1HXVA

Ppiase domain of the mycoplasma genitalium trigger factor
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
85
structure length
85
Chain Sequence
KLANGDIAIIDFTGIVDNKKLASASAQNYELTIGSNSFIKGFETGLIAMKVNQKKTLALTFPSDYHVKELQSKPVTFEVVLKAIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRIGGER FACTOR
publication title NMR solution structure and dynamics of the peptidyl-prolyl cis-trans isomerase domain of the trigger factor from Mycoplasma genitalium compared to FK506-binding protein.
pubmed doi rcsb
source organism Mycoplasma genitalium
molecule tags Chaperone
total genus 8
structure length 85
sequence length 85
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2001-01-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1hxvA00
1W26A 4JFIA 2ZR6A 5DIVA 4DRHA 4ODPA 3KZ7A 3PA7A 4LAVA 1P5QA 3NI6A 5B8IC 4TX0A 4DRPA 2RURA 3H9RB 3PRDA 4TW8A 4DZ2A 4DH0A 4IQ2A 4R0XA 1TCOC 2XP8A 3O5LA 2MNTA 3ODKA 4GGQA 1C9HA 3UI6A 1FKSA 2KR7A 1ROTA 2RQSA 1NSGA 2XP5A 1FKTA 2F2DA 2KFWA 1A7XA 4O2TA 2KE0A 4MGVA 2ZR5A 3O5PA 4ODKA 2RUQA 2D9FA 1F40A 1FKKA 1FKFA 4ODQA 3TC5A 1YW5A 4TW7A 1HXVA 2PV1A 5HW6A 1J4RA 1Q6IA 3O5GA 4W9PA 1FKGA 2Y78A 3KAHA 4BF8A 2ZQUA 2ZQTA 3KACA 4JFLA 3IKDA 1FKDA 3KCEA 3OOBA 1PBKA 4NNRA 5BXJA 2XP6A 3CGMA 4J4NA 3UQIA 2DG9A 3JYMA 1L1PA 3RFWA 1Q1CA 1T11A 2ZQVA 3KAIA 4IQCA 4DRJA 1JVWA 2XP9A 4DRQA 5HKGA 1FKHA 5I98A 2LJ4A 4ODOA 5HW8A 2PPOA 2VCDA 2XPBA 2MPHA 2KI3A 1ROUA 1D7JA 2ITKA 2RSEA 3O5EA 3O5FA 2PPPA 1J6YA 4DROA 2LKNA 3KADA 4ITZA 3KABA 1D7IA 1FAPA 2Q5AA 2MLZA 4DT4A 3JYJA 3O5JA 1U79A 4J4OA 3UI5A 1FD9A 1PINA 1KT1A 1F8AB 1JNTA 2VN1A 3IKGA 5HT1A 2PBCA 2ZQSA 5HWCA 4JFJA 4JFKA 1KT0A 4W9QA 2MLXA 1ZCNA 2XPAA 1D6OA 1NMVA 1Q6UA 4U85A 3KAGA 3UQBA 1D7HA 1QPLA 2KGJA 2UZ5A 4LAYA 5DIUA 2DG4A 2K8IA 2MF9A 1FKLA 3NRKA 5GPGA 4QT2A 4DZ3A 1FKJA 2FKEA 3JXVA 3PRBA 2PV2A 1J4HA 4FN2A 5J6EA 2PPNA 2DG3A 3TDBA 3O5IA 2IF4A 2L2SA 3O5MA 2N87A 4GIVA 1N1AA 3CGNA 3EY6A 2XP7A 4QIBA 4DRIA 1QPFA 4DRMA 1BKFA 4TYOA 3B7XA 2KO7A 3IHZA 1FKIA 3GPKA 4ODMA 4U84A 5HW7A 1Q6HA 1B6CA 4LAXA 4IPXA 5HUAA 1ZK6A 3O5QA 4MSPA 2RUCA 3WH0A 5HWBA 4TNSA 1QZ2A 4U86A 2M08A 4DIPA 5HTGA 2RUDA 2F4EA 4JFMA 1M5YA 5DITA 3TCZA 5D75A 4DRNA 1EYMA 3O5KA 3I6CA 2FAPA 2MLYA 4FAPA 2XP4A 1R9HA 3O5OA 3MDYB 4JYSA 3UQAA 1Y0OA 1YATA 2LGOA 4N19A 3VAWA 1FJDA 4C02B 4ODRA 3UF8A 4LAWA 4G2PA 3UI4A 1JNSA 2OFNA 2ZR4A 2M1IA 4ODNA 1FKRA 4ODLA 2F21A 3RGCA 1BL4A 1NMWA 2JZVA 2PV3A 3O5RA 2LPVA 3FAPA 2AWGA 3O5DA 2XP3A 1EQ3A 3KAFA 4QT3A 2M2AA 4W9OA 3LUOA 1J4IA 4G50A 3NTPA 1FKBA 4DRKA 3IK8A 4TW6A
chains in the Genus database with same CATH superfamily
1HKIA 5DIVA 1IX5A 2WK2A 3KZ7A 3PA7A 4LAVA 1P5QA 3NI6A 2B31A 4TX0A 4DRPA 3H9RB 1LG1A 3PRDA 4TW8A 2EULA 1W1PA 1TCOC 4MNKA 1FKSA 2XP5A 1ZBCA 1H0IA 2F2DA 4O2TA 2KE0A 1WAWA 4MGVA 3B9AA 4ZPVR 2O9OA 2D9FA 1FKKA 3ARXA 4MAVA 4IT6A 1HXVA 2PV1A 4P8XA 4S3KA 2DPEA 4JFLA 3WQWA 1ZL1A 2DSWA 1X6LA 1ZB5A 2A3AA 1HJWA 3QOKA 3JYMA 3RFWA 1T11A 4KR0B 2XP9A 4L72B 2F23A 5I98A 4ODOA 2PPOA 1OWQA 1CTNA 3EIPA 1K9TA 3ARPA 1D7JA 3O5EA 1FFRA 4ITZA 4Z2JA 1KFWA 1KT1A 5HT1A 1F8AB 2VN1A 4MNLA 4W9QA 3CHFA 1ZCNA 2XPAA 2DT3A 1QPLA 2K8IA 2ESCA 1O6IA 4QT2A 3ARWA 3PRBA 1EIBA 5J6EA 3TDBA 1GUVA 1LJYA 3O5MA 3CGNA 4DRIA 1LL4A 4P8WA 3RM4A 1BKFA 1NH6A 1B6CA 1Q6HA 3FXYA 1ZK6A 3WL1A 4Z2HA 5HTGA 1NWSA 1JCHB 2M08A 4U86A 2B5UB 5DITA 3TCZA 1M5YA 1EDQA 5D75A 2PI6A 1TFVA 1EYMA 1LQ0A 1R9HA 2WLYA 3PRAA 3O5OA 3ARTA 3MDYB 3BXWA 3UI4A 1ZBVA 2ZR4A 4ODLA 3GU0A 2AOSA 2AWGA 1LL6A 3KAFA 4W5UA 4XAKA 4W9OA 3ARQA 3NTPA 3AS0A 3WKZA 1W26A 4JFIA 4DRHA 4DWSB 5B8IC 3ARUA 1GOIA 4DZ2A 1EHNA 4R0XA 1WNOA 1W1TA 2XP8A 1HJVA 4R5EA 2KR7A 1E6ZA 1XHGA 1OGGA 3O5PA 1D2KA 4ODKA 1F40A 1HKKA 2G8ZA 4HBOA 1FKGA 2Y78A 4Q22A 5DO2A 1JNEA 2ZQUA 4UDMA 2P4VA 3KCEA 1W9PA 1PBKA 2XP6A 4J4NA 4DWSD 2DG9A 3AQUA 4DWSC 2DT0A 1E9LA 1Q1CA 1SYTA 4IQCA 3AS3A 5HKGA 4ZS6A 2LJ4A 3ALFA 5HW8A 1W9UA 2MPHA 1JNDA 3CHEA 1ZBWA 3O5FA 4DROA 2LKNA 3CHCA 3KABA 2Q5AA 2MLZA 3JYJA 3O5JA 4J4OA 1FD9A 4WIWA 1PINA 2ZQSA 3W4RA 4JFJA 3CZ8A 2MLXA 5GPRA 1NMVA 3WL0A 2QF8A 2UZ5A 1HKMA 3ARSA 2O92A 1GRJA 4P8VA 1FKJA 2FKEA 2PN0A 2PV2A 1J4HA 3WD0A 2DG3A 4HBEA 3O5IA 2L2SA 3CH9A 4MNJA 2N87A 4GIVA 4QIBA 1W1VA 2DSUA 4TYOA 1FKIA 4MTVA 5HW7A 3CHDA 2DT1A 1UR8A 5HUAA 3O5QA 4MSPA 2DSVA 5HWBA 4KQZA 2RUDA 4JFMA 2A3EA 4DRNA 1RD6A 1FFQA 2MLYA 2XP4A 3UQAA 3ARYA 1YATA 4N19A 3VAWA 4ML4A 4ODRA 3UF8A 1JNSA 4G2PA 3G6LA 4ODNA 2A3BA 3ARVA 3FAPA 3RM9A 4QT3A 3RM8A 2A3CA 3LUOA 4NSBA 1FKBA 4DRKA 4LGXA 1X6NA 4MPKA 3WD4A 4DH0A 3ARZA 4IQ2A 4S3JA 3WQVA 3ODKA 4GGQA 1C9HA 3UI6A 2RQSA 3B9EA 1FKTA 1W9VA 2ZR5A 1FKFA 3TC5A 1YW5A 1OGBA 5HW6A 1Q6IA 3O5GA 4BF8A 4W9PA 2ZQTA 3KACA 4Z2KA 1FKDA 3OOBA 2ETNA 5BXJA 3B9DA 3UQIA 1L1PA 2ZQVA 3KAIA 4DRJA 4DRQA 2XPBA 2G41A 2KI3A 1ROUA 4WKFA 2PPPA 1J6YA 4URIA 3KADA 3ALGA 1ZU8A 1U79A 1HKJA 1JNTA 4JFKA 3RMEA 3WD2A 1HJXA 1Q6UA 1NWRA 3AS1A 3KAGA 5GQBA 2KGJA 4PTMA 3UQBA 2MF9A 2OLHA 4DZ3A 3JXVA 1SR0A 3G6MA 4FN2A 4MNMA 3WIJA 4DRMA 5HBFA 5JH8A 3B7XA 2KO7A 3IHZA 4U84A 5DF0A 4LAXA 4Z2GA 3WH0A 3B8SA 3PR9A 1E6PA 3O5KA 3I6CA 2FAPA 1LL7A 5DEZA 2FDMA 1Y0OA 1LG2A 4IT4A 4C02B 2OFNA 1W1YA 3RGCA 1BL4A 1NMWA 2JZVA 2LPVA 2XP3A 2IUZA 2M2AA 4Z2LA 4G50A 1WB0A 2ZR6A 4ODPA 2RURA 3O5LA 2MNTA 2WLZA 2YBTA 4WK9A 1ROTA 1NSGA 2WM0A 2KFWA 1A7XA 2RUQA 2DT2A 4ODQA 4ZPTR 4TW7A 1NWUA 1J4RA 2YBUA 3KAHA 4QZVB 3IKDA 1ZBKA 4NNRA 3CGMA 3BMBA 1JVWA 4WJXA 1E44A 1FKHA 4WKAA 4ZPWR 2VCDA 1UR9A 2ITKA 2RSEA 4NZCA 3AROA 1NWTA 4Q7NA 1D7IA 1FAPA 4DT4A 3UI5A 3IKGA 5HWCA 2PBCA 1KT0A 4WKHA 1D6OA 4U85A 1D7HA 4LAYA 5DIUA 2DG4A 3WD3A 1FKLA 1XRVA 3NRKA 5GPGA 3OA5A 1E6RA 4AY1A 2PPNA 2IF4A 1N1AA 3EY6A 2XP7A 3AS2A 1QPFA 2DSZA 3FY1A 3GPKA 4ODMA 3ARRA 1GPFA 4L3NA 4IPXA 1E6NA 1E15A 1ITXA 2RUCA 4TNSA 1QZ2A 4DIPA 2F4EA 4Z2IA 4FAPA 1VF8A 4P8UA 4JYSA 3GTYX 2LGOA 1FJDA 4LAWA 2M1IA 1FKRA 4HARA 1H0GA 2F21A 3WD1A 2PV3A 3O5RA 3O5DA 1EQ3A 1J4IA 4DWSA 3IK8A 4TW6A
chains in the Genus database with same CATH topology
1HKIA 5DIVA 1IX5A 2WK2A 3KZ7A 3PA7A 4LAVA 1P5QA 3NI6A 2B31A 4TX0A 4DRPA 3H9RB 1LG1A 3PRDA 4TW8A 1W1PA 1TCOC 4MNKA 1FKSA 2XP5A 1ZBCA 1H0IA 2F2DA 4O2TA 2KE0A 1WAWA 4MGVA 3B9AA 4ZPVR 2O9OA 2D9FA 1FKKA 3ARXA 4MAVA 4IT6A 1HXVA 2PV1A 4P8XA 4S3KA 2DPEA 4JFLA 3WQWA 1ZL1A 2DSWA 1X6LA 1ZB5A 2A3AA 1HJWA 3QOKA 3JYMA 3RFWA 1T11A 4KR0B 2XP9A 4L72B 5I98A 4ODOA 2PPOA 1OWQA 1CTNA 1K9TA 3ARPA 1D7JA 3O5EA 1FFRA 4ITZA 4Z2JA 1KFWA 1KT1A 5HT1A 1F8AB 2VN1A 4MNLA 4W9QA 3CHFA 1ZCNA 2XPAA 2DT3A 1QPLA 2K8IA 2ESCA 1O6IA 4QT2A 3ARWA 3PRBA 1EIBA 5J6EA 3TDBA 1GUVA 1LJYA 3O5MA 3CGNA 4DRIA 1LL4A 4P8WA 3RM4A 1BKFA 1NH6A 1B6CA 1Q6HA 3FXYA 1ZK6A 3WL1A 4Z2HA 5HTGA 1NWSA 4U86A 2M08A 5DITA 3TCZA 1M5YA 1EDQA 5D75A 2PI6A 1TFVA 1EYMA 1LQ0A 1R9HA 2WLYA 3PRAA 3O5OA 3ARTA 3MDYB 3BXWA 3UI4A 1ZBVA 2ZR4A 4ODLA 2AOSA 2AWGA 1LL6A 3KAFA 4W5UA 4XAKA 4W9OA 3ARQA 3NTPA 3AS0A 3WKZA 1W26A 4JFIA 4DRHA 4DWSB 5B8IC 3ARUA 1GOIA 4DZ2A 1EHNA 4R0XA 1WNOA 1W1TA 2XP8A 1HJVA 4R5EA 2KR7A 1E6ZA 1XHGA 1OGGA 3O5PA 1D2KA 4ODKA 1F40A 1HKKA 2G8ZA 4HBOA 1FKGA 2Y78A 4Q22A 5DO2A 1JNEA 2ZQUA 3KCEA 1W9PA 1PBKA 2XP6A 4J4NA 4DWSD 2DG9A 3AQUA 4DWSC 2DT0A 1E9LA 1Q1CA 1SYTA 4IQCA 3AS3A 5HKGA 4ZS6A 2LJ4A 3ALFA 5HW8A 1W9UA 2MPHA 1JNDA 3CHEA 1ZBWA 3O5FA 4DROA 2LKNA 3CHCA 3KABA 2Q5AA 2MLZA 3JYJA 3O5JA 4J4OA 1FD9A 4WIWA 1PINA 2ZQSA 3W4RA 4JFJA 3CZ8A 2MLXA 5GPRA 1NMVA 3WL0A 2QF8A 2UZ5A 1HKMA 3ARSA 2O92A 4P8VA 1FKJA 2FKEA 2PV2A 1J4HA 3WD0A 2DG3A 4HBEA 3O5IA 2L2SA 3CH9A 4MNJA 2N87A 4GIVA 4QIBA 1W1VA 2DSUA 4TYOA 1FKIA 4MTVA 5HW7A 3CHDA 2DT1A 1UR8A 5HUAA 3O5QA 4MSPA 2DSVA 5HWBA 4KQZA 2RUDA 4JFMA 2A3EA 4DRNA 1RD6A 1FFQA 2MLYA 2XP4A 3UQAA 3ARYA 1YATA 4N19A 3VAWA 4ML4A 4ODRA 3UF8A 1JNSA 4G2PA 3G6LA 4ODNA 2A3BA 3ARVA 3FAPA 3RM9A 4QT3A 3RM8A 2A3CA 3LUOA 4NSBA 1FKBA 4DRKA 4LGXA 1X6NA 4MPKA 3WD4A 4DH0A 3ARZA 4IQ2A 4S3JA 3WQVA 3ODKA 4GGQA 1C9HA 3UI6A 2RQSA 3B9EA 1FKTA 1W9VA 2ZR5A 1FKFA 3TC5A 1YW5A 1OGBA 5HW6A 1Q6IA 3O5GA 4BF8A 4W9PA 2ZQTA 3KACA 4Z2KA 1FKDA 3OOBA 5BXJA 3B9DA 3UQIA 1L1PA 2ZQVA 3KAIA 4DRJA 4DRQA 2XPBA 2G41A 2KI3A 1ROUA 4WKFA 2PPPA 1J6YA 4URIA 3KADA 3ALGA 1ZU8A 1U79A 1HKJA 1JNTA 4JFKA 3RMEA 3WD2A 1HJXA 1Q6UA 1NWRA 3AS1A 3KAGA 5GQBA 2KGJA 4PTMA 3UQBA 2MF9A 2OLHA 4DZ3A 3JXVA 1SR0A 3G6MA 4FN2A 4MNMA 3WIJA 4DRMA 5HBFA 5JH8A 3B7XA 2KO7A 3IHZA 4U84A 5DF0A 4LAXA 4Z2GA 3WH0A 3B8SA 3PR9A 1E6PA 3O5KA 3I6CA 2FAPA 1LL7A 5DEZA 2FDMA 1Y0OA 1LG2A 4IT4A 4C02B 2OFNA 1W1YA 3RGCA 1BL4A 1NMWA 2JZVA 2LPVA 2XP3A 2IUZA 2M2AA 4Z2LA 4G50A 1WB0A 2ZR6A 4ODPA 2RURA 3O5LA 2MNTA 2WLZA 2YBTA 4WK9A 1ROTA 1NSGA 2WM0A 2KFWA 1A7XA 2RUQA 2DT2A 4ODQA 4ZPTR 4TW7A 1NWUA 1J4RA 2YBUA 3KAHA 4QZVB 3IKDA 1ZBKA 4NNRA 3CGMA 1JVWA 4WJXA 1FKHA 4WKAA 4ZPWR 2VCDA 1UR9A 2ITKA 2RSEA 4NZCA 3AROA 1NWTA 4Q7NA 1D7IA 1FAPA 4DT4A 3UI5A 3IKGA 5HWCA 2PBCA 1KT0A 4WKHA 1D6OA 4U85A 1D7HA 4LAYA 5DIUA 2DG4A 3WD3A 1FKLA 1XRVA 3NRKA 5GPGA 3OA5A 1E6RA 4AY1A 2PPNA 2IF4A 1N1AA 3EY6A 2XP7A 3AS2A 1QPFA 2DSZA 3FY1A 3GPKA 4ODMA 3ARRA 1GPFA 4L3NA 4IPXA 1E6NA 1E15A 1ITXA 2RUCA 4TNSA 1QZ2A 4DIPA 2F4EA 4Z2IA 4FAPA 1VF8A 4P8UA 4JYSA 2LGOA 1FJDA 4LAWA 2M1IA 1FKRA 4HARA 1H0GA 2F21A 3WD1A 2PV3A 3O5RA 3O5DA 1EQ3A 1J4IA 4DWSA 3IK8A 4TW6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W26 A;  4JFI A;  2ZR6 A;  5DIV A;  4DRH A;  4ODP A;  3KZ7 A;  3PA7 A;  4LAV A;  1P5Q A;  3NI6 A;  5B8I C;  4TX0 A;  4DRP A;  2RUR A;  3H9R B;  3PRD A;  4TW8 A;  4DZ2 A;  4DH0 A;  4IQ2 A;  4R0X A;  1TCO C;  2XP8 A;  3O5L A;  2MNT A;  3ODK A;  4GGQ A;  1C9H A;  3UI6 A;  1FKS A;  2KR7 A;  1ROT A;  2RQS A;  1NSG A;  2XP5 A;  1FKT A;  2F2D A;  2KFW A;  1A7X A;  4O2T A;  2KE0 A;  4MGV A;  2ZR5 A;  3O5P A;  4ODK A;  2RUQ A;  2D9F A;  1F40 A;  1FKK A;  1FKF A;  4ODQ A;  3TC5 A;  1YW5 A;  4TW7 A;  1HXV A;  2PV1 A;  5HW6 A;  1J4R A;  1Q6I A;  3O5G A;  4W9P A;  1FKG A;  2Y78 A;  3KAH A;  4BF8 A;  2ZQU A;  2ZQT A;  3KAC A;  4JFL A;  3IKD A;  1FKD A;  3KCE A;  3OOB A;  1PBK A;  4NNR A;  5BXJ A;  2XP6 A;  3CGM A;  4J4N A;  3UQI A;  2DG9 A;  3JYM A;  1L1P A;  3RFW A;  1Q1C A;  1T11 A;  2ZQV A;  3KAI A;  4IQC A;  4DRJ A;  1JVW A;  2XP9 A;  4DRQ A;  5HKG A;  1FKH A;  5I98 A;  2LJ4 A;  4ODO A;  5HW8 A;  2PPO A;  2VCD A;  2XPB A;  2MPH A;  2KI3 A;  1ROU A;  1D7J A;  2ITK A;  2RSE A;  3O5E A;  3O5F A;  2PPP A;  1J6Y A;  4DRO A;  2LKN A;  3KAD A;  4ITZ A;  3KAB A;  1D7I A;  1FAP A;  2Q5A A;  2MLZ A;  4DT4 A;  3JYJ A;  3O5J A;  1U79 A;  4J4O A;  3UI5 A;  1FD9 A;  1PIN A;  1KT1 A;  1F8A B;  1JNT A;  2VN1 A;  3IKG A;  5HT1 A;  2PBC A;  2ZQS A;  5HWC A;  4JFJ A;  4JFK A;  1KT0 A;  4W9Q A;  2MLX A;  1ZCN A;  2XPA A;  1D6O A;  1NMV A;  1Q6U A;  4U85 A;  3KAG A;  3UQB A;  1D7H A;  1QPL A;  2KGJ A;  2UZ5 A;  4LAY A;  5DIU A;  2DG4 A;  2K8I A;  2MF9 A;  1FKL A;  3NRK A;  5GPG A;  4QT2 A;  4DZ3 A;  1FKJ A;  2FKE A;  3JXV A;  3PRB A;  2PV2 A;  1J4H A;  4FN2 A;  5J6E A;  2PPN A;  2DG3 A;  3TDB A;  3O5I A;  2IF4 A;  2L2S A;  3O5M A;  2N87 A;  4GIV A;  1N1A A;  3CGN A;  3EY6 A;  2XP7 A;  4QIB A;  4DRI A;  1QPF A;  4DRM A;  1BKF A;  4TYO A;  3B7X A;  2KO7 A;  3IHZ A;  1FKI A;  3GPK A;  4ODM A;  4U84 A;  5HW7 A;  1Q6H A;  1B6C A;  4LAX A;  4IPX A;  5HUA A;  1ZK6 A;  3O5Q A;  4MSP A;  2RUC A;  3WH0 A;  5HWB A;  4TNS A;  1QZ2 A;  4U86 A;  2M08 A;  4DIP A;  5HTG A;  2RUD A;  2F4E A;  4JFM A;  1M5Y A;  5DIT A;  3TCZ A;  5D75 A;  4DRN A;  1EYM A;  3O5K A;  3I6C A;  2FAP A;  2MLY A;  4FAP A;  2XP4 A;  1R9H A;  3O5O A;  3MDY B;  4JYS A;  3UQA A;  1Y0O A;  1YAT A;  2LGO A;  4N19 A;  3VAW A;  1FJD A;  4C02 B;  4ODR A;  3UF8 A;  4LAW A;  4G2P A;  3UI4 A;  1JNS A;  2OFN A;  2ZR4 A;  2M1I A;  4ODN A;  1FKR A;  4ODL A;  2F21 A;  3RGC A;  1BL4 A;  1NMW A;  2JZV A;  2PV3 A;  3O5R A;  2LPV A;  3FAP A;  2AWG A;  3O5D A;  2XP3 A;  1EQ3 A;  3KAF A;  4QT3 A;  2M2A A;  4W9O A;  3LUO A;  1J4I A;  4G50 A;  3NTP A;  1FKB A;  4DRK A;  3IK8 A;  4TW6 A; 
#chains in the Genus database with same CATH topology
 1HKI A;  5DIV A;  1IX5 A;  2WK2 A;  3KZ7 A;  3PA7 A;  4LAV A;  1P5Q A;  3NI6 A;  2B31 A;  4TX0 A;  4DRP A;  3H9R B;  1LG1 A;  3PRD A;  4TW8 A;  2EUL A;  1W1P A;  1TCO C;  4MNK A;  1FKS A;  2XP5 A;  1ZBC A;  1H0I A;  2F2D A;  4O2T A;  2KE0 A;  1WAW A;  4MGV A;  3B9A A;  4ZPV R;  2O9O A;  2D9F A;  1FKK A;  3ARX A;  4MAV A;  4IT6 A;  1HXV A;  2PV1 A;  4P8X A;  4S3K A;  2DPE A;  4JFL A;  3WQW A;  1ZL1 A;  2DSW A;  1X6L A;  1ZB5 A;  2A3A A;  1HJW A;  3QOK A;  3JYM A;  3RFW A;  1T11 A;  4KR0 B;  2XP9 A;  4L72 B;  2F23 A;  5I98 A;  4ODO A;  2PPO A;  1OWQ A;  1CTN A;  3EIP A;  1K9T A;  3ARP A;  1D7J A;  3O5E A;  1FFR A;  4ITZ A;  4Z2J A;  1KFW A;  1KT1 A;  5HT1 A;  1F8A B;  2VN1 A;  4MNL A;  4W9Q A;  3CHF A;  1ZCN A;  2XPA A;  2DT3 A;  1QPL A;  2K8I A;  2ESC A;  1O6I A;  4QT2 A;  3ARW A;  3PRB A;  1EIB A;  5J6E A;  3TDB A;  1GUV A;  1LJY A;  3O5M A;  3CGN A;  4DRI A;  1LL4 A;  4P8W A;  3RM4 A;  1BKF A;  1NH6 A;  1B6C A;  1Q6H A;  3FXY A;  1ZK6 A;  3WL1 A;  4Z2H A;  5HTG A;  1NWS A;  1JCH B;  2M08 A;  4U86 A;  2B5U B;  5DIT A;  3TCZ A;  1M5Y A;  1EDQ A;  5D75 A;  2PI6 A;  1TFV A;  1EYM A;  1LQ0 A;  1R9H A;  2WLY A;  3PRA A;  3O5O A;  3ART A;  3MDY B;  3BXW A;  3UI4 A;  1ZBV A;  2ZR4 A;  4ODL A;  3GU0 A;  2AOS A;  2AWG A;  1LL6 A;  3KAF A;  4W5U A;  4XAK A;  4W9O A;  3ARQ A;  3NTP A;  3AS0 A;  3WKZ A;  1W26 A;  4JFI A;  4DRH A;  4DWS B;  5B8I C;  3ARU A;  1GOI A;  4DZ2 A;  1EHN A;  4R0X A;  1WNO A;  1W1T A;  2XP8 A;  1HJV A;  4R5E A;  2KR7 A;  1E6Z A;  1XHG A;  1OGG A;  3O5P A;  1D2K A;  4ODK A;  1F40 A;  1HKK A;  2G8Z A;  4HBO A;  1FKG A;  2Y78 A;  4Q22 A;  5DO2 A;  1JNE A;  2ZQU A;  4UDM A;  2P4V A;  3KCE A;  1W9P A;  1PBK A;  2XP6 A;  4J4N A;  4DWS D;  2DG9 A;  3AQU A;  4DWS C;  2DT0 A;  1E9L A;  1Q1C A;  1SYT A;  4IQC A;  3AS3 A;  5HKG A;  4ZS6 A;  2LJ4 A;  3ALF A;  5HW8 A;  1W9U A;  2MPH A;  1JND A;  3CHE A;  1ZBW A;  3O5F A;  4DRO A;  2LKN A;  3CHC A;  3KAB A;  2Q5A A;  2MLZ A;  3JYJ A;  3O5J A;  4J4O A;  1FD9 A;  4WIW A;  1PIN A;  2ZQS A;  3W4R A;  4JFJ A;  3CZ8 A;  2MLX A;  5GPR A;  1NMV A;  3WL0 A;  2QF8 A;  2UZ5 A;  1HKM A;  3ARS A;  2O92 A;  1GRJ A;  4P8V A;  1FKJ A;  2FKE A;  2PN0 A;  2PV2 A;  1J4H A;  3WD0 A;  2DG3 A;  4HBE A;  3O5I A;  2L2S A;  3CH9 A;  4MNJ A;  2N87 A;  4GIV A;  4QIB A;  1W1V A;  2DSU A;  4TYO A;  1FKI A;  4MTV A;  5HW7 A;  3CHD A;  2DT1 A;  1UR8 A;  5HUA A;  3O5Q A;  4MSP A;  2DSV A;  5HWB A;  4KQZ A;  2RUD A;  4JFM A;  2A3E A;  4DRN A;  1RD6 A;  1FFQ A;  2MLY A;  2XP4 A;  3UQA A;  3ARY A;  1YAT A;  4N19 A;  3VAW A;  4ML4 A;  4ODR A;  3UF8 A;  1JNS A;  4G2P A;  3G6L A;  4ODN A;  2A3B A;  3ARV A;  3FAP A;  3RM9 A;  4QT3 A;  3RM8 A;  2A3C A;  3LUO A;  4NSB A;  1FKB A;  4DRK A;  4LGX A;  1X6N A;  4MPK A;  3WD4 A;  4DH0 A;  3ARZ A;  4IQ2 A;  4S3J A;  3WQV A;  3ODK A;  4GGQ A;  1C9H A;  3UI6 A;  2RQS A;  3B9E A;  1FKT A;  1W9V A;  2ZR5 A;  1FKF A;  3TC5 A;  1YW5 A;  1OGB A;  5HW6 A;  1Q6I A;  3O5G A;  4BF8 A;  4W9P A;  2ZQT A;  3KAC A;  4Z2K A;  1FKD A;  3OOB A;  2ETN A;  5BXJ A;  3B9D A;  3UQI A;  1L1P A;  2ZQV A;  3KAI A;  4DRJ A;  4DRQ A;  2XPB A;  2G41 A;  2KI3 A;  1ROU A;  4WKF A;  2PPP A;  1J6Y A;  4URI A;  3KAD A;  3ALG A;  1ZU8 A;  1U79 A;  1HKJ A;  1JNT A;  4JFK A;  3RME A;  3WD2 A;  1HJX A;  1Q6U A;  1NWR A;  3AS1 A;  3KAG A;  5GQB A;  2KGJ A;  4PTM A;  3UQB A;  2MF9 A;  2OLH A;  4DZ3 A;  3JXV A;  1SR0 A;  3G6M A;  4FN2 A;  4MNM A;  3WIJ A;  4DRM A;  5HBF A;  5JH8 A;  3B7X A;  2KO7 A;  3IHZ A;  4U84 A;  5DF0 A;  4LAX A;  4Z2G A;  3WH0 A;  3B8S A;  3PR9 A;  1E6P A;  3O5K A;  3I6C A;  2FAP A;  1LL7 A;  5DEZ A;  2FDM A;  1Y0O A;  1LG2 A;  4IT4 A;  4C02 B;  2OFN A;  1W1Y A;  3RGC A;  1BL4 A;  1NMW A;  2JZV A;  2LPV A;  2XP3 A;  2IUZ A;  2M2A A;  4Z2L A;  4G50 A;  1WB0 A;  2ZR6 A;  4ODP A;  2RUR A;  3O5L A;  2MNT A;  2WLZ A;  2YBT A;  4WK9 A;  1ROT A;  1NSG A;  2WM0 A;  2KFW A;  1A7X A;  2RUQ A;  2DT2 A;  4ODQ A;  4ZPT R;  4TW7 A;  1NWU A;  1J4R A;  2YBU A;  3KAH A;  4QZV B;  3IKD A;  1ZBK A;  4NNR A;  3CGM A;  3BMB A;  1JVW A;  4WJX A;  1E44 A;  1FKH A;  4WKA A;  4ZPW R;  2VCD A;  1UR9 A;  2ITK A;  2RSE A;  4NZC A;  3ARO A;  1NWT A;  4Q7N A;  1D7I A;  1FAP A;  4DT4 A;  3UI5 A;  3IKG A;  5HWC A;  2PBC A;  1KT0 A;  4WKH A;  1D6O A;  4U85 A;  1D7H A;  4LAY A;  5DIU A;  2DG4 A;  3WD3 A;  1FKL A;  1XRV A;  3NRK A;  5GPG A;  3OA5 A;  1E6R A;  4AY1 A;  2PPN A;  2IF4 A;  1N1A A;  3EY6 A;  2XP7 A;  3AS2 A;  1QPF A;  2DSZ A;  3FY1 A;  3GPK A;  4ODM A;  3ARR A;  1GPF A;  4L3N A;  4IPX A;  1E6N A;  1E15 A;  1ITX A;  2RUC A;  4TNS A;  1QZ2 A;  4DIP A;  2F4E A;  4Z2I A;  4FAP A;  1VF8 A;  4P8U A;  4JYS A;  3GTY X;  2LGO A;  1FJD A;  4LAW A;  2M1I A;  1FKR A;  4HAR A;  1H0G A;  2F21 A;  3WD1 A;  2PV3 A;  3O5R A;  3O5D A;  1EQ3 A;  1J4I A;  4DWS A;  3IK8 A;  4TW6 A; 
#chains in the Genus database with same CATH homology
 1HKI A;  5DIV A;  1IX5 A;  2WK2 A;  3KZ7 A;  3PA7 A;  4LAV A;  1P5Q A;  3NI6 A;  2B31 A;  4TX0 A;  4DRP A;  3H9R B;  1LG1 A;  3PRD A;  4TW8 A;  1W1P A;  1TCO C;  4MNK A;  1FKS A;  2XP5 A;  1ZBC A;  1H0I A;  2F2D A;  4O2T A;  2KE0 A;  1WAW A;  4MGV A;  3B9A A;  4ZPV R;  2O9O A;  2D9F A;  1FKK A;  3ARX A;  4MAV A;  4IT6 A;  1HXV A;  2PV1 A;  4P8X A;  4S3K A;  2DPE A;  4JFL A;  3WQW A;  1ZL1 A;  2DSW A;  1X6L A;  1ZB5 A;  2A3A A;  1HJW A;  3QOK A;  3JYM A;  3RFW A;  1T11 A;  4KR0 B;  2XP9 A;  4L72 B;  5I98 A;  4ODO A;  2PPO A;  1OWQ A;  1CTN A;  1K9T A;  3ARP A;  1D7J A;  3O5E A;  1FFR A;  4ITZ A;  4Z2J A;  1KFW A;  1KT1 A;  5HT1 A;  1F8A B;  2VN1 A;  4MNL A;  4W9Q A;  3CHF A;  1ZCN A;  2XPA A;  2DT3 A;  1QPL A;  2K8I A;  2ESC A;  1O6I A;  4QT2 A;  3ARW A;  3PRB A;  1EIB A;  5J6E A;  3TDB A;  1GUV A;  1LJY A;  3O5M A;  3CGN A;  4DRI A;  1LL4 A;  4P8W A;  3RM4 A;  1BKF A;  1NH6 A;  1B6C A;  1Q6H A;  3FXY A;  1ZK6 A;  3WL1 A;  4Z2H A;  5HTG A;  1NWS A;  4U86 A;  2M08 A;  5DIT A;  3TCZ A;  1M5Y A;  1EDQ A;  5D75 A;  2PI6 A;  1TFV A;  1EYM A;  1LQ0 A;  1R9H A;  2WLY A;  3PRA A;  3O5O A;  3ART A;  3MDY B;  3BXW A;  3UI4 A;  1ZBV A;  2ZR4 A;  4ODL A;  2AOS A;  2AWG A;  1LL6 A;  3KAF A;  4W5U A;  4XAK A;  4W9O A;  3ARQ A;  3NTP A;  3AS0 A;  3WKZ A;  1W26 A;  4JFI A;  4DRH A;  4DWS B;  5B8I C;  3ARU A;  1GOI A;  4DZ2 A;  1EHN A;  4R0X A;  1WNO A;  1W1T A;  2XP8 A;  1HJV A;  4R5E A;  2KR7 A;  1E6Z A;  1XHG A;  1OGG A;  3O5P A;  1D2K A;  4ODK A;  1F40 A;  1HKK A;  2G8Z A;  4HBO A;  1FKG A;  2Y78 A;  4Q22 A;  5DO2 A;  1JNE A;  2ZQU A;  3KCE A;  1W9P A;  1PBK A;  2XP6 A;  4J4N A;  4DWS D;  2DG9 A;  3AQU A;  4DWS C;  2DT0 A;  1E9L A;  1Q1C A;  1SYT A;  4IQC A;  3AS3 A;  5HKG A;  4ZS6 A;  2LJ4 A;  3ALF A;  5HW8 A;  1W9U A;  2MPH A;  1JND A;  3CHE A;  1ZBW A;  3O5F A;  4DRO A;  2LKN A;  3CHC A;  3KAB A;  2Q5A A;  2MLZ A;  3JYJ A;  3O5J A;  4J4O A;  1FD9 A;  4WIW A;  1PIN A;  2ZQS A;  3W4R A;  4JFJ A;  3CZ8 A;  2MLX A;  5GPR A;  1NMV A;  3WL0 A;  2QF8 A;  2UZ5 A;  1HKM A;  3ARS A;  2O92 A;  4P8V A;  1FKJ A;  2FKE A;  2PV2 A;  1J4H A;  3WD0 A;  2DG3 A;  4HBE A;  3O5I A;  2L2S A;  3CH9 A;  4MNJ A;  2N87 A;  4GIV A;  4QIB A;  1W1V A;  2DSU A;  4TYO A;  1FKI A;  4MTV A;  5HW7 A;  3CHD A;  2DT1 A;  1UR8 A;  5HUA A;  3O5Q A;  4MSP A;  2DSV A;  5HWB A;  4KQZ A;  2RUD A;  4JFM A;  2A3E A;  4DRN A;  1RD6 A;  1FFQ A;  2MLY A;  2XP4 A;  3UQA A;  3ARY A;  1YAT A;  4N19 A;  3VAW A;  4ML4 A;  4ODR A;  3UF8 A;  1JNS A;  4G2P A;  3G6L A;  4ODN A;  2A3B A;  3ARV A;  3FAP A;  3RM9 A;  4QT3 A;  3RM8 A;  2A3C A;  3LUO A;  4NSB A;  1FKB A;  4DRK A;  4LGX A;  1X6N A;  4MPK A;  3WD4 A;  4DH0 A;  3ARZ A;  4IQ2 A;  4S3J A;  3WQV A;  3ODK A;  4GGQ A;  1C9H A;  3UI6 A;  2RQS A;  3B9E A;  1FKT A;  1W9V A;  2ZR5 A;  1FKF A;  3TC5 A;  1YW5 A;  1OGB A;  5HW6 A;  1Q6I A;  3O5G A;  4BF8 A;  4W9P A;  2ZQT A;  3KAC A;  4Z2K A;  1FKD A;  3OOB A;  5BXJ A;  3B9D A;  3UQI A;  1L1P A;  2ZQV A;  3KAI A;  4DRJ A;  4DRQ A;  2XPB A;  2G41 A;  2KI3 A;  1ROU A;  4WKF A;  2PPP A;  1J6Y A;  4URI A;  3KAD A;  3ALG A;  1ZU8 A;  1U79 A;  1HKJ A;  1JNT A;  4JFK A;  3RME A;  3WD2 A;  1HJX A;  1Q6U A;  1NWR A;  3AS1 A;  3KAG A;  5GQB A;  2KGJ A;  4PTM A;  3UQB A;  2MF9 A;  2OLH A;  4DZ3 A;  3JXV A;  1SR0 A;  3G6M A;  4FN2 A;  4MNM A;  3WIJ A;  4DRM A;  5HBF A;  5JH8 A;  3B7X A;  2KO7 A;  3IHZ A;  4U84 A;  5DF0 A;  4LAX A;  4Z2G A;  3WH0 A;  3B8S A;  3PR9 A;  1E6P A;  3O5K A;  3I6C A;  2FAP A;  1LL7 A;  5DEZ A;  2FDM A;  1Y0O A;  1LG2 A;  4IT4 A;  4C02 B;  2OFN A;  1W1Y A;  3RGC A;  1BL4 A;  1NMW A;  2JZV A;  2LPV A;  2XP3 A;  2IUZ A;  2M2A A;  4Z2L A;  4G50 A;  1WB0 A;  2ZR6 A;  4ODP A;  2RUR A;  3O5L A;  2MNT A;  2WLZ A;  2YBT A;  4WK9 A;  1ROT A;  1NSG A;  2WM0 A;  2KFW A;  1A7X A;  2RUQ A;  2DT2 A;  4ODQ A;  4ZPT R;  4TW7 A;  1NWU A;  1J4R A;  2YBU A;  3KAH A;  4QZV B;  3IKD A;  1ZBK A;  4NNR A;  3CGM A;  1JVW A;  4WJX A;  1FKH A;  4WKA A;  4ZPW R;  2VCD A;  1UR9 A;  2ITK A;  2RSE A;  4NZC A;  3ARO A;  1NWT A;  4Q7N A;  1D7I A;  1FAP A;  4DT4 A;  3UI5 A;  3IKG A;  5HWC A;  2PBC A;  1KT0 A;  4WKH A;  1D6O A;  4U85 A;  1D7H A;  4LAY A;  5DIU A;  2DG4 A;  3WD3 A;  1FKL A;  1XRV A;  3NRK A;  5GPG A;  3OA5 A;  1E6R A;  4AY1 A;  2PPN A;  2IF4 A;  1N1A A;  3EY6 A;  2XP7 A;  3AS2 A;  1QPF A;  2DSZ A;  3FY1 A;  3GPK A;  4ODM A;  3ARR A;  1GPF A;  4L3N A;  4IPX A;  1E6N A;  1E15 A;  1ITX A;  2RUC A;  4TNS A;  1QZ2 A;  4DIP A;  2F4E A;  4Z2I A;  4FAP A;  1VF8 A;  4P8U A;  4JYS A;  2LGO A;  1FJD A;  4LAW A;  2M1I A;  1FKR A;  4HAR A;  1H0G A;  2F21 A;  3WD1 A;  2PV3 A;  3O5R A;  3O5D A;  1EQ3 A;  1J4I A;  4DWS A;  3IK8 A;  4TW6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...