1HXXA

Ompf porin mutant y106f
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
340
structure length
340
Chain Sequence
AEIYNKDGNKVDLYGKAVGLHYFSKGNGENSYGGNGDMTYARLGFKGETQINSDLTGYGQWEYNFQGNNSEGADAQTGNKTRLAFAGLKYADVGSFDYGRNYGVVFDALGYTDMLPEFGGDTAYSDDFFVGRVGGVATYRNSNFFGLVDGLNFAVQYLGKNERDTARRSNGDGVGGSISYEYEGFGIVGAYGAADRTNLQEAQPLGNGKKAEQWATGLKYDANNIYLAANYGETRNATPITNKFTNTSGFANKTQDVLLVAQYQFDFGLRPSIAYTKSKAKDVEGIGDVDLVNYFEVGATYYFNKNMSTYVDYIINQIDSDNKLGVGSDDTVAVGIVYQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Role of charged residues at the OmpF porin channel constriction probed by mutagenesis and simulation.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Membrane protein
molecule keywords OUTER MEMBRANE PROTEIN F
total genus 104
structure length 340
sequence length 340
ec nomenclature
pdb deposition date 2001-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00267 Porin_1 Gram-negative porin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 1hxxA00
2XG6A 4RJWA 5DL8A 3NSGA 5DL7A 4GCSA 1BH3A 2Y0LA 3WI4A 4GCQA 2PORA 6PRNA 3POUA 4RJXA 3FYXA 4LSIA 4KRAA 2XE2A 2ZFGA 4JFBA 4LSHA 4GCPA 3HW9A 1GFQA 3SZDA 3SYSA 3SY7A 3K19A 8PRNA 4D5UA 1GFOA 2Y0HA 3PORA 3POXA 7PRNA 3WI5A 3VY8X 2K4TA 1GFPA 4D64A 4AUIA 5DL6A 4BUMX 5FVNA 3JTYA 2OMFA 1GFNA 5JDPA 2ZLDA 1GFMA 1BT9A 3UPGA 1HXTA 3A2SX 2XE3A 1OSMA 3T20A 1H6S1 2Y0KA 3VZUX 2FGRA 4D65A 4FSOA 1HXUA 2XE1A 3VZTX 2QTKA 2O4VA 1MPFA 1PHOA 1OPFA 4C69X 3HWBA 3UU2A 4FMSA 3SY9A 4FT6A 4FOZA 2J1NA 2Y2XA 3T0SA 2ODJA 3EMNX 3VZWX 4FSPA 2XE5A 4KR8A 3SYBA 1PRNA 4LSEA 1HXXA 3T24A 3VY9X 2J4UP 3PRNA 2PRNA 4LSFA 3SZVA 3POQA 5PRNA 3O0EA 5DL5A 4KR4A 1E54A 2FGQX 4FRTA 4FRXA
chains in the Genus database with same CATH superfamily
2XG6A 4UB6O 4RJWA 5DL8A 3NSGA 2R4LA 5DL7A 4GCSA 3AAEA 1BH3A 2MHLA 4C00A 4F4BA 1ZHTA 5G38A 3HOEA 4AYID 5ADXL 2WVPA 2R4PA 1QJ9A 2Y0LA 3AA1B 3LK2A 2JQYA 3WI4A 2LFUA 4GCQA 4IL6O 3VE1A 2PORA 6PRNA 5G39A 2WJQA 2KDYA 4AYMC 3QRCA 3DA3A 3POUA 4RJXA 2AXTO 2X27X 1QJ8A 3FYXA 4E1TA 4LSIA 3TZGA 4AYDC 3VE2A 3AA1A 3LK2B 2LHFA 5KAIO 4G76A 4KRAA 2R89A 2XE2A 3KZIO 5B66O 5KAFO 2ZFGA 3KVDD 4JFBA 3LK3B 4AYNA 2KXPB 3RBHA 4AZLA 4LSHA 2M07A 5AFUL 1ORMA 2Y7SA 3UAQA 4GCPA 3HW9A 4CTDA 1GFQA 3V8UA 3SZDA 5IYUA 4O4XA 3BRZA 3SYSA 3PQSA 2ERVA 4K3CA 3SY7A 5B5EO 3HOLA 3K19A 4N58A 1GFOA 1Q9FA 2Y0HA 4RL9A 4D5UA 8PRNA 3JCUO 3AA0A 4RLCA 1IZNA 4G75A 1G90A 3PORA 3POXA 4GF4A 7PRNA 3AAEB 3AA6A 4N74A 5D5DA 2KZ7A 2W80C 1Q9GA 5G3AA 3AAAB 2YNKA 1QJPA 2R8AA 4N59A 3VY8X 3WI5A 2K4TA 3AAAA 1GFPA 2WJRA 3DWOX 4D64A 3PGSA 4AUIA 3PQUA 3G7GA 5DL6A 1T1LA 2F1TA 1ZHWA 4AFKA 2N2LA 2X9KA 4BUMX 5FVNA 3JTYA 3AA0B 2OMFA 1GFNA 3DZMA 2IWWA 5JDPA 3PGRA 2ZLDA 1GFMA 4B61A 4O49A 1BT9A 4AKMA 4O3XB 4Z3TA 1BXWA 1HXTA 3UPGA 3A2SX 1ZHYA 4K3BA 2XE3A 5E79O 1ZHXA 4FZLA 1MM5A 3A0HO 1OSMA 4GHBA 4AKRA 3T20A 3LK3A 2XTQA 1H6S1 4O3ZA 2F1VA 2JMMA 2Y0KA 3C5OA 3A0BO 5G26A 3PGUA 3VZUX 2FGRA 4D65A 4FSOA 4FESA 5GTIO 1HXUA 3WU2O 1S5LO 2XE1A 3VZTX 2M06A 3QRAA 3DWNA 4FUVA 3BS0A 2QTKA 2O4VA 2N2MA 4PUXA 3AA6B 2XTRA 1MPFA 1PHOA 1OPFA 2R88A 2XMXA 2W81C 4RLBA 4C69X 1IZNB 4O3WA 3AA7B 3GP6A 5EE2A 4FZMA 2R4OA 3HWBA 4N75A 4FMSA 4QQ1A 3UU2A 4E1SA 4UB8O 2IWVA 3DA4A 3SY9A 4C4VA 4FT6A 4FOZA 5AFUK 1MM4A 4O3YA 4PJ0O 2J1NA 5T5FA 5GV0A 2YPVA 2Y2XA 2KZ7B 2KXPA 2ODJA 3T0SA 5TISO 1THQA 3EMNX 3VZWX 3LK42 4FSPA 4XNKA 2XE5A 4KR8A 3SYBA 1PRNA 3NJTA 1T16A 4AKRB 4LSEA 1YS5A 2GE4A 1HXXA 3T24A 4C4VB 3LK41 3VY9X 2J4UP 3BRYA 2PRNA 3PRNA 4LSFA 3PF1A 4XNLA 3POQA 4FZNA 2KC0A 5PRNA 3SZVA 2MNHA 3O0EA 5GTHO 3AA7A 2K0LA 4U9CA 4AYEC 2R4NA 1ZHZA 4O4UA 5ADXK 2F1CX 4JCHA 4FQEA 4PR7A 4KR4A 1P4TA 5DL5A 1E54A 5H2FO 2FGQX 4FRTA 4FRXA
chains in the Genus database with same CATH topology
2XG6A 4RJWA 5DL8A 3NSGA 5DL7A 4GCSA 3AAEA 1BH3A 2MHLA 4F4BA 1ZHTA 3HOEA 4AYID 5ADXL 2Y0LA 1QJ9A 3AA1B 3LK2A 3WI4A 2LFUA 4GCQA 3VE1A 2PORA 6PRNA 2KDYA 4AYMC 3QRCA 3DA3A 3POUA 4RJXA 2X27X 1QJ8A 3FYXA 4E1TA 4LSIA 3TZGA 4AYDC 3VE2A 3AA1A 3LK2B 2LHFA 4G76A 4KRAA 2XE2A 2ZFGA 3KVDD 4JFBA 3LK3B 4AYNA 2KXPB 3RBHA 4AZLA 4LSHA 2M07A 5AFUL 1ORMA 2Y7SA 3UAQA 4GCPA 3HW9A 1GFQA 3V8UA 3SZDA 5IYUA 4O4XA 3SYSA 3PQSA 2ERVA 3SY7A 3HOLA 3K19A 4N58A 1GFOA 1Q9FA 2Y0HA 4RL9A 4D5UA 8PRNA 3AA0A 4RLCA 1IZNA 4G75A 1G90A 3PORA 3POXA 4GF4A 7PRNA 3AAEB 3AA6A 5D5DA 2KZ7A 2W80C 1Q9GA 3AAAB 2YNKA 1QJPA 4N59A 3VY8X 3WI5A 2K4TA 3AAAA 1GFPA 4D64A 4AUIA 3PQUA 3G7GA 5DL6A 2F1TA 1ZHWA 4AFKA 2N2LA 4BUMX 5FVNA 3JTYA 3AA0B 2OMFA 1GFNA 5JDPA 2ZLDA 1GFMA 4B61A 4O49A 1BT9A 4AKMA 4O3XB 4Z3TA 1BXWA 1HXTA 3UPGA 3A2SX 1ZHYA 2XE3A 1ZHXA 4FZLA 1MM5A 1OSMA 4GHBA 4AKRA 3T20A 3LK3A 2XTQA 1H6S1 4O3ZA 2F1VA 2JMMA 2Y0KA 3C5OA 5G26A 3VZUX 2FGRA 4D65A 4FSOA 4FESA 1HXUA 2XE1A 3VZTX 2M06A 3QRAA 4FUVA 2QTKA 2O4VA 2N2MA 4PUXA 3AA6B 2XTRA 1MPFA 1PHOA 1OPFA 2XMXA 2W81C 4RLBA 4C69X 1IZNB 4O3WA 3AA7B 3GP6A 5EE2A 4FZMA 4E1SA 3HWBA 3UU2A 4FMSA 4QQ1A 3DA4A 3SY9A 4FT6A 4FOZA 5AFUK 1MM4A 4O3YA 5T5FA 2J1NA 5GV0A 2YPVA 2Y2XA 2KZ7B 2KXPA 2ODJA 3T0SA 1THQA 3EMNX 3VZWX 3LK42 4FSPA 4XNKA 2XE5A 4KR8A 3SYBA 1PRNA 4AKRB 4LSEA 1YS5A 2GE4A 1HXXA 3T24A 3LK41 3VY9X 2J4UP 3PRNA 2PRNA 4LSFA 4XNLA 3SZVA 3POQA 4FZNA 2KC0A 5PRNA 2MNHA 3O0EA 3AA7A 2K0LA 4U9CA 4AYEC 1ZHZA 4O4UA 5ADXK 5DL5A 4JCHA 4KR4A 1P4TA 1E54A 2FGQX 4FRTA 4FRXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XG6 A;  4RJW A;  5DL8 A;  3NSG A;  5DL7 A;  4GCS A;  1BH3 A;  2Y0L A;  3WI4 A;  4GCQ A;  2POR A;  6PRN A;  3POU A;  4RJX A;  3FYX A;  4LSI A;  4KRA A;  2XE2 A;  2ZFG A;  4JFB A;  4LSH A;  4GCP A;  3HW9 A;  1GFQ A;  3SZD A;  3SYS A;  3SY7 A;  3K19 A;  8PRN A;  4D5U A;  1GFO A;  2Y0H A;  3POR A;  3POX A;  7PRN A;  3WI5 A;  3VY8 X;  2K4T A;  1GFP A;  4D64 A;  4AUI A;  5DL6 A;  4BUM X;  5FVN A;  3JTY A;  2OMF A;  1GFN A;  5JDP A;  2ZLD A;  1GFM A;  1BT9 A;  3UPG A;  1HXT A;  3A2S X;  2XE3 A;  1OSM A;  3T20 A;  1H6S 1;  2Y0K A;  3VZU X;  2FGR A;  4D65 A;  4FSO A;  1HXU A;  2XE1 A;  3VZT X;  2QTK A;  2O4V A;  1MPF A;  1PHO A;  1OPF A;  4C69 X;  3HWB A;  3UU2 A;  4FMS A;  3SY9 A;  4FT6 A;  4FOZ A;  2J1N A;  2Y2X A;  3T0S A;  2ODJ A;  3EMN X;  3VZW X;  4FSP A;  2XE5 A;  4KR8 A;  3SYB A;  1PRN A;  4LSE A;  1HXX A;  3T24 A;  3VY9 X;  2J4U P;  3PRN A;  2PRN A;  4LSF A;  3SZV A;  3POQ A;  5PRN A;  3O0E A;  5DL5 A;  4KR4 A;  1E54 A;  2FGQ X;  4FRT A;  4FRX A; 
#chains in the Genus database with same CATH topology
 2XG6 A;  4UB6 O;  4RJW A;  5DL8 A;  3NSG A;  2R4L A;  5DL7 A;  4GCS A;  3AAE A;  1BH3 A;  2MHL A;  4C00 A;  4F4B A;  1ZHT A;  5G38 A;  3HOE A;  4AYI D;  5ADX L;  2WVP A;  2R4P A;  1QJ9 A;  2Y0L A;  3AA1 B;  3LK2 A;  2JQY A;  3WI4 A;  2LFU A;  4GCQ A;  4IL6 O;  3VE1 A;  2POR A;  6PRN A;  5G39 A;  2WJQ A;  2KDY A;  4AYM C;  3QRC A;  3DA3 A;  3POU A;  4RJX A;  2AXT O;  2X27 X;  1QJ8 A;  3FYX A;  4E1T A;  4LSI A;  3TZG A;  4AYD C;  3VE2 A;  3AA1 A;  3LK2 B;  2LHF A;  5KAI O;  4G76 A;  4KRA A;  2R89 A;  2XE2 A;  3KZI O;  5B66 O;  5KAF O;  2ZFG A;  3KVD D;  4JFB A;  3LK3 B;  4AYN A;  2KXP B;  3RBH A;  4AZL A;  4LSH A;  2M07 A;  5AFU L;  1ORM A;  2Y7S A;  3UAQ A;  4GCP A;  3HW9 A;  4CTD A;  1GFQ A;  3V8U A;  3SZD A;  5IYU A;  4O4X A;  3BRZ A;  3SYS A;  3PQS A;  2ERV A;  4K3C A;  3SY7 A;  5B5E O;  3HOL A;  3K19 A;  4N58 A;  1GFO A;  1Q9F A;  2Y0H A;  4RL9 A;  4D5U A;  8PRN A;  3JCU O;  3AA0 A;  4RLC A;  1IZN A;  4G75 A;  1G90 A;  3POR A;  3POX A;  4GF4 A;  7PRN A;  3AAE B;  3AA6 A;  4N74 A;  5D5D A;  2KZ7 A;  2W80 C;  1Q9G A;  5G3A A;  3AAA B;  2YNK A;  1QJP A;  2R8A A;  4N59 A;  3VY8 X;  3WI5 A;  2K4T A;  3AAA A;  1GFP A;  2WJR A;  3DWO X;  4D64 A;  3PGS A;  4AUI A;  3PQU A;  3G7G A;  5DL6 A;  1T1L A;  2F1T A;  1ZHW A;  4AFK A;  2N2L A;  2X9K A;  4BUM X;  5FVN A;  3JTY A;  3AA0 B;  2OMF A;  1GFN A;  3DZM A;  2IWW A;  5JDP A;  3PGR A;  2ZLD A;  1GFM A;  4B61 A;  4O49 A;  1BT9 A;  4AKM A;  4O3X B;  4Z3T A;  1BXW A;  1HXT A;  3UPG A;  3A2S X;  1ZHY A;  4K3B A;  2XE3 A;  5E79 O;  1ZHX A;  4FZL A;  1MM5 A;  3A0H O;  1OSM A;  4GHB A;  4AKR A;  3T20 A;  3LK3 A;  2XTQ A;  1H6S 1;  4O3Z A;  2F1V A;  2JMM A;  2Y0K A;  3C5O A;  3A0B O;  5G26 A;  3PGU A;  3VZU X;  2FGR A;  4D65 A;  4FSO A;  4FES A;  5GTI O;  1HXU A;  3WU2 O;  1S5L O;  2XE1 A;  3VZT X;  2M06 A;  3QRA A;  3DWN A;  4FUV A;  3BS0 A;  2QTK A;  2O4V A;  2N2M A;  4PUX A;  3AA6 B;  2XTR A;  1MPF A;  1PHO A;  1OPF A;  2R88 A;  2XMX A;  2W81 C;  4RLB A;  4C69 X;  1IZN B;  4O3W A;  3AA7 B;  3GP6 A;  5EE2 A;  4FZM A;  2R4O A;  3HWB A;  4N75 A;  4FMS A;  4QQ1 A;  3UU2 A;  4E1S A;  4UB8 O;  2IWV A;  3DA4 A;  3SY9 A;  4C4V A;  4FT6 A;  4FOZ A;  5AFU K;  1MM4 A;  4O3Y A;  4PJ0 O;  2J1N A;  5T5F A;  5GV0 A;  2YPV A;  2Y2X A;  2KZ7 B;  2KXP A;  2ODJ A;  3T0S A;  5TIS O;  1THQ A;  3EMN X;  3VZW X;  3LK4 2;  4FSP A;  4XNK A;  2XE5 A;  4KR8 A;  3SYB A;  1PRN A;  3NJT A;  1T16 A;  4AKR B;  4LSE A;  1YS5 A;  2GE4 A;  1HXX A;  3T24 A;  4C4V B;  3LK4 1;  3VY9 X;  2J4U P;  3BRY A;  2PRN A;  3PRN A;  4LSF A;  3PF1 A;  4XNL A;  3POQ A;  4FZN A;  2KC0 A;  5PRN A;  3SZV A;  2MNH A;  3O0E A;  5GTH O;  3AA7 A;  2K0L A;  4U9C A;  4AYE C;  2R4N A;  1ZHZ A;  4O4U A;  5ADX K;  2F1C X;  4JCH A;  4FQE A;  4PR7 A;  4KR4 A;  1P4T A;  5DL5 A;  1E54 A;  5H2F O;  2FGQ X;  4FRT A;  4FRX A; 
#chains in the Genus database with same CATH homology
 2XG6 A;  4RJW A;  5DL8 A;  3NSG A;  5DL7 A;  4GCS A;  3AAE A;  1BH3 A;  2MHL A;  4F4B A;  1ZHT A;  3HOE A;  4AYI D;  5ADX L;  2Y0L A;  1QJ9 A;  3AA1 B;  3LK2 A;  3WI4 A;  2LFU A;  4GCQ A;  3VE1 A;  2POR A;  6PRN A;  2KDY A;  4AYM C;  3QRC A;  3DA3 A;  3POU A;  4RJX A;  2X27 X;  1QJ8 A;  3FYX A;  4E1T A;  4LSI A;  3TZG A;  4AYD C;  3VE2 A;  3AA1 A;  3LK2 B;  2LHF A;  4G76 A;  4KRA A;  2XE2 A;  2ZFG A;  3KVD D;  4JFB A;  3LK3 B;  4AYN A;  2KXP B;  3RBH A;  4AZL A;  4LSH A;  2M07 A;  5AFU L;  1ORM A;  2Y7S A;  3UAQ A;  4GCP A;  3HW9 A;  1GFQ A;  3V8U A;  3SZD A;  5IYU A;  4O4X A;  3SYS A;  3PQS A;  2ERV A;  3SY7 A;  3HOL A;  3K19 A;  4N58 A;  1GFO A;  1Q9F A;  2Y0H A;  4RL9 A;  4D5U A;  8PRN A;  3AA0 A;  4RLC A;  1IZN A;  4G75 A;  1G90 A;  3POR A;  3POX A;  4GF4 A;  7PRN A;  3AAE B;  3AA6 A;  5D5D A;  2KZ7 A;  2W80 C;  1Q9G A;  3AAA B;  2YNK A;  1QJP A;  4N59 A;  3VY8 X;  3WI5 A;  2K4T A;  3AAA A;  1GFP A;  4D64 A;  4AUI A;  3PQU A;  3G7G A;  5DL6 A;  2F1T A;  1ZHW A;  4AFK A;  2N2L A;  4BUM X;  5FVN A;  3JTY A;  3AA0 B;  2OMF A;  1GFN A;  5JDP A;  2ZLD A;  1GFM A;  4B61 A;  4O49 A;  1BT9 A;  4AKM A;  4O3X B;  4Z3T A;  1BXW A;  1HXT A;  3UPG A;  3A2S X;  1ZHY A;  2XE3 A;  1ZHX A;  4FZL A;  1MM5 A;  1OSM A;  4GHB A;  4AKR A;  3T20 A;  3LK3 A;  2XTQ A;  1H6S 1;  4O3Z A;  2F1V A;  2JMM A;  2Y0K A;  3C5O A;  5G26 A;  3VZU X;  2FGR A;  4D65 A;  4FSO A;  4FES A;  1HXU A;  2XE1 A;  3VZT X;  2M06 A;  3QRA A;  4FUV A;  2QTK A;  2O4V A;  2N2M A;  4PUX A;  3AA6 B;  2XTR A;  1MPF A;  1PHO A;  1OPF A;  2XMX A;  2W81 C;  4RLB A;  4C69 X;  1IZN B;  4O3W A;  3AA7 B;  3GP6 A;  5EE2 A;  4FZM A;  4E1S A;  3HWB A;  3UU2 A;  4FMS A;  4QQ1 A;  3DA4 A;  3SY9 A;  4FT6 A;  4FOZ A;  5AFU K;  1MM4 A;  4O3Y A;  5T5F A;  2J1N A;  5GV0 A;  2YPV A;  2Y2X A;  2KZ7 B;  2KXP A;  2ODJ A;  3T0S A;  1THQ A;  3EMN X;  3VZW X;  3LK4 2;  4FSP A;  4XNK A;  2XE5 A;  4KR8 A;  3SYB A;  1PRN A;  4AKR B;  4LSE A;  1YS5 A;  2GE4 A;  1HXX A;  3T24 A;  3LK4 1;  3VY9 X;  2J4U P;  3PRN A;  2PRN A;  4LSF A;  4XNL A;  3SZV A;  3POQ A;  4FZN A;  2KC0 A;  5PRN A;  2MNH A;  3O0E A;  3AA7 A;  2K0L A;  4U9C A;  4AYE C;  1ZHZ A;  4O4U A;  5ADX K;  5DL5 A;  4JCH A;  4KR4 A;  1P4T A;  1E54 A;  2FGQ X;  4FRT A;  4FRX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...