1HXVA

Ppiase domain of the mycoplasma genitalium trigger factor
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
85
structure length
85
Chain Sequence
KLANGDIAIIDFTGIVDNKKLASASAQNYELTIGSNSFIKGFETGLIAMKVNQKKTLALTFPSDYHVKELQSKPVTFEVVLKAIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR solution structure and dynamics of the peptidyl-prolyl cis-trans isomerase domain of the trigger factor from Mycoplasma genitalium compared to FK506-binding protein.
pubmed doi rcsb
source organism Mycoplasma genitalium
molecule tags Chaperone
molecule keywords TRIGGER FACTOR
total genus 8
structure length 85
sequence length 85
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2001-01-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1hxvA00
5HWBA 4W9QA 3KABA 1NSGA 5HKGA 4DZ2A 5HW6A 1Q6HA 2MLZA 3IKDA 1Q6IA 2LJ4A 3JYJA 3H9RB 1QZ2A 4U84A 1A7XA 3O5EA 4NNRA 4DRQA 2FKEA 3UI5A 1PBKA 1FKLA 4R0XA 3I6CA 1EYMA 3O5GA 1EQ3A 3UF8A 5I98A 3KZ7A 4QT3A 1NMWA 4JFLA 1FKHA 2PPNA 2PV1A 4C02B 5DITA 2PPPA 2L2SA 5HW8A 2JZVA 5B8IC 1Q1CA 1ZCNA 2XP8A 3IKGA 1JNSA 2MLXA 2MNTA 2AWGA 2DG9A 1PINA 1C9HA 4DRIA 5D75A 3O5LA 2VCDA 2KFWA 3KADA 1Q6UA 4LAWA 1FKSA 1P5QA 2M08A 3MDYB 4DRKA 1FJDA 1U79A 2KE0A 1M5YA 2Q5AA 3JYMA 3NTPA 4BF8A 2OFNA 4JFIA 1HXVA 4N19A 4ODKA 1FKGA 1R9HA 1J4RA 1Y0OA 2XPAA 4ITZA 2XP3A 4JYSA 3RGCA 3WH0A 2KI3A 4GIVA 2LGOA 2K8IA 2KO7A 2N87A 3TDBA 3UI6A 3KCEA 2KGJA 1D7IA 4J4OA 3TC5A 4DRPA 4FN2A 3O5QA 4LAXA 4DRNA 2D9FA 2IF4A 5HWCA 5HUAA 1T11A 3VAWA 1ROUA 1TCOC 1FKBA 4J4NA 1J4HA 3ODKA 1FKRA 3UQBA 2M1IA 4ODNA 2RURA 2UZ5A 4DIPA 4DH0A 1FKIA 5HW7A 3O5OA 2MF9A 1FAPA 2PV3A 2MPHA 2ZR4A 2XP9A 3KACA 5BXJA 3FAPA 3O5MA 4DRHA 1J6YA 1D6OA 2LPVA 1QPFA 2RQSA 3KAGA 4MSPA 1YATA 4TX0A 2XP7A 1W26A 2MLYA 2XPBA 4LAVA 5DIVA 2M2AA 3IK8A 1KT0A 1BKFA 5J6EA 4TW7A 2RSEA 2RUQA 2XP4A 3KAHA 2PV2A 5GPGA 3LUOA 3RFWA 3UQAA 4ODPA 2RUCA 4JFJA 3PRDA 1FKDA 2ZQTA 1B6CA 2PBCA 2DG4A 4G50A 1ZK6A 2ITKA 1BL4A 3CGNA 4IPXA 2XP5A 4JFMA 3O5PA 4ODRA 4TW8A 4ODQA 3GPKA 3KAIA 4W9PA 2PPOA 2VN1A 1FKJA 4IQ2A 2KR7A 4W9OA 4U86A 1J4IA 3JXVA 3UI4A 1KT1A 4ODOA 3NRKA 3O5RA 1L1PA 2Y78A 5HTGA 2F2DA 1NMVA 3O5JA 1D7JA 2DG3A 3O5FA 3TCZA 4FAPA 4JFKA 5HT1A 4TNSA 1FD9A 2ZQSA 2F21A 4QT2A 1F8AB 3O5DA 4DRMA 4ODLA 4O2TA 2ZQUA 4DRJA 2XP6A 1D7HA 1FKFA 3NI6A 1FKTA 2FAPA 3O5IA 4GGQA 3IHZA 3UQIA 4LAYA 2LKNA 3PA7A 4G2PA 1FKKA 3OOBA 4U85A 3CGMA 2ZR5A 3PRBA 2RUDA 3KAFA 4MGVA 4ODMA 1ROTA 1YW5A 1JVWA 1N1AA 4TYOA 5DIUA 1QPLA 4IQCA 3O5KA 2ZR6A 2ZQVA 3EY6A 4DROA 4DT4A 4DZ3A 1JNTA 4TW6A 2F4EA 4QIBA 3B7XA 1F40A
chains in the Genus database with same CATH superfamily
2O9OA 4W9QA 4URIA 4Z2IA 5HKGA 4MPKA 2WLZA 3IKDA 1KFWA 3H9RB 3O5EA 4NNRA 2FKEA 3GTYX 1JNEA 1O6IA 4ZPVR 1NMWA 3ARUA 4Z2JA 2L2SA 2JZVA 2OLHA 1Q1CA 3IKGA 3EIPA 4Z2KA 3O5LA 3KADA 1Q6UA 4KQZA 3WD2A 4DRKA 4DWSC 3MDYB 3ARRA 1E6ZA 2OFNA 4JFIA 1HJWA 4ZPTR 2K8IA 3CHCA 3PRAA 4QZVB 3UI6A 4HBOA 4DRNA 2IF4A 1EIBA 1ROUA 1IX5A 4DIPA 2WK2A 1RD6A 4IT6A 2ESCA 2PV3A 1LG1A 3FAPA 1D6OA 1W26A 2MLYA 3WQVA 2A3AA 5DIVA 1KT0A 4TW7A 2RSEA 3ARWA 2RUQA 4KR0B 5GPGA 1LG2A 3PRDA 1B6CA 2DG4A 3WKZA 3W4RA 5DF0A 4W9PA 1FKJA 1ZL1A 2KR7A 1W9PA 3JXVA 3B9EA 5GQBA 3NRKA 3AS0A 1NMVA 3UQAA 3ARQA 1ZB5A 2P4VA 2ZQSA 4QT2A 1GOIA 4DRJA 3NI6A 2DT0A 2FAPA 3UQIA 4LAYA 2LKNA 1ITXA 1NWTA 3WD4A 4WKAA 4U85A 3CGMA 1CTNA 4MGVA 4ODMA 4P8WA 1ROTA 1JVWA 1QPLA 4MNMA 4DT4A 4DZ3A 3B7XA 1JNDA 4R0XA 3I6CA 1EYMA 3RM9A 3KZ7A 4Z2LA 2PV1A 2PPNA 4XAKA 4WK9A 3ARXA 2XP8A 3G6LA 2DG9A 1PINA 2A3CA 4DRIA 2VCDA 5GPRA 4DWSB 1FKSA 2PN0A 2KE0A 3JYMA 3B9AA 4BF8A 1HXVA 1FKGA 1Y0OA 1W1PA 2XPAA 3WH0A 1E6PA 4GIVA 2LGOA 3TDBA 2QF8A 3WL1A 1OGBA 1D7IA 3ARTA 3TC5A 4FN2A 3O5QA 5HWCA 5HUAA 2D9FA 4P8VA 1TCOC 1J4HA 3UQBA 2M1IA 2RURA 2UZ5A 3PR9A 3WD1A 2MF9A 1FAPA 1W1YA 2XP9A 5DEZA 1ZBCA 4UDMA 4DWSA 3KAGA 4MSPA 1YATA 1EHNA 4TX0A 2G41A 2O92A 2IUZA 3FY1A 4IT4A 2XP4A 2PV2A 1FKDA 1X6LA 2PBCA 1SYTA 1ZK6A 4JFMA 2XP5A 4TW8A 1LJYA 1FFRA 3GPKA 2VN1A 1KT1A 2Y78A 2G8ZA 3TCZA 4FAPA 1ZBVA 4TNSA 1FD9A 3WIJA 2F21A 3AROA 3O5DA 2PI6A 4DWSD 2XP6A 1D7HA 1FKFA 4MTVA 2YBTA 4LGXA 3RMEA 2DSZA 3PA7A 1FKKA 2ZR5A 1YW5A 4Z2HA 4IQCA 3EY6A 4L72B 1JNTA 1NWUA 1VF8A 4HARA 1F40A 5HWBA 3KABA 4HBEA 5HW6A 4DZ2A 3CHFA 1Q6HA 1Q6IA 2LJ4A 3JYJA 4ZS6A 4U84A 1UR8A 1A7XA 3UI5A 1NWRA 1FKLA 1EQ3A 4JFLA 4NZCA 1FKHA 1HKJA 5DITA 2PPPA 2WLYA 3B9DA 1ZCNA 4AY1A 1JNSA 2MLXA 1C9HA 2B31A 4S3JA 1HJVA 5D75A 4WIWA 4LAWA 3ARVA 3AQUA 2DSWA 1P5QA 1FJDA 2Q5AA 1M5YA 3ALFA 3CHDA 3NTPA 4N19A 1R9HA 1J4RA 4ITZA 4JYSA 2DT3A 2KO7A 3KCEA 4DRPA 2EULA 1FKRA 1E15A 4DH0A 1FKIA 3O5OA 5BXJA 3KACA 1J6YA 2LPVA 2A3EA 4R5EA 1QPFA 2RQSA 1W1VA 1JCHB 4LAVA 1WNOA 2AOSA 3RFWA 4JFJA 4G50A 3CGNA 2WM0A 4IPXA 3KAIA 2PPOA 4W9OA 3BMBA 4NSBA 4U86A 1J4IA 3UI4A 4ODOA 3O5RA 1L1PA 2F2DA 1D7JA 2DG3A 3O5FA 4PTMA 5HT1A 4Q22A 4MNJA 1XRVA 4O2TA 4Z2GA 3WD3A 1SR0A 3B8SA 1E6NA 1FKTA 1X6NA 2A3BA 4GGQA 1GRJA 1W9UA 3AS1A 4WKHA 4G2PA 1W1TA 4WJXA 3OOBA 2FDMA 3WQWA 1HKKA 1NWSA 3AS2A 3GU0A 1W9VA 4W5UA 2B5UB 3O5KA 3OA5A 2ZQVA 4TW6A 3RM4A 2F4EA 4MAVA 1HKMA 1EDQA 1WB0A 3ARSA 1NSGA 3RM8A 2MLZA 3FXYA 1QZ2A 1HJXA 4DRQA 1E44A 1PBKA 1LL6A 4MNKA 3O5GA 3UF8A 2DT2A 5I98A 4QT3A 4WKFA 4C02B 4S3KA 3AS3A 3BXWA 5HW8A 1GUVA 5B8IC 2DPEA 3ARYA 2YBUA 2F23A 1LQ0A 2MNTA 1E9LA 2AWGA 1HKIA 2KFWA 2M08A 1U79A 4ODKA 4DROA 2XP3A 3RGCA 2KI3A 3ARPA 2N87A 1H0GA 2KGJA 4J4OA 1XHGA 4LAXA 1T11A 1LL7A 1K9TA 4J4NA 1FKBA 3VAWA 3ODKA 4ODNA 3CH9A 5HW7A 1UR9A 2ZR4A 1OGGA 1E6RA 2MPHA 4P8XA 4DRHA 3O5MA 3CHEA 2XP7A 1D2KA 2XPBA 2M2AA 3IK8A 1BKFA 5J6EA 4ML4A 3KAHA 3CZ8A 3LUOA 4ODPA 2RUCA 2ZQTA 5DO2A 1WAWA 2ITKA 1BL4A 2DSUA 5HBFA 3O5PA 4ODRA 4ZPWR 4ODQA 4IQ2A 2DSVA 3WD0A 5JH8A 1GPFA 2DT1A 1OWQA 5HTGA 3O5JA 1ZBWA 4JFKA 4P8UA 1ZU8A 1FFQA 1F8AB 4DRMA 4ODLA 2ZQUA 1NH6A 3O5IA 3IHZA 3G6MA 3PRBA 2RUDA 3KAFA 1LL4A 1TFVA 1ZBKA 1N1AA 4TYOA 5DIUA 1H0IA 3QOKA 4MNLA 3ARZA 3WL0A 2ZR6A 4Q7NA 2ETNA 3ALGA 4QIBA 4L3NA
chains in the Genus database with same CATH topology
2O9OA 4W9QA 4URIA 4Z2IA 5HKGA 4MPKA 2WLZA 3IKDA 1KFWA 3H9RB 3O5EA 4NNRA 2FKEA 1JNEA 1O6IA 4ZPVR 1NMWA 3ARUA 4Z2JA 2L2SA 2JZVA 2OLHA 1Q1CA 3IKGA 4Z2KA 3O5LA 3KADA 1Q6UA 4KQZA 3WD2A 4DRKA 4DWSC 3MDYB 3ARRA 1E6ZA 2OFNA 4JFIA 1HJWA 4ZPTR 2K8IA 3CHCA 3PRAA 4QZVB 3UI6A 4HBOA 4DRNA 2IF4A 1EIBA 1ROUA 1IX5A 4DIPA 2WK2A 1RD6A 4IT6A 2ESCA 2PV3A 1LG1A 3FAPA 1D6OA 1W26A 2MLYA 3WQVA 2A3AA 5DIVA 1KT0A 4TW7A 2RSEA 3ARWA 2RUQA 4KR0B 5GPGA 1LG2A 3PRDA 1B6CA 2DG4A 3WKZA 3W4RA 5DF0A 4W9PA 1FKJA 1ZL1A 2KR7A 1W9PA 3JXVA 3B9EA 5GQBA 3NRKA 3AS0A 1NMVA 3UQAA 3ARQA 1ZB5A 2ZQSA 4QT2A 1GOIA 4DRJA 3NI6A 2DT0A 2FAPA 3UQIA 4LAYA 2LKNA 1ITXA 1NWTA 3WD4A 4WKAA 4U85A 3CGMA 1CTNA 4MGVA 4ODMA 4P8WA 1ROTA 1JVWA 1QPLA 4MNMA 4DT4A 4DZ3A 3B7XA 1JNDA 4R0XA 3I6CA 1EYMA 3RM9A 3KZ7A 4Z2LA 2PV1A 2PPNA 4XAKA 4WK9A 3ARXA 2XP8A 3G6LA 2DG9A 1PINA 2A3CA 4DRIA 2VCDA 5GPRA 4DWSB 1FKSA 2KE0A 3JYMA 3B9AA 4BF8A 1HXVA 1FKGA 1Y0OA 1W1PA 2XPAA 3WH0A 1E6PA 4GIVA 2LGOA 3TDBA 2QF8A 3WL1A 1OGBA 1D7IA 3ARTA 3TC5A 4FN2A 3O5QA 5HWCA 5HUAA 2D9FA 4P8VA 1TCOC 1J4HA 3UQBA 2M1IA 2RURA 2UZ5A 3PR9A 3WD1A 2MF9A 1FAPA 1W1YA 2XP9A 5DEZA 1ZBCA 4DWSA 3KAGA 4MSPA 1YATA 1EHNA 4TX0A 2G41A 2O92A 2IUZA 3FY1A 4IT4A 2XP4A 2PV2A 1FKDA 1X6LA 2PBCA 1SYTA 4JFMA 1ZK6A 2XP5A 4TW8A 1LJYA 1FFRA 3GPKA 2VN1A 1KT1A 2Y78A 2G8ZA 3TCZA 4FAPA 1ZBVA 4TNSA 1FD9A 3WIJA 2F21A 3AROA 3O5DA 2PI6A 4DWSD 2XP6A 1D7HA 1FKFA 4MTVA 2YBTA 4LGXA 3RMEA 2DSZA 3PA7A 1FKKA 2ZR5A 1YW5A 4Z2HA 4IQCA 3EY6A 4L72B 1JNTA 1NWUA 1VF8A 4HARA 1F40A 5HWBA 3KABA 4HBEA 5HW6A 4DZ2A 3CHFA 1Q6HA 1Q6IA 2LJ4A 3JYJA 4ZS6A 4U84A 1UR8A 1A7XA 3UI5A 1NWRA 1FKLA 1EQ3A 4JFLA 4NZCA 1FKHA 1HKJA 5DITA 2PPPA 2WLYA 3B9DA 1ZCNA 4AY1A 1JNSA 2MLXA 1C9HA 2B31A 4S3JA 1HJVA 5D75A 4WIWA 4LAWA 3ARVA 3AQUA 2DSWA 1P5QA 1FJDA 2Q5AA 1M5YA 3ALFA 3CHDA 3NTPA 4N19A 1R9HA 1J4RA 4ITZA 4JYSA 2DT3A 2KO7A 3KCEA 4DRPA 1FKRA 1E15A 4DH0A 1FKIA 3O5OA 5BXJA 3KACA 1J6YA 2LPVA 2A3EA 4R5EA 1QPFA 2RQSA 1W1VA 4LAVA 1WNOA 2AOSA 3RFWA 4JFJA 4G50A 3CGNA 2WM0A 4IPXA 3KAIA 2PPOA 4W9OA 4NSBA 4U86A 1J4IA 3UI4A 4ODOA 3O5RA 1L1PA 2F2DA 1D7JA 2DG3A 3O5FA 4PTMA 5HT1A 4Q22A 4MNJA 1XRVA 4O2TA 4Z2GA 3WD3A 1SR0A 3B8SA 1E6NA 1FKTA 1X6NA 2A3BA 4GGQA 1W9UA 3AS1A 4WKHA 4G2PA 1W1TA 4WJXA 3OOBA 2FDMA 3WQWA 1HKKA 1NWSA 3AS2A 1W9VA 4W5UA 3O5KA 3OA5A 2ZQVA 4TW6A 3RM4A 2F4EA 4MAVA 1HKMA 1EDQA 1WB0A 3ARSA 1NSGA 3RM8A 2MLZA 3FXYA 1QZ2A 1HJXA 4DRQA 1PBKA 1LL6A 4MNKA 3O5GA 3UF8A 2DT2A 5I98A 4QT3A 4WKFA 4C02B 4S3KA 3AS3A 3BXWA 5HW8A 1GUVA 5B8IC 2DPEA 3ARYA 2YBUA 1LQ0A 2MNTA 1E9LA 2AWGA 1HKIA 2KFWA 2M08A 1U79A 4ODKA 4DROA 2XP3A 3RGCA 2KI3A 3ARPA 2N87A 1H0GA 2KGJA 4J4OA 1XHGA 4LAXA 1T11A 1LL7A 1K9TA 4J4NA 1FKBA 3VAWA 3ODKA 4ODNA 3CH9A 5HW7A 1UR9A 2ZR4A 1OGGA 1E6RA 2MPHA 4P8XA 4DRHA 3O5MA 3CHEA 2XP7A 1D2KA 2XPBA 2M2AA 3IK8A 1BKFA 5J6EA 4ML4A 3KAHA 3CZ8A 3LUOA 4ODPA 2RUCA 2ZQTA 5DO2A 1WAWA 2ITKA 1BL4A 2DSUA 5HBFA 3O5PA 4ODRA 4ZPWR 4ODQA 4IQ2A 2DSVA 3WD0A 5JH8A 1GPFA 2DT1A 1OWQA 5HTGA 3O5JA 1ZBWA 4JFKA 4P8UA 1ZU8A 1FFQA 1F8AB 4DRMA 4ODLA 2ZQUA 1NH6A 3O5IA 3IHZA 3G6MA 3PRBA 2RUDA 3KAFA 1LL4A 1TFVA 1ZBKA 1N1AA 4TYOA 5DIUA 1H0IA 3QOKA 4MNLA 3ARZA 3WL0A 2ZR6A 4Q7NA 3ALGA 4QIBA 4L3NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HWB A;  4W9Q A;  3KAB A;  1NSG A;  5HKG A;  4DZ2 A;  5HW6 A;  1Q6H A;  2MLZ A;  3IKD A;  1Q6I A;  2LJ4 A;  3JYJ A;  3H9R B;  1QZ2 A;  4U84 A;  1A7X A;  3O5E A;  4NNR A;  4DRQ A;  2FKE A;  3UI5 A;  1PBK A;  1FKL A;  4R0X A;  3I6C A;  1EYM A;  3O5G A;  1EQ3 A;  3UF8 A;  5I98 A;  3KZ7 A;  4QT3 A;  1NMW A;  4JFL A;  1FKH A;  2PPN A;  2PV1 A;  4C02 B;  5DIT A;  2PPP A;  2L2S A;  5HW8 A;  2JZV A;  5B8I C;  1Q1C A;  1ZCN A;  2XP8 A;  3IKG A;  1JNS A;  2MLX A;  2MNT A;  2AWG A;  2DG9 A;  1PIN A;  1C9H A;  4DRI A;  5D75 A;  3O5L A;  2VCD A;  2KFW A;  3KAD A;  1Q6U A;  4LAW A;  1FKS A;  1P5Q A;  2M08 A;  3MDY B;  4DRK A;  1FJD A;  1U79 A;  2KE0 A;  1M5Y A;  2Q5A A;  3JYM A;  3NTP A;  4BF8 A;  2OFN A;  4JFI A;  1HXV A;  4N19 A;  4ODK A;  1FKG A;  1R9H A;  1J4R A;  1Y0O A;  2XPA A;  4ITZ A;  2XP3 A;  4JYS A;  3RGC A;  3WH0 A;  2KI3 A;  4GIV A;  2LGO A;  2K8I A;  2KO7 A;  2N87 A;  3TDB A;  3UI6 A;  3KCE A;  2KGJ A;  1D7I A;  4J4O A;  3TC5 A;  4DRP A;  4FN2 A;  3O5Q A;  4LAX A;  4DRN A;  2D9F A;  2IF4 A;  5HWC A;  5HUA A;  1T11 A;  3VAW A;  1ROU A;  1TCO C;  1FKB A;  4J4N A;  1J4H A;  3ODK A;  1FKR A;  3UQB A;  2M1I A;  4ODN A;  2RUR A;  2UZ5 A;  4DIP A;  4DH0 A;  1FKI A;  5HW7 A;  3O5O A;  2MF9 A;  1FAP A;  2PV3 A;  2MPH A;  2ZR4 A;  2XP9 A;  3KAC A;  5BXJ A;  3FAP A;  3O5M A;  4DRH A;  1J6Y A;  1D6O A;  2LPV A;  1QPF A;  2RQS A;  3KAG A;  4MSP A;  1YAT A;  4TX0 A;  2XP7 A;  1W26 A;  2MLY A;  2XPB A;  4LAV A;  5DIV A;  2M2A A;  3IK8 A;  1KT0 A;  1BKF A;  5J6E A;  4TW7 A;  2RSE A;  2RUQ A;  2XP4 A;  3KAH A;  2PV2 A;  5GPG A;  3LUO A;  3RFW A;  3UQA A;  4ODP A;  2RUC A;  4JFJ A;  3PRD A;  1FKD A;  2ZQT A;  1B6C A;  2PBC A;  2DG4 A;  4G50 A;  1ZK6 A;  2ITK A;  1BL4 A;  3CGN A;  4IPX A;  2XP5 A;  4JFM A;  3O5P A;  4ODR A;  4TW8 A;  4ODQ A;  3GPK A;  3KAI A;  4W9P A;  2PPO A;  2VN1 A;  1FKJ A;  4IQ2 A;  2KR7 A;  4W9O A;  4U86 A;  1J4I A;  3JXV A;  3UI4 A;  1KT1 A;  4ODO A;  3NRK A;  3O5R A;  1L1P A;  2Y78 A;  5HTG A;  2F2D A;  1NMV A;  3O5J A;  1D7J A;  2DG3 A;  3O5F A;  3TCZ A;  4FAP A;  4JFK A;  5HT1 A;  4TNS A;  1FD9 A;  2ZQS A;  2F21 A;  4QT2 A;  1F8A B;  3O5D A;  4DRM A;  4ODL A;  4O2T A;  2ZQU A;  4DRJ A;  2XP6 A;  1D7H A;  1FKF A;  3NI6 A;  1FKT A;  2FAP A;  3O5I A;  4GGQ A;  3IHZ A;  3UQI A;  4LAY A;  2LKN A;  3PA7 A;  4G2P A;  1FKK A;  3OOB A;  4U85 A;  3CGM A;  2ZR5 A;  3PRB A;  2RUD A;  3KAF A;  4MGV A;  4ODM A;  1ROT A;  1YW5 A;  1JVW A;  1N1A A;  4TYO A;  5DIU A;  1QPL A;  4IQC A;  3O5K A;  2ZR6 A;  2ZQV A;  3EY6 A;  4DRO A;  4DT4 A;  4DZ3 A;  1JNT A;  4TW6 A;  2F4E A;  4QIB A;  3B7X A;  1F40 A; 
#chains in the Genus database with same CATH topology
 2O9O A;  4W9Q A;  4URI A;  4Z2I A;  5HKG A;  4MPK A;  2WLZ A;  3IKD A;  1KFW A;  3H9R B;  3O5E A;  4NNR A;  2FKE A;  3GTY X;  1JNE A;  1O6I A;  4ZPV R;  1NMW A;  3ARU A;  4Z2J A;  2L2S A;  2JZV A;  2OLH A;  1Q1C A;  3IKG A;  3EIP A;  4Z2K A;  3O5L A;  3KAD A;  1Q6U A;  4KQZ A;  3WD2 A;  4DRK A;  4DWS C;  3MDY B;  3ARR A;  1E6Z A;  2OFN A;  4JFI A;  1HJW A;  4ZPT R;  2K8I A;  3CHC A;  3PRA A;  4QZV B;  3UI6 A;  4HBO A;  4DRN A;  2IF4 A;  1EIB A;  1ROU A;  1IX5 A;  4DIP A;  2WK2 A;  1RD6 A;  4IT6 A;  2ESC A;  2PV3 A;  1LG1 A;  3FAP A;  1D6O A;  1W26 A;  2MLY A;  3WQV A;  2A3A A;  5DIV A;  1KT0 A;  4TW7 A;  2RSE A;  3ARW A;  2RUQ A;  4KR0 B;  5GPG A;  1LG2 A;  3PRD A;  1B6C A;  2DG4 A;  3WKZ A;  3W4R A;  5DF0 A;  4W9P A;  1FKJ A;  1ZL1 A;  2KR7 A;  1W9P A;  3JXV A;  3B9E A;  5GQB A;  3NRK A;  3AS0 A;  1NMV A;  3UQA A;  3ARQ A;  1ZB5 A;  2P4V A;  2ZQS A;  4QT2 A;  1GOI A;  4DRJ A;  3NI6 A;  2DT0 A;  2FAP A;  3UQI A;  4LAY A;  2LKN A;  1ITX A;  1NWT A;  3WD4 A;  4WKA A;  4U85 A;  3CGM A;  1CTN A;  4MGV A;  4ODM A;  4P8W A;  1ROT A;  1JVW A;  1QPL A;  4MNM A;  4DT4 A;  4DZ3 A;  3B7X A;  1JND A;  4R0X A;  3I6C A;  1EYM A;  3RM9 A;  3KZ7 A;  4Z2L A;  2PV1 A;  2PPN A;  4XAK A;  4WK9 A;  3ARX A;  2XP8 A;  3G6L A;  2DG9 A;  1PIN A;  2A3C A;  4DRI A;  2VCD A;  5GPR A;  4DWS B;  1FKS A;  2PN0 A;  2KE0 A;  3JYM A;  3B9A A;  4BF8 A;  1HXV A;  1FKG A;  1Y0O A;  1W1P A;  2XPA A;  3WH0 A;  1E6P A;  4GIV A;  2LGO A;  3TDB A;  2QF8 A;  3WL1 A;  1OGB A;  1D7I A;  3ART A;  3TC5 A;  4FN2 A;  3O5Q A;  5HWC A;  5HUA A;  2D9F A;  4P8V A;  1TCO C;  1J4H A;  3UQB A;  2M1I A;  2RUR A;  2UZ5 A;  3PR9 A;  3WD1 A;  2MF9 A;  1FAP A;  1W1Y A;  2XP9 A;  5DEZ A;  1ZBC A;  4UDM A;  4DWS A;  3KAG A;  4MSP A;  1YAT A;  1EHN A;  4TX0 A;  2G41 A;  2O92 A;  2IUZ A;  3FY1 A;  4IT4 A;  2XP4 A;  2PV2 A;  1FKD A;  1X6L A;  2PBC A;  1SYT A;  1ZK6 A;  4JFM A;  2XP5 A;  4TW8 A;  1LJY A;  1FFR A;  3GPK A;  2VN1 A;  1KT1 A;  2Y78 A;  2G8Z A;  3TCZ A;  4FAP A;  1ZBV A;  4TNS A;  1FD9 A;  3WIJ A;  2F21 A;  3ARO A;  3O5D A;  2PI6 A;  4DWS D;  2XP6 A;  1D7H A;  1FKF A;  4MTV A;  2YBT A;  4LGX A;  3RME A;  2DSZ A;  3PA7 A;  1FKK A;  2ZR5 A;  1YW5 A;  4Z2H A;  4IQC A;  3EY6 A;  4L72 B;  1JNT A;  1NWU A;  1VF8 A;  4HAR A;  1F40 A;  5HWB A;  3KAB A;  4HBE A;  5HW6 A;  4DZ2 A;  3CHF A;  1Q6H A;  1Q6I A;  2LJ4 A;  3JYJ A;  4ZS6 A;  4U84 A;  1UR8 A;  1A7X A;  3UI5 A;  1NWR A;  1FKL A;  1EQ3 A;  4JFL A;  4NZC A;  1FKH A;  1HKJ A;  5DIT A;  2PPP A;  2WLY A;  3B9D A;  1ZCN A;  4AY1 A;  1JNS A;  2MLX A;  1C9H A;  2B31 A;  4S3J A;  1HJV A;  5D75 A;  4WIW A;  4LAW A;  3ARV A;  3AQU A;  2DSW A;  1P5Q A;  1FJD A;  2Q5A A;  1M5Y A;  3ALF A;  3CHD A;  3NTP A;  4N19 A;  1R9H A;  1J4R A;  4ITZ A;  4JYS A;  2DT3 A;  2KO7 A;  3KCE A;  4DRP A;  2EUL A;  1FKR A;  1E15 A;  4DH0 A;  1FKI A;  3O5O A;  5BXJ A;  3KAC A;  1J6Y A;  2LPV A;  2A3E A;  4R5E A;  1QPF A;  2RQS A;  1W1V A;  1JCH B;  4LAV A;  1WNO A;  2AOS A;  3RFW A;  4JFJ A;  4G50 A;  3CGN A;  2WM0 A;  4IPX A;  3KAI A;  2PPO A;  4W9O A;  3BMB A;  4NSB A;  4U86 A;  1J4I A;  3UI4 A;  4ODO A;  3O5R A;  1L1P A;  2F2D A;  1D7J A;  2DG3 A;  3O5F A;  4PTM A;  5HT1 A;  4Q22 A;  4MNJ A;  1XRV A;  4O2T A;  4Z2G A;  3WD3 A;  1SR0 A;  3B8S A;  1E6N A;  1FKT A;  1X6N A;  2A3B A;  4GGQ A;  1GRJ A;  1W9U A;  3AS1 A;  4WKH A;  4G2P A;  1W1T A;  4WJX A;  3OOB A;  2FDM A;  3WQW A;  1HKK A;  1NWS A;  3AS2 A;  3GU0 A;  1W9V A;  4W5U A;  2B5U B;  3O5K A;  3OA5 A;  2ZQV A;  4TW6 A;  3RM4 A;  2F4E A;  4MAV A;  1HKM A;  1EDQ A;  1WB0 A;  3ARS A;  1NSG A;  3RM8 A;  2MLZ A;  3FXY A;  1QZ2 A;  1HJX A;  4DRQ A;  1E44 A;  1PBK A;  1LL6 A;  4MNK A;  3O5G A;  3UF8 A;  2DT2 A;  5I98 A;  4QT3 A;  4WKF A;  4C02 B;  4S3K A;  3AS3 A;  3BXW A;  5HW8 A;  1GUV A;  5B8I C;  2DPE A;  3ARY A;  2YBU A;  2F23 A;  1LQ0 A;  2MNT A;  1E9L A;  2AWG A;  1HKI A;  2KFW A;  2M08 A;  1U79 A;  4ODK A;  4DRO A;  2XP3 A;  3RGC A;  2KI3 A;  3ARP A;  2N87 A;  1H0G A;  2KGJ A;  4J4O A;  1XHG A;  4LAX A;  1T11 A;  1LL7 A;  1K9T A;  4J4N A;  1FKB A;  3VAW A;  3ODK A;  4ODN A;  3CH9 A;  5HW7 A;  1UR9 A;  2ZR4 A;  1OGG A;  1E6R A;  2MPH A;  4P8X A;  4DRH A;  3O5M A;  3CHE A;  2XP7 A;  1D2K A;  2XPB A;  2M2A A;  3IK8 A;  1BKF A;  5J6E A;  4ML4 A;  3KAH A;  3CZ8 A;  3LUO A;  4ODP A;  2RUC A;  2ZQT A;  5DO2 A;  1WAW A;  2ITK A;  1BL4 A;  2DSU A;  5HBF A;  3O5P A;  4ODR A;  4ZPW R;  4ODQ A;  4IQ2 A;  2DSV A;  3WD0 A;  5JH8 A;  1GPF A;  2DT1 A;  1OWQ A;  5HTG A;  3O5J A;  1ZBW A;  4JFK A;  4P8U A;  1ZU8 A;  1FFQ A;  1F8A B;  4DRM A;  4ODL A;  2ZQU A;  1NH6 A;  3O5I A;  3IHZ A;  3G6M A;  3PRB A;  2RUD A;  3KAF A;  1LL4 A;  1TFV A;  1ZBK A;  1N1A A;  4TYO A;  5DIU A;  1H0I A;  3QOK A;  4MNL A;  3ARZ A;  3WL0 A;  2ZR6 A;  4Q7N A;  2ETN A;  3ALG A;  4QIB A;  4L3N A; 
#chains in the Genus database with same CATH homology
 2O9O A;  4W9Q A;  4URI A;  4Z2I A;  5HKG A;  4MPK A;  2WLZ A;  3IKD A;  1KFW A;  3H9R B;  3O5E A;  4NNR A;  2FKE A;  1JNE A;  1O6I A;  4ZPV R;  1NMW A;  3ARU A;  4Z2J A;  2L2S A;  2JZV A;  2OLH A;  1Q1C A;  3IKG A;  4Z2K A;  3O5L A;  3KAD A;  1Q6U A;  4KQZ A;  3WD2 A;  4DRK A;  4DWS C;  3MDY B;  3ARR A;  1E6Z A;  2OFN A;  4JFI A;  1HJW A;  4ZPT R;  2K8I A;  3CHC A;  3PRA A;  4QZV B;  3UI6 A;  4HBO A;  4DRN A;  2IF4 A;  1EIB A;  1ROU A;  1IX5 A;  4DIP A;  2WK2 A;  1RD6 A;  4IT6 A;  2ESC A;  2PV3 A;  1LG1 A;  3FAP A;  1D6O A;  1W26 A;  2MLY A;  3WQV A;  2A3A A;  5DIV A;  1KT0 A;  4TW7 A;  2RSE A;  3ARW A;  2RUQ A;  4KR0 B;  5GPG A;  1LG2 A;  3PRD A;  1B6C A;  2DG4 A;  3WKZ A;  3W4R A;  5DF0 A;  4W9P A;  1FKJ A;  1ZL1 A;  2KR7 A;  1W9P A;  3JXV A;  3B9E A;  5GQB A;  3NRK A;  3AS0 A;  1NMV A;  3UQA A;  3ARQ A;  1ZB5 A;  2ZQS A;  4QT2 A;  1GOI A;  4DRJ A;  3NI6 A;  2DT0 A;  2FAP A;  3UQI A;  4LAY A;  2LKN A;  1ITX A;  1NWT A;  3WD4 A;  4WKA A;  4U85 A;  3CGM A;  1CTN A;  4MGV A;  4ODM A;  4P8W A;  1ROT A;  1JVW A;  1QPL A;  4MNM A;  4DT4 A;  4DZ3 A;  3B7X A;  1JND A;  4R0X A;  3I6C A;  1EYM A;  3RM9 A;  3KZ7 A;  4Z2L A;  2PV1 A;  2PPN A;  4XAK A;  4WK9 A;  3ARX A;  2XP8 A;  3G6L A;  2DG9 A;  1PIN A;  2A3C A;  4DRI A;  2VCD A;  5GPR A;  4DWS B;  1FKS A;  2KE0 A;  3JYM A;  3B9A A;  4BF8 A;  1HXV A;  1FKG A;  1Y0O A;  1W1P A;  2XPA A;  3WH0 A;  1E6P A;  4GIV A;  2LGO A;  3TDB A;  2QF8 A;  3WL1 A;  1OGB A;  1D7I A;  3ART A;  3TC5 A;  4FN2 A;  3O5Q A;  5HWC A;  5HUA A;  2D9F A;  4P8V A;  1TCO C;  1J4H A;  3UQB A;  2M1I A;  2RUR A;  2UZ5 A;  3PR9 A;  3WD1 A;  2MF9 A;  1FAP A;  1W1Y A;  2XP9 A;  5DEZ A;  1ZBC A;  4DWS A;  3KAG A;  4MSP A;  1YAT A;  1EHN A;  4TX0 A;  2G41 A;  2O92 A;  2IUZ A;  3FY1 A;  4IT4 A;  2XP4 A;  2PV2 A;  1FKD A;  1X6L A;  2PBC A;  1SYT A;  4JFM A;  1ZK6 A;  2XP5 A;  4TW8 A;  1LJY A;  1FFR A;  3GPK A;  2VN1 A;  1KT1 A;  2Y78 A;  2G8Z A;  3TCZ A;  4FAP A;  1ZBV A;  4TNS A;  1FD9 A;  3WIJ A;  2F21 A;  3ARO A;  3O5D A;  2PI6 A;  4DWS D;  2XP6 A;  1D7H A;  1FKF A;  4MTV A;  2YBT A;  4LGX A;  3RME A;  2DSZ A;  3PA7 A;  1FKK A;  2ZR5 A;  1YW5 A;  4Z2H A;  4IQC A;  3EY6 A;  4L72 B;  1JNT A;  1NWU A;  1VF8 A;  4HAR A;  1F40 A;  5HWB A;  3KAB A;  4HBE A;  5HW6 A;  4DZ2 A;  3CHF A;  1Q6H A;  1Q6I A;  2LJ4 A;  3JYJ A;  4ZS6 A;  4U84 A;  1UR8 A;  1A7X A;  3UI5 A;  1NWR A;  1FKL A;  1EQ3 A;  4JFL A;  4NZC A;  1FKH A;  1HKJ A;  5DIT A;  2PPP A;  2WLY A;  3B9D A;  1ZCN A;  4AY1 A;  1JNS A;  2MLX A;  1C9H A;  2B31 A;  4S3J A;  1HJV A;  5D75 A;  4WIW A;  4LAW A;  3ARV A;  3AQU A;  2DSW A;  1P5Q A;  1FJD A;  2Q5A A;  1M5Y A;  3ALF A;  3CHD A;  3NTP A;  4N19 A;  1R9H A;  1J4R A;  4ITZ A;  4JYS A;  2DT3 A;  2KO7 A;  3KCE A;  4DRP A;  1FKR A;  1E15 A;  4DH0 A;  1FKI A;  3O5O A;  5BXJ A;  3KAC A;  1J6Y A;  2LPV A;  2A3E A;  4R5E A;  1QPF A;  2RQS A;  1W1V A;  4LAV A;  1WNO A;  2AOS A;  3RFW A;  4JFJ A;  4G50 A;  3CGN A;  2WM0 A;  4IPX A;  3KAI A;  2PPO A;  4W9O A;  4NSB A;  4U86 A;  1J4I A;  3UI4 A;  4ODO A;  3O5R A;  1L1P A;  2F2D A;  1D7J A;  2DG3 A;  3O5F A;  4PTM A;  5HT1 A;  4Q22 A;  4MNJ A;  1XRV A;  4O2T A;  4Z2G A;  3WD3 A;  1SR0 A;  3B8S A;  1E6N A;  1FKT A;  1X6N A;  2A3B A;  4GGQ A;  1W9U A;  3AS1 A;  4WKH A;  4G2P A;  1W1T A;  4WJX A;  3OOB A;  2FDM A;  3WQW A;  1HKK A;  1NWS A;  3AS2 A;  1W9V A;  4W5U A;  3O5K A;  3OA5 A;  2ZQV A;  4TW6 A;  3RM4 A;  2F4E A;  4MAV A;  1HKM A;  1EDQ A;  1WB0 A;  3ARS A;  1NSG A;  3RM8 A;  2MLZ A;  3FXY A;  1QZ2 A;  1HJX A;  4DRQ A;  1PBK A;  1LL6 A;  4MNK A;  3O5G A;  3UF8 A;  2DT2 A;  5I98 A;  4QT3 A;  4WKF A;  4C02 B;  4S3K A;  3AS3 A;  3BXW A;  5HW8 A;  1GUV A;  5B8I C;  2DPE A;  3ARY A;  2YBU A;  1LQ0 A;  2MNT A;  1E9L A;  2AWG A;  1HKI A;  2KFW A;  2M08 A;  1U79 A;  4ODK A;  4DRO A;  2XP3 A;  3RGC A;  2KI3 A;  3ARP A;  2N87 A;  1H0G A;  2KGJ A;  4J4O A;  1XHG A;  4LAX A;  1T11 A;  1LL7 A;  1K9T A;  4J4N A;  1FKB A;  3VAW A;  3ODK A;  4ODN A;  3CH9 A;  5HW7 A;  1UR9 A;  2ZR4 A;  1OGG A;  1E6R A;  2MPH A;  4P8X A;  4DRH A;  3O5M A;  3CHE A;  2XP7 A;  1D2K A;  2XPB A;  2M2A A;  3IK8 A;  1BKF A;  5J6E A;  4ML4 A;  3KAH A;  3CZ8 A;  3LUO A;  4ODP A;  2RUC A;  2ZQT A;  5DO2 A;  1WAW A;  2ITK A;  1BL4 A;  2DSU A;  5HBF A;  3O5P A;  4ODR A;  4ZPW R;  4ODQ A;  4IQ2 A;  2DSV A;  3WD0 A;  5JH8 A;  1GPF A;  2DT1 A;  1OWQ A;  5HTG A;  3O5J A;  1ZBW A;  4JFK A;  4P8U A;  1ZU8 A;  1FFQ A;  1F8A B;  4DRM A;  4ODL A;  2ZQU A;  1NH6 A;  3O5I A;  3IHZ A;  3G6M A;  3PRB A;  2RUD A;  3KAF A;  1LL4 A;  1TFV A;  1ZBK A;  1N1A A;  4TYO A;  5DIU A;  1H0I A;  3QOK A;  4MNL A;  3ARZ A;  3WL0 A;  2ZR6 A;  4Q7N A;  3ALG A;  4QIB A;  4L3N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...