1HXVA

Ppiase domain of the mycoplasma genitalium trigger factor
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
85
structure length
85
Chain Sequence
KLANGDIAIIDFTGIVDNKKLASASAQNYELTIGSNSFIKGFETGLIAMKVNQKKTLALTFPSDYHVKELQSKPVTFEVVLKAIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRIGGER FACTOR
publication title NMR solution structure and dynamics of the peptidyl-prolyl cis-trans isomerase domain of the trigger factor from Mycoplasma genitalium compared to FK506-binding protein.
pubmed doi rcsb
source organism Mycoplasma genitalium
molecule tags Chaperone
total genus 8
structure length 85
sequence length 85
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2001-01-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1hxvA00
3NRKA 5J6EA 4QT2A 4JFLA 5BXJA 1F40A 2ZR4A 2KR7A 1FKDA 1D6OA 3KAHA 2M08A 2ZR6A 1N1AA 2ZQVA 1NMVA 1Q6HA 1ZCNA 2MLYA 1FKTA 4O2TA 3WH0A 2Y78A 3O5DA 4W9QA 1Y0OA 4LAXA 4LAVA 4NNRA 4J4NA 4DZ2A 2RURA 4TX0A 1J4HA 1PBKA 2XP9A 3O5RA 5B8IC 3MDYB 3EY6A 4IPXA 3UQAA 1HXVA 4ODRA 2D9FA 4DRQA 1FKJA 5DIUA 1Q6IA 2FKEA 2JZVA 1A7XA 2PV3A 3GPKA 4GIVA 1Q1CA 2DG9A 2XP7A 4W9PA 3NI6A 2RUDA 2VN1A 4QIBA 2PPOA 1YATA 1FKRA 4DRIA 2MLZA 4TW7A 3KZ7A 3O5EA 2KI3A 4ODMA 5HUAA 4GGQA 1J6YA 1NMWA 4J4OA 2LKNA 3O5MA 3O5IA 4IQ2A 3KAGA 3KAIA 3TDBA 4DRJA 1QPLA 1ROTA 2ZQUA 1FKBA 3KACA 3I6CA 2F21A 3O5LA 4DT4A 2OFNA 2PPNA 2XP5A 1FAPA 1YW5A 3IK8A 2PPPA 3CGMA 4QT3A 3VAWA 2VCDA 2LPVA 3JYJA 5HWBA 3IKDA 1FD9A 1FKGA 4IQCA 3UI4A 3JYMA 4ODNA 1U79A 2ITKA 4DRHA 1J4IA 1FKIA 2MPHA 2MF9A 1P5QA 2N87A 3O5QA 4LAWA 5DITA 3UQIA 4C02B 2KGJA 4ODLA 4JFMA 3TCZA 4TW8A 5HWCA 1BKFA 1FKHA 3TC5A 1ROUA 4DIPA 3KAFA 4ODKA 1M5YA 1F8AB 3IHZA 5DIVA 4BF8A 4TW6A 2XPBA 1PINA 1C9HA 4U86A 3OOBA 2F4EA 4JYSA 1EQ3A 2M1IA 2XP6A 3UQBA 4TYOA 1D7IA 3O5OA 5HW6A 4N19A 5HW8A 5I98A 3IKGA 1NSGA 1T11A 4LAYA 3RFWA 4ODOA 2DG3A 1J4RA 1QZ2A 2RUCA 4R0XA 4JFKA 1FKKA 4U84A 2KO7A 2RSEA 2ZQSA 2FAPA 2PV1A 1KT1A 3JXVA 2PV2A 2DG4A 3B7XA 3KCEA 1FKSA 3O5JA 3O5FA 4JFJA 4DRMA 3RGCA 5HTGA 1JNTA 5HW7A 4MSPA 5HKGA 2KFWA 2XP3A 1FKLA 4DZ3A 1D7JA 2F2DA 3UI5A 2RUQA 1FKFA 1JVWA 3ODKA 2AWGA 3PA7A 1Q6UA 4FAPA 4MGVA 2IF4A 2LJ4A 4DH0A 3H9RB 4TNSA 2ZR5A 4ITZA 4ODPA 3CGNA 4G50A 1EYMA 4JFIA 4DRNA 3O5PA 2Q5AA 3O5GA 1L1PA 1QPFA 2MNTA 2KE0A 2K8IA 4DROA 4G2PA 1JNSA 4W9OA 2MLXA 4U85A 2XPAA 4FN2A 2ZQTA 4DRPA 3FAPA 3KADA 1TCOC 2RQSA 3UF8A 5GPGA 3LUOA 1B6CA 3NTPA 4DRKA 2PBCA 1FJDA 1D7HA 1ZK6A 4ODQA 2M2AA 1BL4A 2LGOA 2UZ5A 5D75A 2XP4A 3UI6A 3PRBA 2L2SA 2XP8A 3PRDA 5HT1A 1R9HA 3KABA 1W26A 3O5KA 1KT0A
chains in the Genus database with same CATH superfamily
3NRKA 1W9UA 4JFLA 5BXJA 1F40A 2ZR4A 1FKDA 3KAHA 2M08A 2ZR6A 1N1AA 4O2TA 1ZCNA 3WH0A 2MLYA 1ZBWA 1HJWA 1IX5A 4TX0A 1PBKA 4IPXA 2D9FA 5DF0A 1FKJA 3BMBA 2FKEA 2DPEA 2OLHA 4W9PA 1XHGA 3CHDA 4KR0B 1LG1A 2YBUA 3WL0A 1YATA 3G6MA 3WKZA 2G8ZA 1E15A 1QPLA 1ROTA 3O5LA 3IK8A 1HKIA 2VCDA 2LPVA 3IKDA 1FD9A 1FKGA 4IQCA 1FKIA 2MPHA 3O5QA 2MF9A 1KFWA 4HBEA 4TW8A 4DIPA 2O92A 4P8WA 1F8AB 1D2KA 4TW6A 1LL6A 4U86A 4ZPTR 5I98A 5HBFA 4LAYA 3B8SA 3OA5A 3B9EA 4JFKA 1FKKA 4S3JA 2ZQSA 1KT1A 3O5FA 2DG4A 5HTGA 2PI6A 4DRMA 2XP3A 1FKLA 1FFRA 2EULA 4MGVA 4DH0A 3H9RB 1LL7A 4ZPVR 2DT2A 4ODPA 5GQBA 4JFIA 3O5GA 1E6NA 2KE0A 2K8IA 4W5UA 3WD2A 4W9OA 4FN2A 1H0GA 3NTPA 1NH6A 1D7HA 2LGOA 1CTNA 3CHEA 3PRBA 3PRDA 3ARPA 1W9VA 1R9HA 4DWSC 3AS0A 1E6PA 3RM8A 3ARZA 4URIA 3AS2A 1FKTA 1EDQA 4NNRA 4DZ2A 3O5RA 2DT1A 3MDYB 3EY6A 2A3AA 3UQAA 1SYTA 1ZBVA 3GPKA 1Q1CA 2ETNA 4HBOA 1O6IA 3NI6A 2PPOA 1JCHB 2WLZA 3CHFA 3KZ7A 2B31A 2KI3A 1NMWA 4DRHA 3O5IA 4IQ2A 3KAIA 2WLYA 2AOSA 4DWSB 3KACA 2A3EA 3I6CA 1ZB5A 3WD4A 3CH9A 2DT0A 2PPNA 1EHNA 1GRJA 3GTYX 4S3KA 3JYJA 1ZBCA 4MNJA 3UQIA 3WL1A 4C02B 4ODLA 4JFMA 4Z2HA 4P8XA 1BKFA 1FKHA 1ROUA 1HKKA 1ZU8A 1NWRA 3AQUA 3IHZA 5DIVA 1C9HA 2M1IA 3O5OA 1SR0A 5HW8A 2DG3A 1QZ2A 2FAPA 5B8IC 3AS3A 3JXVA 4HARA 3B7XA 3RGCA 1JNTA 4MSPA 5HKGA 4MAVA 4DZ3A 1FKFA 4FAPA 3ODKA 2AWGA 3ARXA 3CHCA 4WIWA 1NWTA 4P8UA 1HKMA 1LG2A 4Z2JA 4Z2IA 2P4VA 3O5PA 1L1PA 1QPFA 2MNTA 4G2PA 4R5EA 4NSBA 2B5UB 2XPAA 3FAPA 1TCOC 3UF8A 1B6CA 1FJDA 3CZ8A 4ODQA 2XP4A 1HJVA 3PRAA 1ZBKA 1JNSA 3O5KA 4MTVA 3GU0A 4Z2GA 2YBTA 4WK9A 3ARTA 1X6NA 4QZVB 4W9QA 2A3CA 1Y0OA 2RURA 2XP9A 3RMEA 4ODRA 4DRQA 1ZL1A 1LQ0A 1Q6IA 2JZVA 1H0IA 2PV3A 5GPRA 2XP7A 3ARUA 5DEZA 1W1YA 1FKRA 3FXYA 4DRIA 1GPFA 1W1VA 1OGGA 1HJXA 4TW7A 4IT6A 3WQWA 3O5EA 4ODMA 5HUAA 1NWSA 4GGQA 4J4OA 2LKNA 4P8VA 3TDBA 2F23A 4XAKA 2ZQUA 2IUZA 2DSUA 2F21A 2OFNA 1HKJA 2PPPA 3QOKA 3WD3A 3WD1A 5HWBA 3UI4A 3JYMA 2PN0A 1U79A 2ITKA 4ZPWR 1J4IA 2N87A 4LAWA 5DITA 3ARQA 5HWCA 2DT3A 1LL4A 3EIPA 5DO2A 3TC5A 4KQZA 3KAFA 1JNDA 1W9PA 1M5YA 2WK2A 3ARVA 4BF8A 3W4RA 3B9DA 2XPBA 3OOBA 1EQ3A 4ML4A 2XP6A 2DSWA 4TYOA 1E9LA 5HW6A 1FFQA 3IKGA 1NSGA 1UR8A 4ODOA 2RUCA 4U84A 2PV2A 3KCEA 4JFJA 4MNMA 5HW7A 3ALGA 1JVWA 3PA7A 4DWSD 1Q6UA 4UDMA 4WKAA 2IF4A 4WKFA 3FY1A 3AROA 4TNSA 2ZR5A 4ITZA 3CGNA 4DRNA 2Q5AA 4L3NA 4DROA 1WB0A 2G41A 3WD0A 3RM9A 4ZS6A 4DRPA 3KADA 5GPGA 3ARYA 3LUOA 4MNLA 4AY1A 2ESCA 1ITXA 1ZK6A 2M2AA 3UI6A 5D75A 4WKHA 4Z2KA 1XRVA 2UZ5A 1KT0A 1OWQA 4ODNA 5J6EA 4QT2A 1JNEA 4LGXA 4L72B 2KR7A 1D6OA 1OGBA 2ZQVA 1NMVA 1Q6HA 1NWUA 2Y78A 1E6RA 3O5DA 4LAXA 4LAVA 4J4NA 1WAWA 1J4HA 3WIJA 4NZCA 2A3BA 1HXVA 3ARSA 3ARWA 3WQVA 5DIUA 1TFVA 1A7XA 4GIVA 3BXWA 2DG9A 2RUDA 2VN1A 4QIBA 1EIBA 1W1PA 5JH8A 4Z2LA 1E6ZA 2QF8A 2MLZA 1LJYA 3AS1A 4IT4A 1J6YA 3O5MA 3KAGA 4DRJA 1RD6A 2WM0A 1GOIA 1FKBA 4DT4A 2XP5A 1FAPA 1YW5A 4QT3A 3CGMA 3VAWA 1E44A 2DSVA 1GUVA 1W1TA 1P5QA 2KGJA 3TCZA 4ODKA 3B9AA 1PINA 3ARRA 4JYSA 2F4EA 4MPKA 3UQBA 1D7IA 4WJXA 4N19A 1VF8A 1T11A 3RFWA 3RM4A 1J4RA 4R0XA 3UI5A 2KO7A 2RSEA 2PV1A 3O5JA 1FKSA 4Q7NA 2DSZA 2KFWA 1D7JA 2F2DA 2RUQA 3G6LA 1UR9A 2LJ4A 1X6LA 2FDMA 3PR9A 4PTMA 4G50A 1EYMA 3ALFA 4Q22A 1WNOA 2MLXA 2O9OA 4U85A 4MNKA 2ZQTA 2RQSA 4DRKA 2PBCA 1BL4A 4DWSA 2L2SA 2XP8A 1K9TA 5HT1A 3KABA 1W26A
chains in the Genus database with same CATH topology
3NRKA 1W9UA 4JFLA 5BXJA 1F40A 2ZR4A 1FKDA 3KAHA 2M08A 2ZR6A 1N1AA 4O2TA 1ZCNA 3WH0A 2MLYA 1ZBWA 1HJWA 1IX5A 4TX0A 1PBKA 4IPXA 2D9FA 5DF0A 1FKJA 2FKEA 2DPEA 2OLHA 4W9PA 1XHGA 3CHDA 4KR0B 1LG1A 2YBUA 3WL0A 1YATA 3G6MA 3WKZA 2G8ZA 1E15A 1QPLA 1ROTA 3O5LA 3IK8A 1HKIA 2VCDA 2LPVA 3IKDA 1FD9A 1FKGA 4IQCA 1FKIA 2MPHA 3O5QA 2MF9A 1KFWA 4HBEA 4TW8A 4DIPA 2O92A 4P8WA 1F8AB 1D2KA 4TW6A 1LL6A 4U86A 4ZPTR 5I98A 5HBFA 4LAYA 3B8SA 3OA5A 3B9EA 4JFKA 1FKKA 4S3JA 2ZQSA 1KT1A 3O5FA 2DG4A 5HTGA 2PI6A 4DRMA 2XP3A 1FKLA 1FFRA 4MGVA 4DH0A 3H9RB 1LL7A 4ZPVR 2DT2A 4ODPA 5GQBA 4JFIA 3O5GA 1E6NA 2KE0A 2K8IA 4W5UA 3WD2A 4W9OA 4FN2A 1H0GA 3NTPA 1NH6A 1D7HA 2LGOA 1CTNA 3CHEA 3PRBA 3PRDA 3ARPA 1W9VA 1R9HA 4DWSC 3AS0A 1E6PA 3RM8A 3ARZA 4URIA 3AS2A 1FKTA 1EDQA 4NNRA 4DZ2A 3O5RA 2DT1A 3MDYB 3EY6A 2A3AA 3UQAA 1SYTA 1ZBVA 3GPKA 1Q1CA 4HBOA 1O6IA 3NI6A 2PPOA 2WLZA 3CHFA 3KZ7A 2B31A 2KI3A 1NMWA 4DRHA 3O5IA 4IQ2A 3KAIA 2WLYA 2AOSA 4DWSB 3KACA 2A3EA 3I6CA 1ZB5A 3WD4A 3CH9A 2DT0A 2PPNA 1EHNA 4S3KA 3JYJA 1ZBCA 4MNJA 3UQIA 3WL1A 4C02B 4ODLA 4JFMA 4Z2HA 4P8XA 1BKFA 1FKHA 1ROUA 1HKKA 1ZU8A 1NWRA 3AQUA 3IHZA 5DIVA 1C9HA 2M1IA 3O5OA 1SR0A 5HW8A 2DG3A 1QZ2A 2FAPA 5B8IC 3AS3A 3JXVA 4HARA 3B7XA 3RGCA 1JNTA 4MSPA 5HKGA 4MAVA 4DZ3A 1FKFA 4FAPA 3ODKA 2AWGA 3ARXA 3CHCA 4WIWA 1NWTA 4P8UA 1HKMA 1LG2A 4Z2JA 4Z2IA 3O5PA 1L1PA 1QPFA 2MNTA 4G2PA 4R5EA 4NSBA 2XPAA 3FAPA 1TCOC 3UF8A 1B6CA 1FJDA 3CZ8A 4ODQA 2XP4A 1HJVA 3PRAA 1ZBKA 1JNSA 3O5KA 4MTVA 4Z2GA 2YBTA 4WK9A 3ARTA 1X6NA 4QZVB 4W9QA 2A3CA 1Y0OA 2RURA 2XP9A 3RMEA 4ODRA 4DRQA 1ZL1A 1LQ0A 1Q6IA 2JZVA 1H0IA 2PV3A 5GPRA 2XP7A 3ARUA 5DEZA 1W1YA 1FKRA 3FXYA 4DRIA 1GPFA 1W1VA 1OGGA 1HJXA 4TW7A 4IT6A 3WQWA 3O5EA 4ODMA 5HUAA 1NWSA 4GGQA 4J4OA 2LKNA 4P8VA 3TDBA 4XAKA 2ZQUA 2IUZA 2DSUA 2F21A 2OFNA 1HKJA 2PPPA 3QOKA 3WD3A 3WD1A 5HWBA 3UI4A 3JYMA 1U79A 2ITKA 4ZPWR 1J4IA 2N87A 4LAWA 5DITA 3ARQA 5HWCA 2DT3A 1LL4A 5DO2A 3TC5A 4KQZA 3KAFA 1JNDA 1W9PA 1M5YA 2WK2A 3ARVA 4BF8A 3W4RA 3B9DA 2XPBA 3OOBA 1EQ3A 4ML4A 2XP6A 2DSWA 4TYOA 1E9LA 5HW6A 1FFQA 3IKGA 1NSGA 1UR8A 4ODOA 2RUCA 4U84A 2PV2A 3KCEA 4JFJA 4MNMA 5HW7A 3ALGA 1JVWA 3PA7A 4DWSD 1Q6UA 4WKAA 2IF4A 4WKFA 3FY1A 3AROA 4TNSA 2ZR5A 4ITZA 3CGNA 4DRNA 2Q5AA 4L3NA 4DROA 1WB0A 2G41A 3WD0A 3RM9A 4ZS6A 4DRPA 3KADA 5GPGA 3ARYA 3LUOA 4MNLA 4AY1A 2ESCA 1ITXA 1ZK6A 2M2AA 3UI6A 5D75A 4WKHA 4Z2KA 1XRVA 2UZ5A 1KT0A 1OWQA 4ODNA 5J6EA 4QT2A 1JNEA 4LGXA 4L72B 2KR7A 1D6OA 1OGBA 2ZQVA 1NMVA 1Q6HA 1NWUA 2Y78A 1E6RA 3O5DA 4LAXA 4LAVA 4J4NA 1WAWA 1J4HA 3WIJA 4NZCA 2A3BA 1HXVA 3ARSA 3ARWA 3WQVA 5DIUA 1TFVA 1A7XA 4GIVA 3BXWA 2DG9A 2RUDA 2VN1A 4QIBA 1EIBA 1W1PA 5JH8A 4Z2LA 1E6ZA 2QF8A 2MLZA 1LJYA 3AS1A 4IT4A 1J6YA 3O5MA 3KAGA 4DRJA 1RD6A 2WM0A 1GOIA 1FKBA 4DT4A 2XP5A 1FAPA 1YW5A 4QT3A 3CGMA 3VAWA 2DSVA 1GUVA 1W1TA 1P5QA 2KGJA 3TCZA 4ODKA 3B9AA 1PINA 3ARRA 4JYSA 2F4EA 4MPKA 3UQBA 1D7IA 4WJXA 4N19A 1VF8A 1T11A 3RFWA 3RM4A 1J4RA 4R0XA 3UI5A 2KO7A 2RSEA 2PV1A 3O5JA 1FKSA 4Q7NA 2DSZA 2KFWA 1D7JA 2F2DA 2RUQA 3G6LA 1UR9A 2LJ4A 1X6LA 2FDMA 3PR9A 4PTMA 4G50A 1EYMA 3ALFA 4Q22A 1WNOA 2MLXA 2O9OA 4U85A 4MNKA 2ZQTA 2RQSA 4DRKA 2PBCA 1BL4A 4DWSA 2L2SA 2XP8A 1K9TA 5HT1A 3KABA 1W26A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NRK A;  5J6E A;  4QT2 A;  4JFL A;  5BXJ A;  1F40 A;  2ZR4 A;  2KR7 A;  1FKD A;  1D6O A;  3KAH A;  2M08 A;  2ZR6 A;  1N1A A;  2ZQV A;  1NMV A;  1Q6H A;  1ZCN A;  2MLY A;  1FKT A;  4O2T A;  3WH0 A;  2Y78 A;  3O5D A;  4W9Q A;  1Y0O A;  4LAX A;  4LAV A;  4NNR A;  4J4N A;  4DZ2 A;  2RUR A;  4TX0 A;  1J4H A;  1PBK A;  2XP9 A;  3O5R A;  5B8I C;  3MDY B;  3EY6 A;  4IPX A;  3UQA A;  1HXV A;  4ODR A;  2D9F A;  4DRQ A;  1FKJ A;  5DIU A;  1Q6I A;  2FKE A;  2JZV A;  1A7X A;  2PV3 A;  3GPK A;  4GIV A;  1Q1C A;  2DG9 A;  2XP7 A;  4W9P A;  3NI6 A;  2RUD A;  2VN1 A;  4QIB A;  2PPO A;  1YAT A;  1FKR A;  4DRI A;  2MLZ A;  4TW7 A;  3KZ7 A;  3O5E A;  2KI3 A;  4ODM A;  5HUA A;  4GGQ A;  1J6Y A;  1NMW A;  4J4O A;  2LKN A;  3O5M A;  3O5I A;  4IQ2 A;  3KAG A;  3KAI A;  3TDB A;  4DRJ A;  1QPL A;  1ROT A;  2ZQU A;  1FKB A;  3KAC A;  3I6C A;  2F21 A;  3O5L A;  4DT4 A;  2OFN A;  2PPN A;  2XP5 A;  1FAP A;  1YW5 A;  3IK8 A;  2PPP A;  3CGM A;  4QT3 A;  3VAW A;  2VCD A;  2LPV A;  3JYJ A;  5HWB A;  3IKD A;  1FD9 A;  1FKG A;  4IQC A;  3UI4 A;  3JYM A;  4ODN A;  1U79 A;  2ITK A;  4DRH A;  1J4I A;  1FKI A;  2MPH A;  2MF9 A;  1P5Q A;  2N87 A;  3O5Q A;  4LAW A;  5DIT A;  3UQI A;  4C02 B;  2KGJ A;  4ODL A;  4JFM A;  3TCZ A;  4TW8 A;  5HWC A;  1BKF A;  1FKH A;  3TC5 A;  1ROU A;  4DIP A;  3KAF A;  4ODK A;  1M5Y A;  1F8A B;  3IHZ A;  5DIV A;  4BF8 A;  4TW6 A;  2XPB A;  1PIN A;  1C9H A;  4U86 A;  3OOB A;  2F4E A;  4JYS A;  1EQ3 A;  2M1I A;  2XP6 A;  3UQB A;  4TYO A;  1D7I A;  3O5O A;  5HW6 A;  4N19 A;  5HW8 A;  5I98 A;  3IKG A;  1NSG A;  1T11 A;  4LAY A;  3RFW A;  4ODO A;  2DG3 A;  1J4R A;  1QZ2 A;  2RUC A;  4R0X A;  4JFK A;  1FKK A;  4U84 A;  2KO7 A;  2RSE A;  2ZQS A;  2FAP A;  2PV1 A;  1KT1 A;  3JXV A;  2PV2 A;  2DG4 A;  3B7X A;  3KCE A;  1FKS A;  3O5J A;  3O5F A;  4JFJ A;  4DRM A;  3RGC A;  5HTG A;  1JNT A;  5HW7 A;  4MSP A;  5HKG A;  2KFW A;  2XP3 A;  1FKL A;  4DZ3 A;  1D7J A;  2F2D A;  3UI5 A;  2RUQ A;  1FKF A;  1JVW A;  3ODK A;  2AWG A;  3PA7 A;  1Q6U A;  4FAP A;  4MGV A;  2IF4 A;  2LJ4 A;  4DH0 A;  3H9R B;  4TNS A;  2ZR5 A;  4ITZ A;  4ODP A;  3CGN A;  4G50 A;  1EYM A;  4JFI A;  4DRN A;  3O5P A;  2Q5A A;  3O5G A;  1L1P A;  1QPF A;  2MNT A;  2KE0 A;  2K8I A;  4DRO A;  4G2P A;  1JNS A;  4W9O A;  2MLX A;  4U85 A;  2XPA A;  4FN2 A;  2ZQT A;  4DRP A;  3FAP A;  3KAD A;  1TCO C;  2RQS A;  3UF8 A;  5GPG A;  3LUO A;  1B6C A;  3NTP A;  4DRK A;  2PBC A;  1FJD A;  1D7H A;  1ZK6 A;  4ODQ A;  2M2A A;  1BL4 A;  2LGO A;  2UZ5 A;  5D75 A;  2XP4 A;  3UI6 A;  3PRB A;  2L2S A;  2XP8 A;  3PRD A;  5HT1 A;  1R9H A;  3KAB A;  1W26 A;  3O5K A;  1KT0 A; 
#chains in the Genus database with same CATH topology
 3NRK A;  1W9U A;  4JFL A;  5BXJ A;  1F40 A;  2ZR4 A;  1FKD A;  3KAH A;  2M08 A;  2ZR6 A;  1N1A A;  4O2T A;  1ZCN A;  3WH0 A;  2MLY A;  1ZBW A;  1HJW A;  1IX5 A;  4TX0 A;  1PBK A;  4IPX A;  2D9F A;  5DF0 A;  1FKJ A;  3BMB A;  2FKE A;  2DPE A;  2OLH A;  4W9P A;  1XHG A;  3CHD A;  4KR0 B;  1LG1 A;  2YBU A;  3WL0 A;  1YAT A;  3G6M A;  3WKZ A;  2G8Z A;  1E15 A;  1QPL A;  1ROT A;  3O5L A;  3IK8 A;  1HKI A;  2VCD A;  2LPV A;  3IKD A;  1FD9 A;  1FKG A;  4IQC A;  1FKI A;  2MPH A;  3O5Q A;  2MF9 A;  1KFW A;  4HBE A;  4TW8 A;  4DIP A;  2O92 A;  4P8W A;  1F8A B;  1D2K A;  4TW6 A;  1LL6 A;  4U86 A;  4ZPT R;  5I98 A;  5HBF A;  4LAY A;  3B8S A;  3OA5 A;  3B9E A;  4JFK A;  1FKK A;  4S3J A;  2ZQS A;  1KT1 A;  3O5F A;  2DG4 A;  5HTG A;  2PI6 A;  4DRM A;  2XP3 A;  1FKL A;  1FFR A;  2EUL A;  4MGV A;  4DH0 A;  3H9R B;  1LL7 A;  4ZPV R;  2DT2 A;  4ODP A;  5GQB A;  4JFI A;  3O5G A;  1E6N A;  2KE0 A;  2K8I A;  4W5U A;  3WD2 A;  4W9O A;  4FN2 A;  1H0G A;  3NTP A;  1NH6 A;  1D7H A;  2LGO A;  1CTN A;  3CHE A;  3PRB A;  3PRD A;  3ARP A;  1W9V A;  1R9H A;  4DWS C;  3AS0 A;  1E6P A;  3RM8 A;  3ARZ A;  4URI A;  3AS2 A;  1FKT A;  1EDQ A;  4NNR A;  4DZ2 A;  3O5R A;  2DT1 A;  3MDY B;  3EY6 A;  2A3A A;  3UQA A;  1SYT A;  1ZBV A;  3GPK A;  1Q1C A;  2ETN A;  4HBO A;  1O6I A;  3NI6 A;  2PPO A;  1JCH B;  2WLZ A;  3CHF A;  3KZ7 A;  2B31 A;  2KI3 A;  1NMW A;  4DRH A;  3O5I A;  4IQ2 A;  3KAI A;  2WLY A;  2AOS A;  4DWS B;  3KAC A;  2A3E A;  3I6C A;  1ZB5 A;  3WD4 A;  3CH9 A;  2DT0 A;  2PPN A;  1EHN A;  1GRJ A;  3GTY X;  4S3K A;  3JYJ A;  1ZBC A;  4MNJ A;  3UQI A;  3WL1 A;  4C02 B;  4ODL A;  4JFM A;  4Z2H A;  4P8X A;  1BKF A;  1FKH A;  1ROU A;  1HKK A;  1ZU8 A;  1NWR A;  3AQU A;  3IHZ A;  5DIV A;  1C9H A;  2M1I A;  3O5O A;  1SR0 A;  5HW8 A;  2DG3 A;  1QZ2 A;  2FAP A;  5B8I C;  3AS3 A;  3JXV A;  4HAR A;  3B7X A;  3RGC A;  1JNT A;  4MSP A;  5HKG A;  4MAV A;  4DZ3 A;  1FKF A;  4FAP A;  3ODK A;  2AWG A;  3ARX A;  3CHC A;  4WIW A;  1NWT A;  4P8U A;  1HKM A;  1LG2 A;  4Z2J A;  4Z2I A;  2P4V A;  3O5P A;  1L1P A;  1QPF A;  2MNT A;  4G2P A;  4R5E A;  4NSB A;  2B5U B;  2XPA A;  3FAP A;  1TCO C;  3UF8 A;  1B6C A;  1FJD A;  3CZ8 A;  4ODQ A;  2XP4 A;  1HJV A;  3PRA A;  1ZBK A;  1JNS A;  3O5K A;  4MTV A;  3GU0 A;  4Z2G A;  2YBT A;  4WK9 A;  3ART A;  1X6N A;  4QZV B;  4W9Q A;  2A3C A;  1Y0O A;  2RUR A;  2XP9 A;  3RME A;  4ODR A;  4DRQ A;  1ZL1 A;  1LQ0 A;  1Q6I A;  2JZV A;  1H0I A;  2PV3 A;  5GPR A;  2XP7 A;  3ARU A;  5DEZ A;  1W1Y A;  1FKR A;  3FXY A;  4DRI A;  1GPF A;  1W1V A;  1OGG A;  1HJX A;  4TW7 A;  4IT6 A;  3WQW A;  3O5E A;  4ODM A;  5HUA A;  1NWS A;  4GGQ A;  4J4O A;  2LKN A;  4P8V A;  3TDB A;  2F23 A;  4XAK A;  2ZQU A;  2IUZ A;  2DSU A;  2F21 A;  2OFN A;  1HKJ A;  2PPP A;  3QOK A;  3WD3 A;  3WD1 A;  5HWB A;  3UI4 A;  3JYM A;  2PN0 A;  1U79 A;  2ITK A;  4ZPW R;  1J4I A;  2N87 A;  4LAW A;  5DIT A;  3ARQ A;  5HWC A;  2DT3 A;  1LL4 A;  3EIP A;  5DO2 A;  3TC5 A;  4KQZ A;  3KAF A;  1JND A;  1W9P A;  1M5Y A;  2WK2 A;  3ARV A;  4BF8 A;  3W4R A;  3B9D A;  2XPB A;  3OOB A;  1EQ3 A;  4ML4 A;  2XP6 A;  2DSW A;  4TYO A;  1E9L A;  5HW6 A;  1FFQ A;  3IKG A;  1NSG A;  1UR8 A;  4ODO A;  2RUC A;  4U84 A;  2PV2 A;  3KCE A;  4JFJ A;  4MNM A;  5HW7 A;  3ALG A;  1JVW A;  3PA7 A;  4DWS D;  1Q6U A;  4UDM A;  4WKA A;  2IF4 A;  4WKF A;  3FY1 A;  3ARO A;  4TNS A;  2ZR5 A;  4ITZ A;  3CGN A;  4DRN A;  2Q5A A;  4L3N A;  4DRO A;  1WB0 A;  2G41 A;  3WD0 A;  3RM9 A;  4ZS6 A;  4DRP A;  3KAD A;  5GPG A;  3ARY A;  3LUO A;  4MNL A;  4AY1 A;  2ESC A;  1ITX A;  1ZK6 A;  2M2A A;  3UI6 A;  5D75 A;  4WKH A;  4Z2K A;  1XRV A;  2UZ5 A;  1KT0 A;  1OWQ A;  4ODN A;  5J6E A;  4QT2 A;  1JNE A;  4LGX A;  4L72 B;  2KR7 A;  1D6O A;  1OGB A;  2ZQV A;  1NMV A;  1Q6H A;  1NWU A;  2Y78 A;  1E6R A;  3O5D A;  4LAX A;  4LAV A;  4J4N A;  1WAW A;  1J4H A;  3WIJ A;  4NZC A;  2A3B A;  1HXV A;  3ARS A;  3ARW A;  3WQV A;  5DIU A;  1TFV A;  1A7X A;  4GIV A;  3BXW A;  2DG9 A;  2RUD A;  2VN1 A;  4QIB A;  1EIB A;  1W1P A;  5JH8 A;  4Z2L A;  1E6Z A;  2QF8 A;  2MLZ A;  1LJY A;  3AS1 A;  4IT4 A;  1J6Y A;  3O5M A;  3KAG A;  4DRJ A;  1RD6 A;  2WM0 A;  1GOI A;  1FKB A;  4DT4 A;  2XP5 A;  1FAP A;  1YW5 A;  4QT3 A;  3CGM A;  3VAW A;  1E44 A;  2DSV A;  1GUV A;  1W1T A;  1P5Q A;  2KGJ A;  3TCZ A;  4ODK A;  3B9A A;  1PIN A;  3ARR A;  4JYS A;  2F4E A;  4MPK A;  3UQB A;  1D7I A;  4WJX A;  4N19 A;  1VF8 A;  1T11 A;  3RFW A;  3RM4 A;  1J4R A;  4R0X A;  3UI5 A;  2KO7 A;  2RSE A;  2PV1 A;  3O5J A;  1FKS A;  4Q7N A;  2DSZ A;  2KFW A;  1D7J A;  2F2D A;  2RUQ A;  3G6L A;  1UR9 A;  2LJ4 A;  1X6L A;  2FDM A;  3PR9 A;  4PTM A;  4G50 A;  1EYM A;  3ALF A;  4Q22 A;  1WNO A;  2MLX A;  2O9O A;  4U85 A;  4MNK A;  2ZQT A;  2RQS A;  4DRK A;  2PBC A;  1BL4 A;  4DWS A;  2L2S A;  2XP8 A;  1K9T A;  5HT1 A;  3KAB A;  1W26 A; 
#chains in the Genus database with same CATH homology
 3NRK A;  1W9U A;  4JFL A;  5BXJ A;  1F40 A;  2ZR4 A;  1FKD A;  3KAH A;  2M08 A;  2ZR6 A;  1N1A A;  4O2T A;  1ZCN A;  3WH0 A;  2MLY A;  1ZBW A;  1HJW A;  1IX5 A;  4TX0 A;  1PBK A;  4IPX A;  2D9F A;  5DF0 A;  1FKJ A;  2FKE A;  2DPE A;  2OLH A;  4W9P A;  1XHG A;  3CHD A;  4KR0 B;  1LG1 A;  2YBU A;  3WL0 A;  1YAT A;  3G6M A;  3WKZ A;  2G8Z A;  1E15 A;  1QPL A;  1ROT A;  3O5L A;  3IK8 A;  1HKI A;  2VCD A;  2LPV A;  3IKD A;  1FD9 A;  1FKG A;  4IQC A;  1FKI A;  2MPH A;  3O5Q A;  2MF9 A;  1KFW A;  4HBE A;  4TW8 A;  4DIP A;  2O92 A;  4P8W A;  1F8A B;  1D2K A;  4TW6 A;  1LL6 A;  4U86 A;  4ZPT R;  5I98 A;  5HBF A;  4LAY A;  3B8S A;  3OA5 A;  3B9E A;  4JFK A;  1FKK A;  4S3J A;  2ZQS A;  1KT1 A;  3O5F A;  2DG4 A;  5HTG A;  2PI6 A;  4DRM A;  2XP3 A;  1FKL A;  1FFR A;  4MGV A;  4DH0 A;  3H9R B;  1LL7 A;  4ZPV R;  2DT2 A;  4ODP A;  5GQB A;  4JFI A;  3O5G A;  1E6N A;  2KE0 A;  2K8I A;  4W5U A;  3WD2 A;  4W9O A;  4FN2 A;  1H0G A;  3NTP A;  1NH6 A;  1D7H A;  2LGO A;  1CTN A;  3CHE A;  3PRB A;  3PRD A;  3ARP A;  1W9V A;  1R9H A;  4DWS C;  3AS0 A;  1E6P A;  3RM8 A;  3ARZ A;  4URI A;  3AS2 A;  1FKT A;  1EDQ A;  4NNR A;  4DZ2 A;  3O5R A;  2DT1 A;  3MDY B;  3EY6 A;  2A3A A;  3UQA A;  1SYT A;  1ZBV A;  3GPK A;  1Q1C A;  4HBO A;  1O6I A;  3NI6 A;  2PPO A;  2WLZ A;  3CHF A;  3KZ7 A;  2B31 A;  2KI3 A;  1NMW A;  4DRH A;  3O5I A;  4IQ2 A;  3KAI A;  2WLY A;  2AOS A;  4DWS B;  3KAC A;  2A3E A;  3I6C A;  1ZB5 A;  3WD4 A;  3CH9 A;  2DT0 A;  2PPN A;  1EHN A;  4S3K A;  3JYJ A;  1ZBC A;  4MNJ A;  3UQI A;  3WL1 A;  4C02 B;  4ODL A;  4JFM A;  4Z2H A;  4P8X A;  1BKF A;  1FKH A;  1ROU A;  1HKK A;  1ZU8 A;  1NWR A;  3AQU A;  3IHZ A;  5DIV A;  1C9H A;  2M1I A;  3O5O A;  1SR0 A;  5HW8 A;  2DG3 A;  1QZ2 A;  2FAP A;  5B8I C;  3AS3 A;  3JXV A;  4HAR A;  3B7X A;  3RGC A;  1JNT A;  4MSP A;  5HKG A;  4MAV A;  4DZ3 A;  1FKF A;  4FAP A;  3ODK A;  2AWG A;  3ARX A;  3CHC A;  4WIW A;  1NWT A;  4P8U A;  1HKM A;  1LG2 A;  4Z2J A;  4Z2I A;  3O5P A;  1L1P A;  1QPF A;  2MNT A;  4G2P A;  4R5E A;  4NSB A;  2XPA A;  3FAP A;  1TCO C;  3UF8 A;  1B6C A;  1FJD A;  3CZ8 A;  4ODQ A;  2XP4 A;  1HJV A;  3PRA A;  1ZBK A;  1JNS A;  3O5K A;  4MTV A;  4Z2G A;  2YBT A;  4WK9 A;  3ART A;  1X6N A;  4QZV B;  4W9Q A;  2A3C A;  1Y0O A;  2RUR A;  2XP9 A;  3RME A;  4ODR A;  4DRQ A;  1ZL1 A;  1LQ0 A;  1Q6I A;  2JZV A;  1H0I A;  2PV3 A;  5GPR A;  2XP7 A;  3ARU A;  5DEZ A;  1W1Y A;  1FKR A;  3FXY A;  4DRI A;  1GPF A;  1W1V A;  1OGG A;  1HJX A;  4TW7 A;  4IT6 A;  3WQW A;  3O5E A;  4ODM A;  5HUA A;  1NWS A;  4GGQ A;  4J4O A;  2LKN A;  4P8V A;  3TDB A;  4XAK A;  2ZQU A;  2IUZ A;  2DSU A;  2F21 A;  2OFN A;  1HKJ A;  2PPP A;  3QOK A;  3WD3 A;  3WD1 A;  5HWB A;  3UI4 A;  3JYM A;  1U79 A;  2ITK A;  4ZPW R;  1J4I A;  2N87 A;  4LAW A;  5DIT A;  3ARQ A;  5HWC A;  2DT3 A;  1LL4 A;  5DO2 A;  3TC5 A;  4KQZ A;  3KAF A;  1JND A;  1W9P A;  1M5Y A;  2WK2 A;  3ARV A;  4BF8 A;  3W4R A;  3B9D A;  2XPB A;  3OOB A;  1EQ3 A;  4ML4 A;  2XP6 A;  2DSW A;  4TYO A;  1E9L A;  5HW6 A;  1FFQ A;  3IKG A;  1NSG A;  1UR8 A;  4ODO A;  2RUC A;  4U84 A;  2PV2 A;  3KCE A;  4JFJ A;  4MNM A;  5HW7 A;  3ALG A;  1JVW A;  3PA7 A;  4DWS D;  1Q6U A;  4WKA A;  2IF4 A;  4WKF A;  3FY1 A;  3ARO A;  4TNS A;  2ZR5 A;  4ITZ A;  3CGN A;  4DRN A;  2Q5A A;  4L3N A;  4DRO A;  1WB0 A;  2G41 A;  3WD0 A;  3RM9 A;  4ZS6 A;  4DRP A;  3KAD A;  5GPG A;  3ARY A;  3LUO A;  4MNL A;  4AY1 A;  2ESC A;  1ITX A;  1ZK6 A;  2M2A A;  3UI6 A;  5D75 A;  4WKH A;  4Z2K A;  1XRV A;  2UZ5 A;  1KT0 A;  1OWQ A;  4ODN A;  5J6E A;  4QT2 A;  1JNE A;  4LGX A;  4L72 B;  2KR7 A;  1D6O A;  1OGB A;  2ZQV A;  1NMV A;  1Q6H A;  1NWU A;  2Y78 A;  1E6R A;  3O5D A;  4LAX A;  4LAV A;  4J4N A;  1WAW A;  1J4H A;  3WIJ A;  4NZC A;  2A3B A;  1HXV A;  3ARS A;  3ARW A;  3WQV A;  5DIU A;  1TFV A;  1A7X A;  4GIV A;  3BXW A;  2DG9 A;  2RUD A;  2VN1 A;  4QIB A;  1EIB A;  1W1P A;  5JH8 A;  4Z2L A;  1E6Z A;  2QF8 A;  2MLZ A;  1LJY A;  3AS1 A;  4IT4 A;  1J6Y A;  3O5M A;  3KAG A;  4DRJ A;  1RD6 A;  2WM0 A;  1GOI A;  1FKB A;  4DT4 A;  2XP5 A;  1FAP A;  1YW5 A;  4QT3 A;  3CGM A;  3VAW A;  2DSV A;  1GUV A;  1W1T A;  1P5Q A;  2KGJ A;  3TCZ A;  4ODK A;  3B9A A;  1PIN A;  3ARR A;  4JYS A;  2F4E A;  4MPK A;  3UQB A;  1D7I A;  4WJX A;  4N19 A;  1VF8 A;  1T11 A;  3RFW A;  3RM4 A;  1J4R A;  4R0X A;  3UI5 A;  2KO7 A;  2RSE A;  2PV1 A;  3O5J A;  1FKS A;  4Q7N A;  2DSZ A;  2KFW A;  1D7J A;  2F2D A;  2RUQ A;  3G6L A;  1UR9 A;  2LJ4 A;  1X6L A;  2FDM A;  3PR9 A;  4PTM A;  4G50 A;  1EYM A;  3ALF A;  4Q22 A;  1WNO A;  2MLX A;  2O9O A;  4U85 A;  4MNK A;  2ZQT A;  2RQS A;  4DRK A;  2PBC A;  1BL4 A;  4DWS A;  2L2S A;  2XP8 A;  1K9T A;  5HT1 A;  3KAB A;  1W26 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...