1HY7A

A carboxylic acid based inhibitor in complex with mmp3
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
168
structure length
162
Chain Sequence
b'FRTFPGIPKWRKTHLTYRIVNYTPDLPKDAVDSAVEKALKVWEEVTPLTFSRLYEGEADIMISFAVREHGDFYPFDGPGNVLAHAYAPGPGINGDAHFDDDEQWTKDTTGTNLFLVAAHEIGHSLGLFHSANTEALMYPLLTRFRLSQDDINGIQSLYGPPP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STROMELYSIN-1
publication title Development of new carboxylic acid-based MMP inhibitors derived from functionalized propargylglycines.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 45
structure length 162
sequence length 168
chains with identical sequence B
ec nomenclature ec 3.4.24.17: Stromelysin 1.
pdb deposition date 2001-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 1hy7A00
1BSWA 5B5OA 1L6JA 2OXUA 3O64A 2TCLA 1A85A 3L0VA 1YOUA 1H71P 1JIZA 3B92A 3Q2GA 4H82A 1JH1A 3GBOA 3NX7A 4Q1LA 4FVLA 4XM7A 3OHLA 3KWVC 2X3AA 1FM1A 5I12A 1BUDA 2A8HA 2OW9A 1RMZA 1XFVA 5B5PA 1B3DA 1IAEA 1YQYA 4L19A 1R54A 2L0RA 1IADA 3LK8A 2JNPA 2DW1A 1MMPA 2Y6DA 2W13A 1CIZA 3HY7A 4PKVA 1KUKA 2OI0A 1XFWA 1UMSA 3B8ZA 1GE7A 4GF1A 1G9KA 2FV5A 1FLSA 1HV5A 1MMBA 2D1NA 1HTDA 2OW0A 1C3IA 2WOAA 1G49A 1GO8P 1BIWA 4JQGA 3EHXA 3LKAA 1CGLA 2JT6A 2O36A 2DW2A 2OY4A 1Y8JA 1KAPP 1D8FA 5CXAA 1OS2A 4PKSA 4DPEA 4I03A 5D2BA 5D1UA 3KECA 1WNIA 4IN9A 1R55A 3ELMA 4JPAA 3EDHA 3K7NA 1AYKA 5D1TA 3EWJA 4ON1A 5I2ZA 3V96B 1UMTA 1PWWA 1CAQA 4GWNA 5BOTA 1HFCA 1D7XA 2FV9A 1CQRA 2OZRA 1CGFA 1ND1A 3HBVP 3LQ0A 2QPJA 4FXQA 1OM6A 4FU4A 2W0DA 3TSKA 1CXVA 2EROA 2I47A 2OVXA 3VTGA 1XURA 1I1IP 2ERPA 1I73A 4WF6A 5BPAA 3LIKA 3LJGA 1BQOA 2X7MA 3Q2HA 1DTHA 1OMJA 4XM6A 1GXDA 3G5CA 2MLSA 4AYKA 1ATLA 1ZVXA 2N8RA 1BZSA 1GE6A 3VI1A 1UTZA 2OXZA 4XBHA 3P1VA 1OS9A 1CK7A 1AF0A 2OVZA 1G12A 4XCTA 3DSLA 2O3EA 1JJ9A 2W15A 1QJJA 1ZXVA 1K7GA 2W14A 3F16A 1JAQA 2JIHA 1XFUA 1JIWP 3DNGA 3KMEA 1S4BP 4H1QA 3DL1A 1OM7A 2RJQA 3UVCA 1UTTA 1BQQM 1UEAA 1K7IA 2WO8A 1O0TA 2OW2A 3AYKA 5I4OA 1SRPA 1Q3AA 3O2XA 3KMCA 1BUVM 1ZXCA 3I7IA 3TT4A 3ZUKA 2MZEA 1EAKA 3WV2A 5BOYA 1BKCI 3USNA 1AKLA 5D1SA 1YP1A 1FBLA 3EDZA 4GR0A 1HY7A 1Y0VA 4CTHA 2V4BA 4HMAA 1GKDA 2YB9A 1XUCA 1BM6A 3AYUA 4JP4A 1C7KA 4ILWD 4PKRA 3LUMA 3HB2P 4GUYA 3LQBA 3N2VA 1CGEA 3OHOA 1XFXA 1QICA 1PWUA 4H2EA 4H49A 1Z3JA 3I7GA 1GKCA 1D8MA 4WK7A 1XFYA 3G42A 3ZVSA 2D1OA 3KEKA 3ZXHA 3HYGA 2DDFA 2W12A 3KRYA 4GWMA 2WO9A 1K7QA 1C8TA 4H76A 4WKEA 1IAGA 1KUFA 2J83A 1J7NA 3F15A 1BKCA 1SLNA 2X3BA 3U1RA 1YCMA 1SU3A 3LJZA 3DPEA 2JT5A 1DMTA 1D5JA 4WZVA 1GO7P 3CKIA 3LIRA 4DD8A 1GE5A 4H84A 4H3XA 5H8XA 1G4KA 3L0TA 3TVCA 2POJA 1MNCA 2PJTA 4L6TA 1SLMA 1QIBA 2ERQA 4A7BA 4DF9A 2E2DA 1O0QA 3RTTA 3TS4A 1IAAA 5L7FA 4R3VA 4ZR5A 1QUAA 3KEJA 3LEAA 3WV1A 5LABA 4GR8A 1ASTA 1R1HA 3F1AA 5I3MA 3DPFA 4A3WA 1PWVA 3WV3A 3LE9A 4IUWA 1MMRA 2JSDA 2CKIA 1ZS0A 4JA1A 1SMPA 2AYKA 1RM8A 4PKQA 1IACA 3LMCA 4IJOA 2AIGP 5L79A 2MZIA 1PWQA 4PKUA 3B2ZA 1XFZA 3LGPA 1KUIA 3HY9A 3EDGA 1JANA 4GQLA 4QKZA 3P24A 1PWPA 3RTSA 3EHYA 4HX3A 2OY2A 3HDBA 2YIGA 4WKIA 2SRTA 1ROSA 5I43A 1OM8A 4I35A 1JAOA 1ZTQA 2XS4A 5JMYA 1HOVA 2E3XA 1KUGA 2X3CA 1ZP5A 2DW0A 2USNA 1R1JA 5CZMA 1JK3A 4EFSA 2K9CA 3SHIA 1Y93A 2XS3A 830CA 1G05A 1HFSA 3K7LA 966CA 2DDYA 4AUOA 2J0TA 2OXWA 3AIGA 1BKCE 4GR3A 1USNA 1XUDA 3LILA 456CA 4PKTA 1SATA 3F18A 1IABA 3LUNA 2HU6A 3HBUP 1A86A 5CUHA 4PKWA 1QIAA 5I0LA 3LJTA 4G9LA 3N2UA 1R1IA 1KUHA 4L63A 3F17A 1EUBA 3HDAP 1MMQA 3DWBA 3BA0A 4J4MA 4AXQA 2CLTA 3F19A 2MZHA 1OO9A 2RJPA 2Z2DA 2K2GA 1JAPA 4DV8A 3E8RA 1B8YA 2OW1A 1QJIA 4H30A 5D3CA 4FXYP 4G0DA 1KBCA 4JIJA 2Y6CA 1I76A 3MA2A 4XM8A 4AIGA 3KHIA 1JKYA 3EDIA 1EB6A 2MLRA 2KRJA 5D7WA
chains in the Genus database with same CATH superfamily
1BSWA 5B5OA 1L6JA 2OXUA 3O64A 2TCLA 1A85A 3L0VA 1YOUA 1H71P 1JIZA 3B92A 3Q2GA 4H82A 1JH1A 3GBOA 3NX7A 4Q1LA 4FVLA 4XM7A 3OHLA 3KWVC 2X3AA 1FM1A 5I12A 1BUDA 2A8HA 2OW9A 1RMZA 1XFVA 5B5PA 1B3DA 1IAEA 1YQYA 4L19A 1R54A 2L0RA 1IADA 3LK8A 2JNPA 2DW1A 1MMPA 2Y6DA 2W13A 1CIZA 3HY7A 4PKVA 1KUKA 2OI0A 1XFWA 1UMSA 3B8ZA 1GE7A 4GF1A 1G9KA 2FV5A 1FLSA 1HV5A 1MMBA 2D1NA 1HTDA 2OW0A 1C3IA 2WOAA 1G49A 1GO8P 1BIWA 4JQGA 3EHXA 3LKAA 1CGLA 2JT6A 2O36A 2DW2A 2OY4A 1Y8JA 1KAPP 1D8FA 5CXAA 1OS2A 3DTKA 4PKSA 4DPEA 4I03A 5D2BA 5D1UA 1XAXA 3KECA 1WNIA 4IN9A 1R55A 3ELMA 4JPAA 3EDHA 3K7NA 1AYKA 5D1TA 3EWJA 4ON1A 5I2ZA 3V96B 1UMTA 1PWWA 1CAQA 4GWNA 5BOTA 1HFCA 1D7XA 2FV9A 1CQRA 2OZRA 1CGFA 1ND1A 3HBVP 3LQ0A 2QPJA 4FXQA 3DTEA 1OM6A 4FU4A 2W0DA 3TSKA 1CXVA 2EROA 2I47A 2OVXA 2YUFA 3VTGA 1XURA 1I1IP 2ERPA 1I73A 4WF6A 5BPAA 3LIKA 3LJGA 1BQOA 2X7MA 3Q2HA 1DTHA 1OMJA 4XM6A 1GXDA 3G5CA 2MLSA 4AYKA 1ATLA 1ZVXA 2N8RA 1BZSA 1GE6A 3VI1A 1UTZA 2OXZA 4XBHA 3P1VA 1OS9A 1CK7A 1AF0A 2OVZA 1G12A 4XCTA 3DSLA 2O3EA 1JJ9A 2W15A 1QJJA 1ZXVA 1K7GA 2W14A 3F16A 1JAQA 2JIHA 1XFUA 1JIWP 3DNGA 3KMEA 1S4BP 4H1QA 3DL1A 1OM7A 2RJQA 3UVCA 1UTTA 1BQQM 1UEAA 1K7IA 2WO8A 1O0TA 2OW2A 3AYKA 5I4OA 1SRPA 1Q3AA 3O2XA 3KMCA 1BUVM 1ZXCA 3I7IA 3TT4A 3ZUKA 2MZEA 1EAKA 3WV2A 5BOYA 1BKCI 3USNA 1AKLA 5D1SA 1YP1A 1FBLA 3EDZA 4GR0A 1HY7A 1Y0VA 4CTHA 2V4BA 4HMAA 1GKDA 1TVIA 2YB9A 1XUCA 1BM6A 3AYUA 4JP4A 1C7KA 4ILWD 4PKRA 3LUMA 3HB2P 4GUYA 3LQBA 3N2VA 1CGEA 3OHOA 1XM5A 1XFXA 1QICA 1PWUA 4H2EA 4H49A 1Z3JA 3DTIA 3I7GA 1GKCA 1D8MA 4WK7A 1XFYA 3G42A 3ZVSA 2D1OA 3KEKA 3ZXHA 3HYGA 2DDFA 2W12A 3KRYA 4GWMA 2WO9A 1K7QA 1C8TA 4H76A 4WKEA 1IAGA 1KUFA 2J83A 1J7NA 3F15A 1BKCA 1SLNA 2X3BA 3U1RA 1YCMA 1SU3A 3LJZA 3DPEA 2JT5A 1DMTA 1D5JA 4WZVA 1GO7P 3CKIA 3LIRA 4DD8A 1GE5A 4H84A 4H3XA 5H8XA 1G4KA 3L0TA 3TVCA 2POJA 1MNCA 2PJTA 4L6TA 1SLMA 1QIBA 2ERQA 4A7BA 4DF9A 2E2DA 1O0QA 3RTTA 3TS4A 1IAAA 5L7FA 4R3VA 4ZR5A 1QUAA 3KEJA 3LEAA 3WV1A 5LABA 4GR8A 1ASTA 1R1HA 3F1AA 5I3MA 3DPFA 4A3WA 1PWVA 3WV3A 3LE9A 4IUWA 1MMRA 2JSDA 2CKIA 1ZS0A 4JA1A 1SMPA 2AYKA 1RM8A 4PKQA 1IACA 3LMCA 1OZ9A 4IJOA 2AIGP 5L79A 2MZIA 1PWQA 4PKUA 3B2ZA 1XFZA 3LGPA 1KUIA 3HY9A 3EDGA 1JANA 4GQLA 4QKZA 3P24A 1PWPA 4L7AA 3RTSA 3EHYA 4HX3A 2OY2A 3HDBA 2YIGA 4WKIA 2SRTA 1ROSA 5I43A 1OM8A 4I35A 1JAOA 1ZTQA 2XS4A 5JMYA 1HOVA 2E3XA 1KUGA 2X3CA 1ZP5A 2DW0A 2USNA 1R1JA 5CZMA 1JK3A 4EFSA 2K9CA 3SHIA 1Y93A 2XS3A 830CA 1G05A 1HFSA 3K7LA 966CA 2DDYA 4AUOA 2J0TA 2OXWA 3AIGA 1BKCE 4GR3A 1USNA 1XUDA 3LILA 456CA 4PKTA 1SATA 3F18A 1IABA 3LUNA 2HU6A 3HBUP 1A86A 5CUHA 4PKWA 1QIAA 5I0LA 3LJTA 4G9LA 3N2UA 1R1IA 1KUHA 4L63A 3F17A 1EUBA 3HDAP 1MMQA 3DWBA 3BA0A 4J4MA 4AXQA 2CLTA 3F19A 2MZHA 1OO9A 2RJPA 2Z2DA 2K2GA 1JAPA 4DV8A 3E8RA 1B8YA 2OW1A 1QJIA 4H30A 5D3CA 4FXYP 4G0DA 1KBCA 4JIJA 2Y6CA 1I76A 3MA2A 4XM8A 4AIGA 3KHIA 1JKYA 3EDIA 1EB6A 2MLRA 2KRJA 5D7WA
chains in the Genus database with same CATH topology
1BSWA 5B5OA 1L6JA 2OXUA 3O64A 2TCLA 1A85A 3L0VA 1YOUA 1H71P 1JIZA 3B92A 3Q2GA 4H82A 1JH1A 3GBOA 3NX7A 4Q1LA 4FVLA 4XM7A 3OHLA 3KWVC 2X3AA 1FM1A 5I12A 1BUDA 2A8HA 2OW9A 1RMZA 1XFVA 5B5PA 1B3DA 1IAEA 1YQYA 4L19A 1R54A 2L0RA 1IADA 3LK8A 2JNPA 2DW1A 1MMPA 2Y6DA 2W13A 1CIZA 3HY7A 4PKVA 1KUKA 2OI0A 1XFWA 1UMSA 3B8ZA 1GE7A 4GF1A 1G9KA 2FV5A 1FLSA 1HV5A 1MMBA 2D1NA 1HTDA 2OW0A 1C3IA 2WOAA 1G49A 1GO8P 1BIWA 4JQGA 3EHXA 3LKAA 1CGLA 2JT6A 2O36A 2DW2A 2OY4A 1Y8JA 1KAPP 1D8FA 5CXAA 1OS2A 3DTKA 4PKSA 4DPEA 4I03A 5D2BA 5D1UA 3KECA 1WNIA 4IN9A 1R55A 3ELMA 4JPAA 3EDHA 3K7NA 1AYKA 5D1TA 3EWJA 4ON1A 5I2ZA 3V96B 1UMTA 1PWWA 1CAQA 4GWNA 5BOTA 1HFCA 1D7XA 2FV9A 1CQRA 2OZRA 1CGFA 1ND1A 3HBVP 3LQ0A 2QPJA 4FXQA 3DTEA 1OM6A 4FU4A 2W0DA 3TSKA 1CXVA 2EROA 2I47A 2OVXA 2YUFA 3VTGA 1XURA 1I1IP 2ERPA 1I73A 4WF6A 5BPAA 3LIKA 3LJGA 1BQOA 2X7MA 3Q2HA 1DTHA 1OMJA 4XM6A 1GXDA 3G5CA 2MLSA 4AYKA 1ATLA 1ZVXA 2N8RA 1BZSA 1GE6A 3VI1A 1UTZA 2OXZA 4XBHA 3P1VA 1OS9A 1CK7A 1AF0A 2OVZA 1G12A 4XCTA 3DSLA 2O3EA 1JJ9A 2W15A 1QJJA 1ZXVA 1K7GA 2W14A 3F16A 1JAQA 2JIHA 1XFUA 1JIWP 3DNGA 3KMEA 1S4BP 4H1QA 3DL1A 1OM7A 2RJQA 3UVCA 1UTTA 1BQQM 1UEAA 1K7IA 2WO8A 1O0TA 2OW2A 3AYKA 5I4OA 1SRPA 1Q3AA 3O2XA 3KMCA 1BUVM 1ZXCA 3I7IA 3TT4A 3ZUKA 2MZEA 1EAKA 3WV2A 5BOYA 1BKCI 3USNA 1AKLA 5D1SA 1YP1A 1FBLA 3EDZA 4GR0A 1HY7A 1Y0VA 4CTHA 2V4BA 4HMAA 1GKDA 2YB9A 1XUCA 1BM6A 3AYUA 4JP4A 1C7KA 4ILWD 4PKRA 3LUMA 3HB2P 4GUYA 3LQBA 3N2VA 1CGEA 3OHOA 1XFXA 1QICA 1PWUA 4H2EA 4H49A 1Z3JA 3DTIA 3I7GA 1GKCA 1D8MA 4WK7A 1XFYA 3G42A 3ZVSA 2D1OA 3KEKA 3ZXHA 3HYGA 2DDFA 2W12A 3KRYA 4GWMA 2WO9A 1K7QA 1C8TA 4H76A 4WKEA 1IAGA 1KUFA 2J83A 1J7NA 3F15A 1BKCA 1SLNA 2X3BA 3U1RA 1YCMA 1SU3A 3LJZA 3DPEA 2JT5A 1DMTA 1D5JA 4WZVA 1GO7P 3CKIA 3LIRA 4DD8A 1GE5A 4H84A 4H3XA 5H8XA 1G4KA 3L0TA 3TVCA 2POJA 1MNCA 2PJTA 4L6TA 1SLMA 1QIBA 2ERQA 4A7BA 4DF9A 2E2DA 1O0QA 3RTTA 3TS4A 1IAAA 5L7FA 4R3VA 4ZR5A 1QUAA 3KEJA 3LEAA 3WV1A 5LABA 4GR8A 1ASTA 1R1HA 3F1AA 5I3MA 3DPFA 4A3WA 1PWVA 3WV3A 3LE9A 4IUWA 1MMRA 2JSDA 2CKIA 1ZS0A 4JA1A 1SMPA 2AYKA 1RM8A 4PKQA 1IACA 3LMCA 4IJOA 2AIGP 5L79A 2MZIA 1PWQA 4PKUA 3B2ZA 1XFZA 3LGPA 1KUIA 3HY9A 3EDGA 1JANA 4GQLA 4QKZA 3P24A 1PWPA 4L7AA 3RTSA 3EHYA 4HX3A 2OY2A 3HDBA 2YIGA 4WKIA 2SRTA 1ROSA 5I43A 1OM8A 4I35A 1JAOA 1ZTQA 2XS4A 5JMYA 1HOVA 2E3XA 1KUGA 2X3CA 1ZP5A 2DW0A 2USNA 1R1JA 5CZMA 1JK3A 4EFSA 2K9CA 3SHIA 1Y93A 2XS3A 830CA 1G05A 1HFSA 3K7LA 966CA 2DDYA 4AUOA 2J0TA 2OXWA 3AIGA 1BKCE 4GR3A 1USNA 1XUDA 3LILA 456CA 4PKTA 1SATA 3F18A 1IABA 3LUNA 2HU6A 3HBUP 1A86A 5CUHA 4PKWA 1QIAA 5I0LA 3LJTA 4G9LA 3N2UA 1R1IA 1KUHA 4L63A 3F17A 1EUBA 3HDAP 1MMQA 3DWBA 3BA0A 4J4MA 4AXQA 2CLTA 3F19A 2MZHA 1OO9A 2RJPA 2Z2DA 2K2GA 1JAPA 4DV8A 3E8RA 1B8YA 2OW1A 1QJIA 4H30A 5D3CA 4FXYP 4G0DA 1KBCA 4JIJA 2Y6CA 1I76A 3MA2A 4XM8A 4AIGA 3KHIA 1JKYA 3EDIA 1EB6A 2MLRA 2KRJA 5D7WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BSW A;  5B5O A;  1L6J A;  2OXU A;  3O64 A;  2TCL A;  1A85 A;  3L0V A;  1YOU A;  1H71 P;  1JIZ A;  3B92 A;  3Q2G A;  4H82 A;  1JH1 A;  3GBO A;  3NX7 A;  4Q1L A;  4FVL A;  4XM7 A;  3OHL A;  3KWV C;  2X3A A;  1FM1 A;  5I12 A;  1BUD A;  2A8H A;  2OW9 A;  1RMZ A;  1XFV A;  5B5P A;  1B3D A;  1IAE A;  1YQY A;  4L19 A;  1R54 A;  2L0R A;  1IAD A;  3LK8 A;  2JNP A;  2DW1 A;  1MMP A;  2Y6D A;  2W13 A;  1CIZ A;  3HY7 A;  4PKV A;  1KUK A;  2OI0 A;  1XFW A;  1UMS A;  3B8Z A;  1GE7 A;  4GF1 A;  1G9K A;  2FV5 A;  1FLS A;  1HV5 A;  1MMB A;  2D1N A;  1HTD A;  2OW0 A;  1C3I A;  2WOA A;  1G49 A;  1GO8 P;  1BIW A;  4JQG A;  3EHX A;  3LKA A;  1CGL A;  2JT6 A;  2O36 A;  2DW2 A;  2OY4 A;  1Y8J A;  1KAP P;  1D8F A;  5CXA A;  1OS2 A;  4PKS A;  4DPE A;  4I03 A;  5D2B A;  5D1U A;  3KEC A;  1WNI A;  4IN9 A;  1R55 A;  3ELM A;  4JPA A;  3EDH A;  3K7N A;  1AYK A;  5D1T A;  3EWJ A;  4ON1 A;  5I2Z A;  3V96 B;  1UMT A;  1PWW A;  1CAQ A;  4GWN A;  5BOT A;  1HFC A;  1D7X A;  2FV9 A;  1CQR A;  2OZR A;  1CGF A;  1ND1 A;  3HBV P;  3LQ0 A;  2QPJ A;  4FXQ A;  1OM6 A;  4FU4 A;  2W0D A;  3TSK A;  1CXV A;  2ERO A;  2I47 A;  2OVX A;  3VTG A;  1XUR A;  1I1I P;  2ERP A;  1I73 A;  4WF6 A;  5BPA A;  3LIK A;  3LJG A;  1BQO A;  2X7M A;  3Q2H A;  1DTH A;  1OMJ A;  4XM6 A;  1GXD A;  3G5C A;  2MLS A;  4AYK A;  1ATL A;  1ZVX A;  2N8R A;  1BZS A;  1GE6 A;  3VI1 A;  1UTZ A;  2OXZ A;  4XBH A;  3P1V A;  1OS9 A;  1CK7 A;  1AF0 A;  2OVZ A;  1G12 A;  4XCT A;  3DSL A;  2O3E A;  1JJ9 A;  2W15 A;  1QJJ A;  1ZXV A;  1K7G A;  2W14 A;  3F16 A;  1JAQ A;  2JIH A;  1XFU A;  1JIW P;  3DNG A;  3KME A;  1S4B P;  4H1Q A;  3DL1 A;  1OM7 A;  2RJQ A;  3UVC A;  1UTT A;  1BQQ M;  1UEA A;  1K7I A;  2WO8 A;  1O0T A;  2OW2 A;  3AYK A;  5I4O A;  1SRP A;  1Q3A A;  3O2X A;  3KMC A;  1BUV M;  1ZXC A;  3I7I A;  3TT4 A;  3ZUK A;  2MZE A;  1EAK A;  3WV2 A;  5BOY A;  1BKC I;  3USN A;  1AKL A;  5D1S A;  1YP1 A;  1FBL A;  3EDZ A;  4GR0 A;  1HY7 A;  1Y0V A;  4CTH A;  2V4B A;  4HMA A;  1GKD A;  2YB9 A;  1XUC A;  1BM6 A;  3AYU A;  4JP4 A;  1C7K A;  4ILW D;  4PKR A;  3LUM A;  3HB2 P;  4GUY A;  3LQB A;  3N2V A;  1CGE A;  3OHO A;  1XFX A;  1QIC A;  1PWU A;  4H2E A;  4H49 A;  1Z3J A;  3I7G A;  1GKC A;  1D8M A;  4WK7 A;  1XFY A;  3G42 A;  3ZVS A;  2D1O A;  3KEK A;  3ZXH A;  3HYG A;  2DDF A;  2W12 A;  3KRY A;  4GWM A;  2WO9 A;  1K7Q A;  1C8T A;  4H76 A;  4WKE A;  1IAG A;  1KUF A;  2J83 A;  1J7N A;  3F15 A;  1BKC A;  1SLN A;  2X3B A;  3U1R A;  1YCM A;  1SU3 A;  3LJZ A;  3DPE A;  2JT5 A;  1DMT A;  1D5J A;  4WZV A;  1GO7 P;  3CKI A;  3LIR A;  4DD8 A;  1GE5 A;  4H84 A;  4H3X A;  5H8X A;  1G4K A;  3L0T A;  3TVC A;  2POJ A;  1MNC A;  2PJT A;  4L6T A;  1SLM A;  1QIB A;  2ERQ A;  4A7B A;  4DF9 A;  2E2D A;  1O0Q A;  3RTT A;  3TS4 A;  1IAA A;  5L7F A;  4R3V A;  4ZR5 A;  1QUA A;  3KEJ A;  3LEA A;  3WV1 A;  5LAB A;  4GR8 A;  1AST A;  1R1H A;  3F1A A;  5I3M A;  3DPF A;  4A3W A;  1PWV A;  3WV3 A;  3LE9 A;  4IUW A;  1MMR A;  2JSD A;  2CKI A;  1ZS0 A;  4JA1 A;  1SMP A;  2AYK A;  1RM8 A;  4PKQ A;  1IAC A;  3LMC A;  4IJO A;  2AIG P;  5L79 A;  2MZI A;  1PWQ A;  4PKU A;  3B2Z A;  1XFZ A;  3LGP A;  1KUI A;  3HY9 A;  3EDG A;  1JAN A;  4GQL A;  4QKZ A;  3P24 A;  1PWP A;  3RTS A;  3EHY A;  4HX3 A;  2OY2 A;  3HDB A;  2YIG A;  4WKI A;  2SRT A;  1ROS A;  5I43 A;  1OM8 A;  4I35 A;  1JAO A;  1ZTQ A;  2XS4 A;  5JMY A;  1HOV A;  2E3X A;  1KUG A;  2X3C A;  1ZP5 A;  2DW0 A;  2USN A;  1R1J A;  5CZM A;  1JK3 A;  4EFS A;  2K9C A;  3SHI A;  1Y93 A;  2XS3 A;  830C A;  1G05 A;  1HFS A;  3K7L A;  966C A;  2DDY A;  4AUO A;  2J0T A;  2OXW A;  3AIG A;  1BKC E;  4GR3 A;  1USN A;  1XUD A;  3LIL A;  456C A;  4PKT A;  1SAT A;  3F18 A;  1IAB A;  3LUN A;  2HU6 A;  3HBU P;  1A86 A;  5CUH A;  4PKW A;  1QIA A;  5I0L A;  3LJT A;  4G9L A;  3N2U A;  1R1I A;  1KUH A;  4L63 A;  3F17 A;  1EUB A;  3HDA P;  1MMQ A;  3DWB A;  3BA0 A;  4J4M A;  4AXQ A;  2CLT A;  3F19 A;  2MZH A;  1OO9 A;  2RJP A;  2Z2D A;  2K2G A;  1JAP A;  4DV8 A;  3E8R A;  1B8Y A;  2OW1 A;  1QJI A;  4H30 A;  5D3C A;  4FXY P;  4G0D A;  1KBC A;  4JIJ A;  2Y6C A;  1I76 A;  3MA2 A;  4XM8 A;  4AIG A;  3KHI A;  1JKY A;  3EDI A;  1EB6 A;  2MLR A;  2KRJ A;  5D7W A; 
#chains in the Genus database with same CATH topology
 1BSW A;  5B5O A;  1L6J A;  2OXU A;  3O64 A;  2TCL A;  1A85 A;  3L0V A;  1YOU A;  1H71 P;  1JIZ A;  3B92 A;  3Q2G A;  4H82 A;  1JH1 A;  3GBO A;  3NX7 A;  4Q1L A;  4FVL A;  4XM7 A;  3OHL A;  3KWV C;  2X3A A;  1FM1 A;  5I12 A;  1BUD A;  2A8H A;  2OW9 A;  1RMZ A;  1XFV A;  5B5P A;  1B3D A;  1IAE A;  1YQY A;  4L19 A;  1R54 A;  2L0R A;  1IAD A;  3LK8 A;  2JNP A;  2DW1 A;  1MMP A;  2Y6D A;  2W13 A;  1CIZ A;  3HY7 A;  4PKV A;  1KUK A;  2OI0 A;  1XFW A;  1UMS A;  3B8Z A;  1GE7 A;  4GF1 A;  1G9K A;  2FV5 A;  1FLS A;  1HV5 A;  1MMB A;  2D1N A;  1HTD A;  2OW0 A;  1C3I A;  2WOA A;  1G49 A;  1GO8 P;  1BIW A;  4JQG A;  3EHX A;  3LKA A;  1CGL A;  2JT6 A;  2O36 A;  2DW2 A;  2OY4 A;  1Y8J A;  1KAP P;  1D8F A;  5CXA A;  1OS2 A;  3DTK A;  4PKS A;  4DPE A;  4I03 A;  5D2B A;  5D1U A;  1XAX A;  3KEC A;  1WNI A;  4IN9 A;  1R55 A;  3ELM A;  4JPA A;  3EDH A;  3K7N A;  1AYK A;  5D1T A;  3EWJ A;  4ON1 A;  5I2Z A;  3V96 B;  1UMT A;  1PWW A;  1CAQ A;  4GWN A;  5BOT A;  1HFC A;  1D7X A;  2FV9 A;  1CQR A;  2OZR A;  1CGF A;  1ND1 A;  3HBV P;  3LQ0 A;  2QPJ A;  4FXQ A;  3DTE A;  1OM6 A;  4FU4 A;  2W0D A;  3TSK A;  1CXV A;  2ERO A;  2I47 A;  2OVX A;  2YUF A;  3VTG A;  1XUR A;  1I1I P;  2ERP A;  1I73 A;  4WF6 A;  5BPA A;  3LIK A;  3LJG A;  1BQO A;  2X7M A;  3Q2H A;  1DTH A;  1OMJ A;  4XM6 A;  1GXD A;  3G5C A;  2MLS A;  4AYK A;  1ATL A;  1ZVX A;  2N8R A;  1BZS A;  1GE6 A;  3VI1 A;  1UTZ A;  2OXZ A;  4XBH A;  3P1V A;  1OS9 A;  1CK7 A;  1AF0 A;  2OVZ A;  1G12 A;  4XCT A;  3DSL A;  2O3E A;  1JJ9 A;  2W15 A;  1QJJ A;  1ZXV A;  1K7G A;  2W14 A;  3F16 A;  1JAQ A;  2JIH A;  1XFU A;  1JIW P;  3DNG A;  3KME A;  1S4B P;  4H1Q A;  3DL1 A;  1OM7 A;  2RJQ A;  3UVC A;  1UTT A;  1BQQ M;  1UEA A;  1K7I A;  2WO8 A;  1O0T A;  2OW2 A;  3AYK A;  5I4O A;  1SRP A;  1Q3A A;  3O2X A;  3KMC A;  1BUV M;  1ZXC A;  3I7I A;  3TT4 A;  3ZUK A;  2MZE A;  1EAK A;  3WV2 A;  5BOY A;  1BKC I;  3USN A;  1AKL A;  5D1S A;  1YP1 A;  1FBL A;  3EDZ A;  4GR0 A;  1HY7 A;  1Y0V A;  4CTH A;  2V4B A;  4HMA A;  1GKD A;  1TVI A;  2YB9 A;  1XUC A;  1BM6 A;  3AYU A;  4JP4 A;  1C7K A;  4ILW D;  4PKR A;  3LUM A;  3HB2 P;  4GUY A;  3LQB A;  3N2V A;  1CGE A;  3OHO A;  1XM5 A;  1XFX A;  1QIC A;  1PWU A;  4H2E A;  4H49 A;  1Z3J A;  3DTI A;  3I7G A;  1GKC A;  1D8M A;  4WK7 A;  1XFY A;  3G42 A;  3ZVS A;  2D1O A;  3KEK A;  3ZXH A;  3HYG A;  2DDF A;  2W12 A;  3KRY A;  4GWM A;  2WO9 A;  1K7Q A;  1C8T A;  4H76 A;  4WKE A;  1IAG A;  1KUF A;  2J83 A;  1J7N A;  3F15 A;  1BKC A;  1SLN A;  2X3B A;  3U1R A;  1YCM A;  1SU3 A;  3LJZ A;  3DPE A;  2JT5 A;  1DMT A;  1D5J A;  4WZV A;  1GO7 P;  3CKI A;  3LIR A;  4DD8 A;  1GE5 A;  4H84 A;  4H3X A;  5H8X A;  1G4K A;  3L0T A;  3TVC A;  2POJ A;  1MNC A;  2PJT A;  4L6T A;  1SLM A;  1QIB A;  2ERQ A;  4A7B A;  4DF9 A;  2E2D A;  1O0Q A;  3RTT A;  3TS4 A;  1IAA A;  5L7F A;  4R3V A;  4ZR5 A;  1QUA A;  3KEJ A;  3LEA A;  3WV1 A;  5LAB A;  4GR8 A;  1AST A;  1R1H A;  3F1A A;  5I3M A;  3DPF A;  4A3W A;  1PWV A;  3WV3 A;  3LE9 A;  4IUW A;  1MMR A;  2JSD A;  2CKI A;  1ZS0 A;  4JA1 A;  1SMP A;  2AYK A;  1RM8 A;  4PKQ A;  1IAC A;  3LMC A;  1OZ9 A;  4IJO A;  2AIG P;  5L79 A;  2MZI A;  1PWQ A;  4PKU A;  3B2Z A;  1XFZ A;  3LGP A;  1KUI A;  3HY9 A;  3EDG A;  1JAN A;  4GQL A;  4QKZ A;  3P24 A;  1PWP A;  4L7A A;  3RTS A;  3EHY A;  4HX3 A;  2OY2 A;  3HDB A;  2YIG A;  4WKI A;  2SRT A;  1ROS A;  5I43 A;  1OM8 A;  4I35 A;  1JAO A;  1ZTQ A;  2XS4 A;  5JMY A;  1HOV A;  2E3X A;  1KUG A;  2X3C A;  1ZP5 A;  2DW0 A;  2USN A;  1R1J A;  5CZM A;  1JK3 A;  4EFS A;  2K9C A;  3SHI A;  1Y93 A;  2XS3 A;  830C A;  1G05 A;  1HFS A;  3K7L A;  966C A;  2DDY A;  4AUO A;  2J0T A;  2OXW A;  3AIG A;  1BKC E;  4GR3 A;  1USN A;  1XUD A;  3LIL A;  456C A;  4PKT A;  1SAT A;  3F18 A;  1IAB A;  3LUN A;  2HU6 A;  3HBU P;  1A86 A;  5CUH A;  4PKW A;  1QIA A;  5I0L A;  3LJT A;  4G9L A;  3N2U A;  1R1I A;  1KUH A;  4L63 A;  3F17 A;  1EUB A;  3HDA P;  1MMQ A;  3DWB A;  3BA0 A;  4J4M A;  4AXQ A;  2CLT A;  3F19 A;  2MZH A;  1OO9 A;  2RJP A;  2Z2D A;  2K2G A;  1JAP A;  4DV8 A;  3E8R A;  1B8Y A;  2OW1 A;  1QJI A;  4H30 A;  5D3C A;  4FXY P;  4G0D A;  1KBC A;  4JIJ A;  2Y6C A;  1I76 A;  3MA2 A;  4XM8 A;  4AIG A;  3KHI A;  1JKY A;  3EDI A;  1EB6 A;  2MLR A;  2KRJ A;  5D7W A; 
#chains in the Genus database with same CATH homology
 1BSW A;  5B5O A;  1L6J A;  2OXU A;  3O64 A;  2TCL A;  1A85 A;  3L0V A;  1YOU A;  1H71 P;  1JIZ A;  3B92 A;  3Q2G A;  4H82 A;  1JH1 A;  3GBO A;  3NX7 A;  4Q1L A;  4FVL A;  4XM7 A;  3OHL A;  3KWV C;  2X3A A;  1FM1 A;  5I12 A;  1BUD A;  2A8H A;  2OW9 A;  1RMZ A;  1XFV A;  5B5P A;  1B3D A;  1IAE A;  1YQY A;  4L19 A;  1R54 A;  2L0R A;  1IAD A;  3LK8 A;  2JNP A;  2DW1 A;  1MMP A;  2Y6D A;  2W13 A;  1CIZ A;  3HY7 A;  4PKV A;  1KUK A;  2OI0 A;  1XFW A;  1UMS A;  3B8Z A;  1GE7 A;  4GF1 A;  1G9K A;  2FV5 A;  1FLS A;  1HV5 A;  1MMB A;  2D1N A;  1HTD A;  2OW0 A;  1C3I A;  2WOA A;  1G49 A;  1GO8 P;  1BIW A;  4JQG A;  3EHX A;  3LKA A;  1CGL A;  2JT6 A;  2O36 A;  2DW2 A;  2OY4 A;  1Y8J A;  1KAP P;  1D8F A;  5CXA A;  1OS2 A;  3DTK A;  4PKS A;  4DPE A;  4I03 A;  5D2B A;  5D1U A;  3KEC A;  1WNI A;  4IN9 A;  1R55 A;  3ELM A;  4JPA A;  3EDH A;  3K7N A;  1AYK A;  5D1T A;  3EWJ A;  4ON1 A;  5I2Z A;  3V96 B;  1UMT A;  1PWW A;  1CAQ A;  4GWN A;  5BOT A;  1HFC A;  1D7X A;  2FV9 A;  1CQR A;  2OZR A;  1CGF A;  1ND1 A;  3HBV P;  3LQ0 A;  2QPJ A;  4FXQ A;  3DTE A;  1OM6 A;  4FU4 A;  2W0D A;  3TSK A;  1CXV A;  2ERO A;  2I47 A;  2OVX A;  2YUF A;  3VTG A;  1XUR A;  1I1I P;  2ERP A;  1I73 A;  4WF6 A;  5BPA A;  3LIK A;  3LJG A;  1BQO A;  2X7M A;  3Q2H A;  1DTH A;  1OMJ A;  4XM6 A;  1GXD A;  3G5C A;  2MLS A;  4AYK A;  1ATL A;  1ZVX A;  2N8R A;  1BZS A;  1GE6 A;  3VI1 A;  1UTZ A;  2OXZ A;  4XBH A;  3P1V A;  1OS9 A;  1CK7 A;  1AF0 A;  2OVZ A;  1G12 A;  4XCT A;  3DSL A;  2O3E A;  1JJ9 A;  2W15 A;  1QJJ A;  1ZXV A;  1K7G A;  2W14 A;  3F16 A;  1JAQ A;  2JIH A;  1XFU A;  1JIW P;  3DNG A;  3KME A;  1S4B P;  4H1Q A;  3DL1 A;  1OM7 A;  2RJQ A;  3UVC A;  1UTT A;  1BQQ M;  1UEA A;  1K7I A;  2WO8 A;  1O0T A;  2OW2 A;  3AYK A;  5I4O A;  1SRP A;  1Q3A A;  3O2X A;  3KMC A;  1BUV M;  1ZXC A;  3I7I A;  3TT4 A;  3ZUK A;  2MZE A;  1EAK A;  3WV2 A;  5BOY A;  1BKC I;  3USN A;  1AKL A;  5D1S A;  1YP1 A;  1FBL A;  3EDZ A;  4GR0 A;  1HY7 A;  1Y0V A;  4CTH A;  2V4B A;  4HMA A;  1GKD A;  2YB9 A;  1XUC A;  1BM6 A;  3AYU A;  4JP4 A;  1C7K A;  4ILW D;  4PKR A;  3LUM A;  3HB2 P;  4GUY A;  3LQB A;  3N2V A;  1CGE A;  3OHO A;  1XFX A;  1QIC A;  1PWU A;  4H2E A;  4H49 A;  1Z3J A;  3DTI A;  3I7G A;  1GKC A;  1D8M A;  4WK7 A;  1XFY A;  3G42 A;  3ZVS A;  2D1O A;  3KEK A;  3ZXH A;  3HYG A;  2DDF A;  2W12 A;  3KRY A;  4GWM A;  2WO9 A;  1K7Q A;  1C8T A;  4H76 A;  4WKE A;  1IAG A;  1KUF A;  2J83 A;  1J7N A;  3F15 A;  1BKC A;  1SLN A;  2X3B A;  3U1R A;  1YCM A;  1SU3 A;  3LJZ A;  3DPE A;  2JT5 A;  1DMT A;  1D5J A;  4WZV A;  1GO7 P;  3CKI A;  3LIR A;  4DD8 A;  1GE5 A;  4H84 A;  4H3X A;  5H8X A;  1G4K A;  3L0T A;  3TVC A;  2POJ A;  1MNC A;  2PJT A;  4L6T A;  1SLM A;  1QIB A;  2ERQ A;  4A7B A;  4DF9 A;  2E2D A;  1O0Q A;  3RTT A;  3TS4 A;  1IAA A;  5L7F A;  4R3V A;  4ZR5 A;  1QUA A;  3KEJ A;  3LEA A;  3WV1 A;  5LAB A;  4GR8 A;  1AST A;  1R1H A;  3F1A A;  5I3M A;  3DPF A;  4A3W A;  1PWV A;  3WV3 A;  3LE9 A;  4IUW A;  1MMR A;  2JSD A;  2CKI A;  1ZS0 A;  4JA1 A;  1SMP A;  2AYK A;  1RM8 A;  4PKQ A;  1IAC A;  3LMC A;  4IJO A;  2AIG P;  5L79 A;  2MZI A;  1PWQ A;  4PKU A;  3B2Z A;  1XFZ A;  3LGP A;  1KUI A;  3HY9 A;  3EDG A;  1JAN A;  4GQL A;  4QKZ A;  3P24 A;  1PWP A;  4L7A A;  3RTS A;  3EHY A;  4HX3 A;  2OY2 A;  3HDB A;  2YIG A;  4WKI A;  2SRT A;  1ROS A;  5I43 A;  1OM8 A;  4I35 A;  1JAO A;  1ZTQ A;  2XS4 A;  5JMY A;  1HOV A;  2E3X A;  1KUG A;  2X3C A;  1ZP5 A;  2DW0 A;  2USN A;  1R1J A;  5CZM A;  1JK3 A;  4EFS A;  2K9C A;  3SHI A;  1Y93 A;  2XS3 A;  830C A;  1G05 A;  1HFS A;  3K7L A;  966C A;  2DDY A;  4AUO A;  2J0T A;  2OXW A;  3AIG A;  1BKC E;  4GR3 A;  1USN A;  1XUD A;  3LIL A;  456C A;  4PKT A;  1SAT A;  3F18 A;  1IAB A;  3LUN A;  2HU6 A;  3HBU P;  1A86 A;  5CUH A;  4PKW A;  1QIA A;  5I0L A;  3LJT A;  4G9L A;  3N2U A;  1R1I A;  1KUH A;  4L63 A;  3F17 A;  1EUB A;  3HDA P;  1MMQ A;  3DWB A;  3BA0 A;  4J4M A;  4AXQ A;  2CLT A;  3F19 A;  2MZH A;  1OO9 A;  2RJP A;  2Z2D A;  2K2G A;  1JAP A;  4DV8 A;  3E8R A;  1B8Y A;  2OW1 A;  1QJI A;  4H30 A;  5D3C A;  4FXY P;  4G0D A;  1KBC A;  4JIJ A;  2Y6C A;  1I76 A;  3MA2 A;  4XM8 A;  4AIG A;  3KHI A;  1JKY A;  3EDI A;  1EB6 A;  2MLR A;  2KRJ A;  5D7W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...