  3UQB A;  2PV3 A;  3TCZ A;  3I6C A;  1PIN A;  3O5L A;  1ROU A;  1FKS A;  1NMW A;  1SYT A;  2XP4 A;  3CHD A;  4WKH A;  1ZU8 A;  5HT1 A;  1W1Y A;  1JNE A;  2KE0 A;  2PN0 A;  2A3C A;  1D7I A;  1LL4 A;  4DWS C;  4Z2L A;  1FKB A;  3AS2 A;  4DRQ A;  1W1P A;  2F4E A;  4URI A;  4P8U A;  4TYO A;  2M08 A;  4KR0 B;  5B8I C;  2DSV A;  5HBF A;  2MF9 A;  2DSZ A;  2UZ5 A;  1B6C A;  4ITZ A;  4DRN A;  3FXY A;  3NRK A;  2YBU A;  2MLX A;  2RUQ A;  1VF8 A;  4QT3 A;  3JYM A;  1E9L A;  3CH9 A;  1T11 A;  1H0G A;  1Q6I A;  4Z2I A;  4TW6 A;  4MNK A;  1GRJ A;  4FN2 A;  1TFV A;  1K9T A;  1F40 A;  3UF8 A;  2F2D A;  4ODL A;  4HBE A;  4ODK A;  1Q6H A;  2JZV A;  4P8V A;  3UI6 A;  1FKJ A;  2MNT A;  4P8X A;  3UI5 A;  4Z2G A;  4DRJ A; 
#chains in the Genus database with same CATH homology
 3KAB A;  3ARW A;  3PR9 A;  4BF8 A;  1H0I A;  1OGG A;  3ARP A;  5BXJ A;  2B31 A;  4LAY A;  3KAG A;  2KFW A;  2ZR6 A;  3GPK A;  2RQS A;  1OGB A;  4ZPT R;  1HKI A;  1E6P A;  3ARX A;  3MDY B;  1NWR A;  3ARQ A;  1X6L A;  2LJ4 A;  1ZK6 A;  3AS1 A;  1IX5 A;  2AWG A;  4HAR A;  4L72 B;  5HW8 A;  5GPG A;  2QF8 A;  3WL1 A;  5GQB A;  4G2P A;  1D7H A;  2DG9 A;  1QPL A;  3OA5 A;  4LAV A;  2XP6 A;  1FFR A;  3AQU A;  3O5I A;  4NNR A;  1LJY A;  1NWU A;  3O5P A;  1LG2 A;  4LAX A;  5DIU A;  4W9Q A;  1QPF A;  1XRV A;  2DSW A;  2PPP A;  1LG1 A;  2DSU A;  2XPB A;  3RGC A;  4DRP A;  2DPE A;  2DG4 A;  2FDM A;  3O5O A;  4Z2K A;  3O5R A;  3CGN A;  4ML4 A;  4ZS6 A;  2ESC A;  4ZPW R;  1N1A A;  3WD0 A;  3WKZ A;  3CHC A;  3JYJ A;  1E6N A;  2ZQV A;  1ITX A;  1GPF A;  4TX0 A;  4L3N A;  2O92 A;  3TC5 A;  1WNO A;  2RUR A;  2FAP A;  3KAH A;  3ALG A;  4WKA A;  3WD2 A;  1O6I A;  1SR0 A;  2KGJ A;  4WKF A;  1UR8 A;  4JFJ A;  1FKT A;  2PI6 A;  2KI3 A;  1HJW A;  3O5J A;  2WM0 A;  3O5K A;  2OLH A;  1KT1 A;  1LQ0 A;  1Y0O A;  3NTP A;  4JFI A;  1A7X A;  1ZB5 A;  2Y78 A;  1PBK A;  1E15 A;  5D75 A;  2LPV A;  3WD4 A;  3ART A;  5DIT A;  4ZPV R;  4PTM A;  4MNL A;  4GIV A;  4JFL A;  1Q1C A;  4U85 A;  1U79 A;  4QZV B;  4ODQ A;  3BXW A;  4J4O A;  1W1V A;  4MSP A;  4DIP A;  3B9E A;  4LGX A;  3B8S A;  1JVW A;  2WLY A;  4XAK A;  3O5M A;  1QZ2 A;  2XP5 A;  5HTG A;  1GOI A;  3IKD A;  5I98 A;  4WIW A;  1TCO C;  2PBC A;  2MLY A;  4J4N A;  1W1T A;  3TDB A;  4DRH A;  4HBO A;  3AS3 A;  3ARZ A;  1ZBK A;  3O5Q A;  3CHF A;  4G50 A;  3LUO A;  1NWT A;  1WAW A;  1NWS A;  1F8A B;  1HXV A;  1ZBW A;  1NH6 A;  3ARV A;  3G6L A;  1YW5 A;  3ARU A;  3KAD A;  2XP3 A;  5GPR A;  1W9U A;  4TNS A;  2KO7 A;  4MTV A;  1J4R A;  2XP9 A;  1D7J A;  1X6N A;  5HW7 A;  2XP8 A;  2AOS A;  1W9P A;  1LL6 A;  2WK2 A;  3CHE A;  1FKD A;  1CTN A;  3KZ7 A;  3RFW A;  1HKK A;  4Z2J A;  3JXV A;  1GUV A;  1JNT A;  3RM9 A;  4MNM A;  4MGV A;  3RM4 A;  2F21 A;  2RSE A;  2M2A A;  4W5U A;  3AS0 A;  4WK9 A;  2PV2 A;  1BKF A;  1FKI A;  3ALF A;  4AY1 A;  1FD9 A;  3PRA A;  4QIB A;  1ZBC A;  3IHZ A;  3ARR A;  2ZQT A;  2PPN A;  3H9R B;  3KCE A;  1W9V A;  4IT4 A;  2G8Z A;  4ODO A;  4R5E A;  3RM8 A;  2D9F A;  2Q5A A;  4Q22 A;  1D2K A;  1HJX A;  4MAV A;  2MPH A;  3UI4 A;  3KAC A;  3WD1 A;  3B9D A;  2YBT A;  4Q7N A;  4LAW A;  1JND A;  1KT0 A;  4DWS D;  2DG3 A;  2WLZ A;  4ODN A;  3WL0 A;  1FKL A;  3O5G A;  3B9A A;  4P8W A;  4TW8 A;  5DIV A;  3ODK A;  2A3A A;  3OOB A;  2DT1 A;  4S3K A;  4U86 A;  3WQV A;  3B7X A;  5HWB A;  4JFK A;  1L1P A;  5J6E A;  3CZ8 A;  1EYM A;  1LL7 A;  3O5E A;  4MNJ A;  1P5Q A;  5HUA A;  3WQW A;  1FAP A;  3CGM A;  5HKG A;  1J4I A;  2ZR5 A;  2G41 A;  4ODP A;  3QOK A;  3WD3 A;  3EY6 A;  1FKG A;  2PPO A;  4KQZ A;  2KR7 A;  3O5F A;  2A3B A;  3RME A;  5JH8 A;  3O5D A;  1HKM A;  2ZQS A;  4Z2H A;  3KAI A;  3ARO A;  3PRD A;  1FKK A;  1EHN A;  3IKG A;  3WIJ A;  4DWS A;  2LKN A;  1ZL1 A;  2O9O A;  1C9H A;  3ARS A;  4QT2 A;  5DO2 A;  5DEZ A;  1M5Y A;  1ZCN A;  4S3J A;  3UQI A;  2VN1 A;  4JFM A;  5HW6 A;  3G6M A;  1RD6 A;  1FKH A;  3WH0 A;  2RUC A;  4NSB A;  4IT6 A;  1E6Z A;  1Q6U A;  4N19 A;  2IF4 A;  4DRI A;  1R9H A;  1YAT A;  2DT2 A;  3PA7 A;  2XPA A;  4R0X A;  2N87 A;  1W26 A;  4TW7 A;  1E6R A;  3NI6 A;  4DT4 A;  2M1I A;  1NMV A;  1EQ3 A;  4FAP A;  2A3E A;  3IK8 A;  4NZC A;  5HWC A;  2K8I A;  2IUZ A;  3W4R A;  1ZBV A;  1WB0 A;  4JYS A;  2XP7 A;  1J4H A;  1FKR A;  2ZQU A;  4IQC A;  3ARY A;  1NSG A;  3FY1 A;  4ODR A;  4DRK A;  1OWQ A;  1XHG A;  1FFQ A;  4W9P A;  4C02 B;  4DWS B;  5DF0 A;  2L2S A;  4DRO A;  2PV1 A;  4DZ2 A;  1EIB A;  1HJV A;  2ITK A;  2DT0 A;  2VCD A;  1JNS A;  2MLZ A;  2LGO A;  3FAP A;  2ZR4 A;  4IPX A;  2DT3 A;  4WJX A;  1BL4 A;  3UQA A;  1FKF A;  1HKJ A;  1KFW A;  2FKE A;  3KAF A;  4U84 A;  3VAW A;  4O2T A;  4DZ3 A;  1EDQ A;  2RUD A;  1FJD A;  4DH0 A;  1UR9 A;  4MPK A;  4IQ2 A;  4W9O A;  4GGQ A;  4ODM A;  1D6O A;  2OFN A;  1ROT A;  1J6Y A;  3PRB A;  4DRM A;  3UQB A;  2PV3 A;  3TCZ A;  3I6C A;  1PIN A;  3O5L A;  1ROU A;  1FKS A;  1NMW A;  1SYT A;  2XP4 A;  3CHD A;  4WKH A;  1ZU8 A;  5HT1 A;  1W1Y A;  1JNE A;  2KE0 A;  2A3C A;  1D7I A;  1LL4 A;  4DWS C;  4Z2L A;  1FKB A;  3AS2 A;  4DRQ A;  1W1P A;  2F4E A;  4URI A;  4P8U A;  4TYO A;  2M08 A;  4KR0 B;  5B8I C;  2DSV A;  5HBF A;  2MF9 A;  2DSZ A;  2UZ5 A;  1B6C A;  4ITZ A;  4DRN A;  3FXY A;  3NRK A;  2YBU A;  2MLX A;  2RUQ A;  1VF8 A;  4QT3 A;  3JYM A;  1E9L A;  3CH9 A;  1T11 A;  1H0G A;  1Q6I A;  4Z2I A;  4TW6 A;  4MNK A;  4FN2 A;  1TFV A;  1K9T A;  1F40 A;  3UF8 A;  2F2D A;  4ODL A;  4HBE A;  4ODK A;  1Q6H A;  2JZV A;  4P8V A;  3UI6 A;  1FKJ A;  2MNT A;  4P8X A;  3UI5 A;  4Z2G A;  4DRJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...