1HXXA

Ompf porin mutant y106f
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
340
structure length
340
Chain Sequence
b'AEIYNKDGNKVDLYGKAVGLHYFSKGNGENSYGGNGDMTYARLGFKGETQINSDLTGYGQWEYNFQGNNSEGADAQTGNKTRLAFAGLKYADVGSFDYGRNYGVVFDALGYTDMLPEFGGDTAYSDDFFVGRVGGVATYRNSNFFGLVDGLNFAVQYLGKNERDTARRSNGDGVGGSISYEYEGFGIVGAYGAADRTNLQEAQPLGNGKKAEQWATGLKYDANNIYLAANYGETRNATPITNKFTNTSGFANKTQDVLLVAQYQFDFGLRPSIAYTKSKAKDVEGIGDVDLVNYFEVGATYYFNKNMSTYVDYIINQIDSDNKLGVGSDDTVAVGIVYQF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords OUTER MEMBRANE PROTEIN F
publication title Role of charged residues at the OmpF porin channel constriction probed by mutagenesis and simulation.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Membrane protein
total genus 104
structure length 340
sequence length 340
ec nomenclature
pdb deposition date 2001-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00267 Porin_1 Gram-negative porin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 1hxxA00
2J1NA 4KR4A 2OMFA 2ZFGA 4KR8A 4D5UA 4RJXA 4LSHA 2K4TA 4BUMX 2Y0KA 3HWBA 1E54A 3NSGA 2Y2XA 2Y0HA 2Y0LA 3UPGA 1GFOA 3HW9A 3SY9A 1PHOA 2PRNA 1GFNA 2ZLDA 3UU2A 4LSEA 4KRAA 5DL6A 5PRNA 3O0EA 4AUIA 4LSIA 3WI4A 3PORA 3POUA 1OPFA 4GCSA 2XE5A 1HXXA 5DL8A 3POQA 2XG6A 1PRNA 3VY8X 1GFMA 4FOZA 1HXUA 2XE3A 4FSOA 3JTYA 3VZUX 3WI5A 1BT9A 2XE2A 4FSPA 4FRTA 3T0SA 3T24A 5DL7A 4GCQA 5FVNA 2XE1A 3VY9X 1H6S1 5DL5A 4RJWA 1BH3A 4D65A 3VZTX 2FGQX 4LSFA 2O4VA 2J4UP 4FMSA 3SZVA 1GFPA 3SYSA 1OSMA 6PRNA 7PRNA 3PRNA 2QTKA 3EMNX 1MPFA 8PRNA 4FRXA 2ODJA 1GFQA 3FYXA 4GCPA 2PORA 1HXTA 3POXA 3SYBA 3T20A 4FT6A 3K19A 3SY7A 4JFBA 3VZWX 4D64A 3A2SX 3SZDA 5JDPA 2FGRA 4C69X
chains in the Genus database with same CATH superfamily
3PF1A 4UB8O 2J1NA 4XNKA 4C00A 5AFUK 5H2FO 4KR4A 2JQYA 3BRZA 2WJRA 2OMFA 3WU2O 2ZFGA 3V8UA 4KR8A 5G3AA 2KDYA 5GTHO 4JCHA 2ERVA 4D5UA 4RJXA 3BS0A 4LSHA 3DWOX 3AAAB 2K4TA 2JMMA 3KZIO 3AA6B 1P4TA 4BUMX 2WVPA 2Y0KA 3HWBA 2MNHA 3C5OA 2W80C 4N58A 1E54A 2F1CX 2IWVA 5TISO 3NSGA 2Y2XA 3AA1B 3GP6A 1ZHTA 2KZ7B 2Y0HA 2Y0LA 3NJTA 4N75A 1GFOA 4C4VB 3UPGA 3HW9A 5JDPA 3SY9A 1PHOA 1THQA 4O3WA 4O3ZA 5T5FA 2Y7SA 2PRNA 2X9KA 3PGUA 1QJ9A 4G75A 1GFNA 1Q9GA 2ZLDA 3UU2A 4F4BA 3HOEA 4O49A 1T16A 4LSEA 1Q9FA 4KRAA 2M07A 4UB6O 1IZNB 5E79O 2R4LA 5DL6A 5PRNA 1MM4A 3JCUO 5D5DA 3O0EA 4AKRB 4AUIA 2R88A 4C69X 3A0HO 2R4OA 3AA7A 4LSIA 2LHFA 4AFKA 2WJQA 3TZGA 4AYDC 5ADXK 2AXTO 4PUXA 3WI4A 5G39A 4FZMA 1QJ8A 5AFUL 4CTDA 4GF4A 3LK42 4RL9A 3PORA 5KAFO 1BXWA 2K0LA 3POUA 1OPFA 2W81C 2LFUA 4O3YA 3RBHA 4Z3TA 3BRYA 2J4UP 4K3CA 3HOLA 4RLCA 5ADXL 3G7GA 4GCSA 4K3BA 2XE5A 3LK3A 4AZLA 1HXXA 5G38A 2MHLA 3LK2A 5DL8A 3POQA 3AA0A 1PRNA 1QJPA 2KXPA 2N2LA 2XG6A 4AYMC 3VY8X 1GFMA 4FOZA 1MM5A 3KVDD 2R89A 5KAIO 3AAEA 4O3XB 4AYEC 1HXUA 4QQ1A 2XE3A 1T1LA 2YNKA 2R4NA 4FSOA 3JTYA 3VZUX 3LK41 1BT9A 2XE2A 1ZHXA 4FSPA 3VE2A 4FRTA 3WI5A 2GE4A 3LK3B 2XMXA 3DA4A 4E1SA 3T0SA 1G90A 3T24A 5DL7A 4FUVA 3AAAA 3AA0B 4GCQA 5FVNA 3AA6A 4RLBA 2XE1A 3VY9X 5GV0A 1H6S1 5DL5A 4B61A 3PQSA 4RJWA 1BH3A 4D65A 5IYUA 2F1VA 2FGQX 3DZMA 4LSFA 2O4VA 3AA1A 5G26A 1ZHWA 3VZTX 2KZ7A 2R4PA 1S5LO 3DA3A 3PGSA 2X27X 3AA7B 4FMSA 3SZVA 3VE1A 1GFPA 3SYSA 4C4VA 1OSMA 6PRNA 2XTRA 4GHBA 7PRNA 2IWWA 3PRNA 2QTKA 3EMNX 1MPFA 4AYID 3DWNA 8PRNA 4FRXA 2ODJA 1GFQA 3FYXA 4GCPA 2PORA 4IL6O 3UAQA 1IZNA 5EE2A 2R8AA 4PR7A 2YPVA 4FZNA 4PJ0O 4FZLA 1ORMA 4AKRA 3PQUA 3QRCA 4G76A 1HXTA 3POXA 3SYBA 5B5EO 3PGRA 3T20A 2F1TA 3A0BO 4AKMA 4FT6A 4FQEA 4O4UA 4AYNA 4O4XA 3LK2B 5GTIO 2KXPB 4N74A 4FESA 2KC0A 3K19A 3SY7A 4JFBA 3QRAA 4E1TA 2N2MA 4XNLA 3VZWX 4D64A 2M06A 1YS5A 1ZHYA 3A2SX 3SZDA 3AAEB 4U9CA 1ZHZA 5B66O 4N59A 2FGRA 2XTQA
chains in the Genus database with same CATH topology
5AFUK 4XNKA 2J1NA 4KR4A 2OMFA 2ZFGA 3V8UA 4KR8A 2KDYA 4JCHA 2ERVA 4D5UA 4RJXA 4LSHA 3AAAB 2K4TA 2JMMA 3AA6B 1P4TA 4BUMX 2Y0KA 3HWBA 2MNHA 3C5OA 2W80C 4N58A 1E54A 3NSGA 2Y2XA 3AA1B 3GP6A 1ZHTA 2KZ7B 2Y0HA 2Y0LA 3UPGA 1GFOA 3HW9A 5JDPA 3SY9A 1PHOA 1THQA 4O3WA 4O3ZA 5T5FA 2Y7SA 2PRNA 1QJ9A 4G75A 1GFNA 1Q9GA 2ZLDA 3UU2A 4F4BA 3HOEA 4O49A 4LSEA 1Q9FA 4KRAA 2M07A 1IZNB 5DL6A 5PRNA 1MM4A 5D5DA 3O0EA 4AKRB 4AUIA 4C69X 3AA7A 4AFKA 4LSIA 2LHFA 3TZGA 4AYDC 5ADXK 3WI4A 4PUXA 4FZMA 1QJ8A 5AFUL 4GF4A 3LK42 4RL9A 3PORA 1BXWA 2K0LA 3POUA 1OPFA 2W81C 2LFUA 4O3YA 3RBHA 4Z3TA 3HOLA 4RLCA 5ADXL 3G7GA 4GCSA 4AZLA 2XE5A 3LK3A 1HXXA 2MHLA 3LK2A 5DL8A 3POQA 3AA0A 2XG6A 1QJPA 1PRNA 2KXPA 2N2LA 4AYMC 3VY8X 1GFMA 4FOZA 1MM5A 3KVDD 3AAEA 4O3XB 4AYEC 1HXUA 4QQ1A 2XE3A 2YNKA 4FSOA 3JTYA 3VZUX 3LK41 1BT9A 2XE2A 1ZHXA 4FSPA 3VE2A 4FRTA 3WI5A 2GE4A 3LK3B 2XMXA 3DA4A 4E1SA 3T0SA 1G90A 3T24A 5DL7A 4FUVA 3AAAA 3AA0B 4GCQA 5FVNA 3AA6A 4RLBA 2XE1A 3VY9X 5GV0A 1H6S1 5DL5A 4B61A 3PQSA 4RJWA 1BH3A 4D65A 5IYUA 2F1VA 2FGQX 4LSFA 5G26A 2O4VA 3AA1A 3VZTX 1ZHWA 4AYID 2KZ7A 3DA3A 3VE1A 2J4UP 2X27X 3AA7B 4FMSA 3SZVA 1GFPA 3SYSA 1OSMA 6PRNA 2XTRA 4GHBA 7PRNA 3PRNA 2QTKA 3EMNX 1MPFA 8PRNA 4FRXA 2ODJA 1GFQA 3FYXA 4GCPA 2PORA 3UAQA 1IZNA 5EE2A 2YPVA 4FZNA 4FZLA 1ORMA 4AKRA 3PQUA 3QRCA 4G76A 1HXTA 3POXA 3SYBA 3T20A 2F1TA 4AKMA 4FT6A 4O4UA 4AYNA 4O4XA 3LK2B 2KXPB 4FESA 2KC0A 3K19A 3SY7A 4JFBA 3QRAA 4E1TA 2N2MA 4XNLA 3VZWX 4D64A 2M06A 1YS5A 1ZHYA 3A2SX 3SZDA 3AAEB 4U9CA 1ZHZA 4N59A 2FGRA 2XTQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J1N A;  4KR4 A;  2OMF A;  2ZFG A;  4KR8 A;  4D5U A;  4RJX A;  4LSH A;  2K4T A;  4BUM X;  2Y0K A;  3HWB A;  1E54 A;  3NSG A;  2Y2X A;  2Y0H A;  2Y0L A;  3UPG A;  1GFO A;  3HW9 A;  3SY9 A;  1PHO A;  2PRN A;  1GFN A;  2ZLD A;  3UU2 A;  4LSE A;  4KRA A;  5DL6 A;  5PRN A;  3O0E A;  4AUI A;  4LSI A;  3WI4 A;  3POR A;  3POU A;  1OPF A;  4GCS A;  2XE5 A;  1HXX A;  5DL8 A;  3POQ A;  2XG6 A;  1PRN A;  3VY8 X;  1GFM A;  4FOZ A;  1HXU A;  2XE3 A;  4FSO A;  3JTY A;  3VZU X;  3WI5 A;  1BT9 A;  2XE2 A;  4FSP A;  4FRT A;  3T0S A;  3T24 A;  5DL7 A;  4GCQ A;  5FVN A;  2XE1 A;  3VY9 X;  1H6S 1;  5DL5 A;  4RJW A;  1BH3 A;  4D65 A;  3VZT X;  2FGQ X;  4LSF A;  2O4V A;  2J4U P;  4FMS A;  3SZV A;  1GFP A;  3SYS A;  1OSM A;  6PRN A;  7PRN A;  3PRN A;  2QTK A;  3EMN X;  1MPF A;  8PRN A;  4FRX A;  2ODJ A;  1GFQ A;  3FYX A;  4GCP A;  2POR A;  1HXT A;  3POX A;  3SYB A;  3T20 A;  4FT6 A;  3K19 A;  3SY7 A;  4JFB A;  3VZW X;  4D64 A;  3A2S X;  3SZD A;  5JDP A;  2FGR A;  4C69 X; 
#chains in the Genus database with same CATH topology
 3PF1 A;  4UB8 O;  2J1N A;  4XNK A;  4C00 A;  5AFU K;  5H2F O;  4KR4 A;  2JQY A;  3BRZ A;  2WJR A;  2OMF A;  3WU2 O;  2ZFG A;  3V8U A;  4KR8 A;  5G3A A;  2KDY A;  5GTH O;  4JCH A;  2ERV A;  4D5U A;  4RJX A;  3BS0 A;  4LSH A;  3DWO X;  3AAA B;  2K4T A;  2JMM A;  3KZI O;  3AA6 B;  1P4T A;  4BUM X;  2WVP A;  2Y0K A;  3HWB A;  2MNH A;  3C5O A;  2W80 C;  4N58 A;  1E54 A;  2F1C X;  2IWV A;  5TIS O;  3NSG A;  2Y2X A;  3AA1 B;  3GP6 A;  1ZHT A;  2KZ7 B;  2Y0H A;  2Y0L A;  3NJT A;  4N75 A;  1GFO A;  4C4V B;  3UPG A;  3HW9 A;  5JDP A;  3SY9 A;  1PHO A;  1THQ A;  4O3W A;  4O3Z A;  5T5F A;  2Y7S A;  2PRN A;  2X9K A;  3PGU A;  1QJ9 A;  4G75 A;  1GFN A;  1Q9G A;  2ZLD A;  3UU2 A;  4F4B A;  3HOE A;  4O49 A;  1T16 A;  4LSE A;  1Q9F A;  4KRA A;  2M07 A;  4UB6 O;  1IZN B;  5E79 O;  2R4L A;  5DL6 A;  5PRN A;  1MM4 A;  3JCU O;  5D5D A;  3O0E A;  4AKR B;  4AUI A;  2R88 A;  4C69 X;  3A0H O;  2R4O A;  3AA7 A;  4LSI A;  2LHF A;  4AFK A;  2WJQ A;  3TZG A;  4AYD C;  5ADX K;  2AXT O;  4PUX A;  3WI4 A;  5G39 A;  4FZM A;  1QJ8 A;  5AFU L;  4CTD A;  4GF4 A;  3LK4 2;  4RL9 A;  3POR A;  5KAF O;  1BXW A;  2K0L A;  3POU A;  1OPF A;  2W81 C;  2LFU A;  4O3Y A;  3RBH A;  4Z3T A;  3BRY A;  2J4U P;  4K3C A;  3HOL A;  4RLC A;  5ADX L;  3G7G A;  4GCS A;  4K3B A;  2XE5 A;  3LK3 A;  4AZL A;  1HXX A;  5G38 A;  2MHL A;  3LK2 A;  5DL8 A;  3POQ A;  3AA0 A;  1PRN A;  1QJP A;  2KXP A;  2N2L A;  2XG6 A;  4AYM C;  3VY8 X;  1GFM A;  4FOZ A;  1MM5 A;  3KVD D;  2R89 A;  5KAI O;  3AAE A;  4O3X B;  4AYE C;  1HXU A;  4QQ1 A;  2XE3 A;  1T1L A;  2YNK A;  2R4N A;  4FSO A;  3JTY A;  3VZU X;  3LK4 1;  1BT9 A;  2XE2 A;  1ZHX A;  4FSP A;  3VE2 A;  4FRT A;  3WI5 A;  2GE4 A;  3LK3 B;  2XMX A;  3DA4 A;  4E1S A;  3T0S A;  1G90 A;  3T24 A;  5DL7 A;  4FUV A;  3AAA A;  3AA0 B;  4GCQ A;  5FVN A;  3AA6 A;  4RLB A;  2XE1 A;  3VY9 X;  5GV0 A;  1H6S 1;  5DL5 A;  4B61 A;  3PQS A;  4RJW A;  1BH3 A;  4D65 A;  5IYU A;  2F1V A;  2FGQ X;  3DZM A;  4LSF A;  2O4V A;  3AA1 A;  5G26 A;  1ZHW A;  3VZT X;  2KZ7 A;  2R4P A;  1S5L O;  3DA3 A;  3PGS A;  2X27 X;  3AA7 B;  4FMS A;  3SZV A;  3VE1 A;  1GFP A;  3SYS A;  4C4V A;  1OSM A;  6PRN A;  2XTR A;  4GHB A;  7PRN A;  2IWW A;  3PRN A;  2QTK A;  3EMN X;  1MPF A;  4AYI D;  3DWN A;  8PRN A;  4FRX A;  2ODJ A;  1GFQ A;  3FYX A;  4GCP A;  2POR A;  4IL6 O;  3UAQ A;  1IZN A;  5EE2 A;  2R8A A;  4PR7 A;  2YPV A;  4FZN A;  4PJ0 O;  4FZL A;  1ORM A;  4AKR A;  3PQU A;  3QRC A;  4G76 A;  1HXT A;  3POX A;  3SYB A;  5B5E O;  3PGR A;  3T20 A;  2F1T A;  3A0B O;  4AKM A;  4FT6 A;  4FQE A;  4O4U A;  4AYN A;  4O4X A;  3LK2 B;  5GTI O;  2KXP B;  4N74 A;  4FES A;  2KC0 A;  3K19 A;  3SY7 A;  4JFB A;  3QRA A;  4E1T A;  2N2M A;  4XNL A;  3VZW X;  4D64 A;  2M06 A;  1YS5 A;  1ZHY A;  3A2S X;  3SZD A;  3AAE B;  4U9C A;  1ZHZ A;  5B66 O;  4N59 A;  2FGR A;  2XTQ A; 
#chains in the Genus database with same CATH homology
 5AFU K;  4XNK A;  2J1N A;  4KR4 A;  2OMF A;  2ZFG A;  3V8U A;  4KR8 A;  2KDY A;  4JCH A;  2ERV A;  4D5U A;  4RJX A;  4LSH A;  3AAA B;  2K4T A;  2JMM A;  3AA6 B;  1P4T A;  4BUM X;  2Y0K A;  3HWB A;  2MNH A;  3C5O A;  2W80 C;  4N58 A;  1E54 A;  3NSG A;  2Y2X A;  3AA1 B;  3GP6 A;  1ZHT A;  2KZ7 B;  2Y0H A;  2Y0L A;  3UPG A;  1GFO A;  3HW9 A;  5JDP A;  3SY9 A;  1PHO A;  1THQ A;  4O3W A;  4O3Z A;  5T5F A;  2Y7S A;  2PRN A;  1QJ9 A;  4G75 A;  1GFN A;  1Q9G A;  2ZLD A;  3UU2 A;  4F4B A;  3HOE A;  4O49 A;  4LSE A;  1Q9F A;  4KRA A;  2M07 A;  1IZN B;  5DL6 A;  5PRN A;  1MM4 A;  5D5D A;  3O0E A;  4AKR B;  4AUI A;  4C69 X;  3AA7 A;  4AFK A;  4LSI A;  2LHF A;  3TZG A;  4AYD C;  5ADX K;  3WI4 A;  4PUX A;  4FZM A;  1QJ8 A;  5AFU L;  4GF4 A;  3LK4 2;  4RL9 A;  3POR A;  1BXW A;  2K0L A;  3POU A;  1OPF A;  2W81 C;  2LFU A;  4O3Y A;  3RBH A;  4Z3T A;  3HOL A;  4RLC A;  5ADX L;  3G7G A;  4GCS A;  4AZL A;  2XE5 A;  3LK3 A;  1HXX A;  2MHL A;  3LK2 A;  5DL8 A;  3POQ A;  3AA0 A;  2XG6 A;  1QJP A;  1PRN A;  2KXP A;  2N2L A;  4AYM C;  3VY8 X;  1GFM A;  4FOZ A;  1MM5 A;  3KVD D;  3AAE A;  4O3X B;  4AYE C;  1HXU A;  4QQ1 A;  2XE3 A;  2YNK A;  4FSO A;  3JTY A;  3VZU X;  3LK4 1;  1BT9 A;  2XE2 A;  1ZHX A;  4FSP A;  3VE2 A;  4FRT A;  3WI5 A;  2GE4 A;  3LK3 B;  2XMX A;  3DA4 A;  4E1S A;  3T0S A;  1G90 A;  3T24 A;  5DL7 A;  4FUV A;  3AAA A;  3AA0 B;  4GCQ A;  5FVN A;  3AA6 A;  4RLB A;  2XE1 A;  3VY9 X;  5GV0 A;  1H6S 1;  5DL5 A;  4B61 A;  3PQS A;  4RJW A;  1BH3 A;  4D65 A;  5IYU A;  2F1V A;  2FGQ X;  4LSF A;  5G26 A;  2O4V A;  3AA1 A;  3VZT X;  1ZHW A;  4AYI D;  2KZ7 A;  3DA3 A;  3VE1 A;  2J4U P;  2X27 X;  3AA7 B;  4FMS A;  3SZV A;  1GFP A;  3SYS A;  1OSM A;  6PRN A;  2XTR A;  4GHB A;  7PRN A;  3PRN A;  2QTK A;  3EMN X;  1MPF A;  8PRN A;  4FRX A;  2ODJ A;  1GFQ A;  3FYX A;  4GCP A;  2POR A;  3UAQ A;  1IZN A;  5EE2 A;  2YPV A;  4FZN A;  4FZL A;  1ORM A;  4AKR A;  3PQU A;  3QRC A;  4G76 A;  1HXT A;  3POX A;  3SYB A;  3T20 A;  2F1T A;  4AKM A;  4FT6 A;  4O4U A;  4AYN A;  4O4X A;  3LK2 B;  2KXP B;  4FES A;  2KC0 A;  3K19 A;  3SY7 A;  4JFB A;  3QRA A;  4E1T A;  2N2M A;  4XNL A;  3VZW X;  4D64 A;  2M06 A;  1YS5 A;  1ZHY A;  3A2S X;  3SZD A;  3AAE B;  4U9C A;  1ZHZ A;  4N59 A;  2FGR A;  2XTQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...