1HYJA

Solution structure of the eea1 fyve domain
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
65
structure length
65
Chain Sequence
RKWAEDNEVQNCMACGKGFSVTVRRHHCRQCGNIFCAECSAKNALTPSSKKPVRVCDACFNDLQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENDOSOME-ASSOCIATED PROTEIN
publication title Structural mechanism of endosome docking by the FYVE domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Endocytosis/exocytosis
total genus 4
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2001-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01363 FYVE FYVE zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 1hyjA00
5AIUA 4CCGX 4A4CA 4W4UA 5LKZA 5EYAF 2E6RA 2KWJA 5TDWA 1HYJA 2MNZA 2VP7A 2LRIC 5AITA 2C2LA 2JMJA 2ECIA 4LADB 2KGGA 4AYCA 5LCWB 2KREA 2RSDA 3ZNIA 2LXHC 1IYMA 2VPEA 2K16A 3L1ZB 4L7XA 4QF3A 4NN2A 1T1HA 4O64A 4LK9A 4GNGA 2XB1A 2M85A 1CHCA 4C9ZA 1Z2QA 5G05B 5LKTA 3KV5A 4AUQB 4YAXA 4GB0A 1WESA 3IHPA 3N9LA 5B78A 4S3OB 1WEOA 4F52B 3HCUA 2ECWA 5H1VA 1N87A 2XEUA 2FSAA 4AP4A 4UP0A 1VFYA 2YU4A 3U5PA 2M1RA 1VYXA 2YURA 5B8DA 3ZTGA 5J3XA 4A4BA 3MHSA 5LKUA 5TABA 1WEQA 2VJFB 2KE1A 3O35A 4YABA 5DKAA 1WE9A 3M62A 1G25A 4PTBA 1V87A 4GNFA 5TBNA 1WEMA 4AYCB 3O36A 2CT2A 4FIPA 2YHNA 2VPDA 3LQJA 3LQIA 1Z60A 4X3GA 4FO9A 2F6NA 1WFKA 1F62A 2ECGA 2M6MA 1WIMA 1Z6UA 2K4DA 2MT5A 3ASLA 4I7BA 1WEEA 2YQMA 2RI7A 3N9QA 3KV6A 3PURA 3ZYQA 2VJEA 3ZPV1 3RPGC 2KFTA 2JRJA 4FJCA 2LN0A 5TDRA 2CSYA 3HTKC 4QF2A 3L11A 2QJ0A 2CKLA 5DINA 4Q6FA 2IDAA 4L58A 1JM7A 3ZPVE 2K17A 4ZUXU 1BORA 1U6GB 4MSXA 3QZVA 2LV9A 4B7YC 3LRQA 2ECJA 3O70A 4BBQA 5FEYA 4A49A 3M99A 2KWOA 2G43A 5B77A 2E6SA 4GNDA 2VNFA 5G04B 2HDPA 1RMDA 2LGKA 2ZETC 5D1MB 3RTRB 2KU3A 5TRBA 4IC3A 1LDJB 2KGIA 3N9OA 2I50A 2EGPA 1WEPA 3KQIA 2VJEB 1VD4A 4AVXA 3HCSA 2M3HA 2Y1NA 4YATA 2MNYA 4I7CA 2L43A 2YREA 5H9MA 4YBSA 4WA6A 2LXPC 5KH7A 3VK6A 4B86C 3DQVR 2YQLA 5C13A 4TKPB 2MD7B 2PUYA 5KH3A 1JM7B 2C2VS 3EB6A 1E4UA 2LGGA 4S3OC 1WENA 4XI1A 2KIZA 5JG6A 1LDKC 2KWNA 2ECTA 4V3LC 2YSMA 2YYRA 3N9MA 3O34A 2ECNA 2K1JA 3DPLR 2MUMA 2KR4A 2JMIA 5B76A 4YBMA 2F42A 3M63A 2MIQA 5B75A 4ZDTA 4LLBA 4LKAA 2QICA 3SOXA 2CSZA 3C5KA 5B79A 2MD8C 1K2FA 3N9NA 4IC2A 5H1TA 4FK5A 1WEUA 3O37A 4MVTA 4N4FA 1X4IA 4BHWA 3FL2A 5KH9A 2VJFA 3KNVA 5FB0A 3ZVYA 5FERA 1WEWA 4CA1A 3SHBA 3PUQA 2EA6A 2LDRA 4ZQLA 2H0DA 1FP0A 3U5MA 2YSJA 2L80A 2YHOA 3C6WA 2BAYA 1X4JA 3NG2A 1WGMA 2UZGA 3T6RA 4A0CD 1MM2A 1WILA 2MA5A 1MM3A 2L75A 3U5NA 3T7LA 2KWKA 4YADA 2YUCA 2G6QA 5D1LB 2MA6A 3MHHA 4I7DA 5FB1A 3SOUA 2EODA 4YC9A 1WEVA 1JOCA 3EB5A 3LQHA 1X4UA 2Y43A 2YT5A 5C11A 4WZ0A 3GL6A 2FUUA 1DVPA 2LGVA 3L1XA 2FUIA 3U5OA 2VPBA 1FBVA 3O7AA 2PNXA 4R2YA 2G45A 2HYED 4R8PK 2CKLB 2ECVA 2Y1MA 3RPGB 5LKXA 5G0FA 2OXQC 4UP5A 3PHDA 2L5UA 4V3KC 3V43A 2DX8A 2H0DB 4WZ2A 3ZVZB 4UI9B 2KYUA 2QIZA 3O33A 2F6JA 4R7EA 2AN6A 2NAAA 2L0BA 4LJNA 5I3LA 1ZBDB 2VPGA 4PPEA 3N9PA 2YW8A 2D8SA 2LQ6A 4WZ3B 4GNEA 3HCTA 2LGLA 5D1KB 1HYIA 4N3WA 3I2DA 4YBTA 4P5OB 5H1UA 3GV4A 2JMDA 3SOWA 1XWHA
chains in the Genus database with same CATH superfamily
2EXUA 5AIUA 4CCGX 4A4CA 4W4UA 5LKZA 5EYAF 2E6RA 2KWJA 5TDWA 4H9DA 1HYJA 2MNZA 2VP7A 2LRIC 5AITA 2C2LA 2XP0A 2JMJA 2ECIA 4LADB 2KGGA 4AYCA 5LCWB 2DJAA 2KREA 2RSDA 3ZNIA 2LXHC 1IYMA 2VPEA 2K16A 3L1ZB 4L7XA 4QF3A 4NN2A 1T1HA 4O64A 4LK9A 4GNGA 2XB1A 3H7HA 2M85A 1CHCA 4C9ZA 1Z2QA 5G05B 5LKTA 3KV5A 4AUQB 4YAXA 4GB0A 1WESA 3IHPA 3N9LA 5B78A 4S3OB 1WEOA 3FEHA 4F52B 3HCUA 2ECWA 5H1VA 1N87A 2XEUA 2FSAA 4AP4A 4UP0A 3MDBC 1VFYA 2YU4A 3U5PA 2M1RA 1VYXA 2YURA 5B8DA 2KKXA 3ZTGA 3FAOA 5J3XA 4A4BA 2KKYA 3MHSA 5LKUA 5TABA 1WEQA 3O47A 2VJFB 2KE1A 3O35A 4YABA 5DKAA 1WE9A 3M62A 1G25A 4PTBA 1V87A 4GNFA 5TBNA 2D8UA 1WEMA 2CRRA 4AYCB 3O36A 2CT2A 4FIPA 2YHNA 2VPDA 3LQJA 3LQIA 1DCQA 1Z60A 5SVIB 4X3GA 4FO9A 2F6NA 1WFKA 1F62A 2ECGA 2M6MA 1WIMA 1Z6UA 2K4DA 2IQJA 2MT5A 2YVRA 3ASLA 4I7BA 1WEEA 2YQMA 5SVYA 2RI7A 3N9QA 3KV6A 3PURA 4O62A 3ZYQA 2VJEA 3ZPV1 3RPGC 2KFTA 2JRJA 4FJCA 5SVXA 2LN0A 4OGEA 5TDRA 2CSYA 3HTKC 4QF2A 3L11A 1MBMA 2JM3A 2DSMA 2QJ0A 2CKLA 5DINA 2CSVA 4Q6FA 2IDAA 4L58A 1JM7A 3ZPVE 2K17A 2E61A 4ZUXU 1BORA 1U6GB 4MSXA 3QZVA 2LV9A 4B7YC 3LRQA 2ECJA 3O70A 5K3QA 4BBQA 5FEYA 4A49A 3M99A 2KWOA 2G43A 5B77A 2E6SA 4GNDA 2VNFA 5G04B 2HDPA 1RMDA 2LGKA 2ZETC 5D1MB 3RTRB 4OGCA 2KU3A 5TRBA 4IC3A 1LDJB 2KGIA 4Z0RA 3N9OA 2I50A 3E2DA 2EGPA 1WEPA 3KQIA 2VJEB 1VD4A 4AVXA 3HCSA 2M3HA 2JUNA 2Y1NA 4YATA 2MNYA 4I7CA 2L43A 2YREA 5H9MA 4YBSA 4WA6A 2LXPC 5KH7A 3VK6A 4B86C 3DQVR 2YQLA 5C13A 4TKPB 2MD7B 2PUYA 5KH3A 1JM7B 2C2VS 3EB6A 2XOYA 1E4UA 2LGGA 4S3OC 1WENA 4XI1A 2KIZA 5JG6A 1LDKC 2KWNA 2ECTA 4V3LC 2YSMA 2YYRA 3N9MA 3O34A 2ECNA 3T9KA 2K1JA 3DPLR 3SUBA 2MUMA 2KR4A 2JMIA 5B76A 4YBMA 2F42A 3M63A 2MIQA 5B75A 4ZDTA 3LJUX 3Q1DA 4LLBA 4LKAA 2QICA 3SOXA 2EGMA 2CSZA 3C5KA 5B79A 2MD8C 1K2FA 2CONA 3N9NA 4IC2A 5H1TA 2P57A 4FK5A 1WEUA 2OWAA 3FJUB 3O37A 2LAUA 4QQ4A 4MVTA 4N4FA 1X4IA 4BHWA 3FL2A 5KH9A 2VJFA 3KNVA 5FB0A 3ZVYA 5FERA 1WEWA 4CA1A 3SHBA 2M13A 3PUQA 3DWDA 2MKEA 4F1PA 2EA6A 2LDRA 4ZQLA 2H0DA 1FP0A 3U5MA 3JUEA 2YSJA 2L80A 2YHOA 3C6WA 2BAYA 1X4JA 2CRWA 3NG2A 5SVIA 1WGMA 2UZGA 3T6RA 4A0CD 1MM2A 1WILA 2MA5A 1MM3A 2L75A 2B0OE 3U5NA 3FM8C 3T7LA 2KWKA 4YADA 2YUCA 2G6QA 5D1LB 2MA6A 3MHHA 4I7DA 5FB1A 3SOUA 2EODA 2FFWA 4YC9A 1WEVA 1JOCA 3EB5A 3LQHA 1X4UA 2Y43A 2YT5A 5C11A 4WZ0A 3GL6A 2FUUA 4Z0OA 1DVPA 2LGVA 3L1XA 2FUIA 3U5OA 3PLWA 2VPBA 1FBVA 3M7KA 3O7AA 2PNXA 3DDTA 4R2YA 2G45A 2HYED 4R8PK 2CKLB 2ECVA 2Y1MA 3RPGB 2FD4A 5LKXA 5G0FA 2XOZA 2OXQC 4UP5A 3LVQE 3KDEC 3PHDA 2L5UA 4V3KC 3V43A 2DX8A 2H0DB 4WZ2A 3ZVZB 4UI9B 2KYUA 3LVRE 2QIZA 3O33A 2F6JA 3LDYA 4R7EA 3FANA 2AN6A 2NAAA 2L0BA 4LJNA 5I3LA 1ZBDB 2VPGA 4PPEA 3N9PA 2YW8A 2D8SA 2LQ6A 4WZ3B 4GNEA 3HCTA 2RR4A 2L7PA 2LGLA 5D1KB 1HYIA 4N3WA 3I2DA 4YBTA 4P5OB 5H1UA 2XOCA 3GV4A 2JMDA 3SOWA 1XWHA
chains in the Genus database with same CATH topology
5AIUA 4CCGX 4A4CA 4W4UA 5LKZA 5EYAF 2E6RA 2KWJA 5TDWA 1HYJA 2MNZA 2VP7A 2LRIC 5AITA 2C2LA 2JMJA 2ECIA 4LADB 2KGGA 4AYCA 5LCWB 2KREA 2RSDA 3ZNIA 2LXHC 1IYMA 2VPEA 2K16A 3L1ZB 4L7XA 4QF3A 4NN2A 1T1HA 4O64A 4LK9A 4GNGA 2XB1A 2M85A 1CHCA 4C9ZA 1Z2QA 5G05B 5LKTA 3KV5A 4AUQB 4YAXA 4GB0A 1WESA 3IHPA 3N9LA 5B78A 4S3OB 1WEOA 4F52B 3HCUA 2ECWA 5H1VA 1N87A 2XEUA 2FSAA 4AP4A 4UP0A 1VFYA 2YU4A 3U5PA 2M1RA 1VYXA 2YURA 5B8DA 3ZTGA 5J3XA 4A4BA 3MHSA 5LKUA 5TABA 1WEQA 2VJFB 2KE1A 3O35A 4YABA 5DKAA 1WE9A 3M62A 1G25A 4PTBA 1V87A 4GNFA 5TBNA 1WEMA 4AYCB 3O36A 2CT2A 4FIPA 2YHNA 2VPDA 3LQJA 3LQIA 1Z60A 4X3GA 4FO9A 2F6NA 1WFKA 1F62A 2ECGA 2M6MA 1WIMA 1Z6UA 2K4DA 2MT5A 3ASLA 4I7BA 1WEEA 2YQMA 2RI7A 3N9QA 3KV6A 3PURA 3ZYQA 2VJEA 3ZPV1 3RPGC 2KFTA 2JRJA 4FJCA 2LN0A 5TDRA 2CSYA 3HTKC 4QF2A 3L11A 2QJ0A 2CKLA 5DINA 4Q6FA 2IDAA 4L58A 1JM7A 3ZPVE 2K17A 4ZUXU 1BORA 1U6GB 4MSXA 3QZVA 2LV9A 4B7YC 3LRQA 2ECJA 3O70A 4BBQA 5FEYA 4A49A 3M99A 2KWOA 2G43A 5B77A 2E6SA 4GNDA 2VNFA 5G04B 2HDPA 1RMDA 2LGKA 2ZETC 5D1MB 3RTRB 2KU3A 5TRBA 4IC3A 1LDJB 2KGIA 3N9OA 2I50A 2EGPA 1WEPA 3KQIA 2VJEB 1VD4A 4AVXA 3HCSA 2M3HA 2Y1NA 4YATA 2MNYA 4I7CA 2L43A 2YREA 5H9MA 4YBSA 4WA6A 2LXPC 5KH7A 3VK6A 4B86C 3DQVR 2YQLA 5C13A 4TKPB 2MD7B 2PUYA 5KH3A 1JM7B 2C2VS 3EB6A 1E4UA 2LGGA 4S3OC 1WENA 4XI1A 2KIZA 5JG6A 1LDKC 2KWNA 2ECTA 4V3LC 2YSMA 2YYRA 3N9MA 3O34A 2ECNA 2K1JA 3DPLR 2MUMA 2KR4A 2JMIA 5B76A 4YBMA 2F42A 3M63A 2MIQA 5B75A 4ZDTA 4LLBA 4LKAA 2QICA 3SOXA 2CSZA 3C5KA 5B79A 2MD8C 1K2FA 3N9NA 4IC2A 5H1TA 4FK5A 1WEUA 3O37A 4MVTA 4N4FA 1X4IA 4BHWA 3FL2A 5KH9A 2VJFA 3KNVA 5FB0A 3ZVYA 5FERA 1WEWA 4CA1A 3SHBA 3PUQA 2EA6A 2LDRA 4ZQLA 2H0DA 1FP0A 3U5MA 2YSJA 2L80A 2YHOA 3C6WA 2BAYA 1X4JA 3NG2A 1WGMA 2UZGA 3T6RA 4A0CD 1MM2A 1WILA 2MA5A 1MM3A 2L75A 3U5NA 3T7LA 2KWKA 4YADA 2YUCA 2G6QA 5D1LB 2MA6A 3MHHA 4I7DA 5FB1A 3SOUA 2EODA 4YC9A 1WEVA 1JOCA 3EB5A 3LQHA 1X4UA 2Y43A 2YT5A 5C11A 4WZ0A 3GL6A 2FUUA 1DVPA 2LGVA 3L1XA 2FUIA 3U5OA 2VPBA 1FBVA 3O7AA 2PNXA 4R2YA 2G45A 2HYED 4R8PK 2CKLB 2ECVA 2Y1MA 3RPGB 5LKXA 5G0FA 2OXQC 4UP5A 3PHDA 2L5UA 4V3KC 3V43A 2DX8A 2H0DB 4WZ2A 3ZVZB 4UI9B 2KYUA 2QIZA 3O33A 2F6JA 4R7EA 2AN6A 2NAAA 2L0BA 4LJNA 5I3LA 1ZBDB 2VPGA 4PPEA 3N9PA 2YW8A 2D8SA 2LQ6A 4WZ3B 4GNEA 3HCTA 2LGLA 5D1KB 1HYIA 4N3WA 3I2DA 4YBTA 4P5OB 5H1UA 3GV4A 2JMDA 3SOWA 1XWHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AIU A;  4CCG X;  4A4C A;  4W4U A;  5LKZ A;  5EYA F;  2E6R A;  2KWJ A;  5TDW A;  1HYJ A;  2MNZ A;  2VP7 A;  2LRI C;  5AIT A;  2C2L A;  2JMJ A;  2ECI A;  4LAD B;  2KGG A;  4AYC A;  5LCW B;  2KRE A;  2RSD A;  3ZNI A;  2LXH C;  1IYM A;  2VPE A;  2K16 A;  3L1Z B;  4L7X A;  4QF3 A;  4NN2 A;  1T1H A;  4O64 A;  4LK9 A;  4GNG A;  2XB1 A;  2M85 A;  1CHC A;  4C9Z A;  1Z2Q A;  5G05 B;  5LKT A;  3KV5 A;  4AUQ B;  4YAX A;  4GB0 A;  1WES A;  3IHP A;  3N9L A;  5B78 A;  4S3O B;  1WEO A;  4F52 B;  3HCU A;  2ECW A;  5H1V A;  1N87 A;  2XEU A;  2FSA A;  4AP4 A;  4UP0 A;  1VFY A;  2YU4 A;  3U5P A;  2M1R A;  1VYX A;  2YUR A;  5B8D A;  3ZTG A;  5J3X A;  4A4B A;  3MHS A;  5LKU A;  5TAB A;  1WEQ A;  2VJF B;  2KE1 A;  3O35 A;  4YAB A;  5DKA A;  1WE9 A;  3M62 A;  1G25 A;  4PTB A;  1V87 A;  4GNF A;  5TBN A;  1WEM A;  4AYC B;  3O36 A;  2CT2 A;  4FIP A;  2YHN A;  2VPD A;  3LQJ A;  3LQI A;  1Z60 A;  4X3G A;  4FO9 A;  2F6N A;  1WFK A;  1F62 A;  2ECG A;  2M6M A;  1WIM A;  1Z6U A;  2K4D A;  2MT5 A;  3ASL A;  4I7B A;  1WEE A;  2YQM A;  2RI7 A;  3N9Q A;  3KV6 A;  3PUR A;  3ZYQ A;  2VJE A;  3ZPV 1;  3RPG C;  2KFT A;  2JRJ A;  4FJC A;  2LN0 A;  5TDR A;  2CSY A;  3HTK C;  4QF2 A;  3L11 A;  2QJ0 A;  2CKL A;  5DIN A;  4Q6F A;  2IDA A;  4L58 A;  1JM7 A;  3ZPV E;  2K17 A;  4ZUX U;  1BOR A;  1U6G B;  4MSX A;  3QZV A;  2LV9 A;  4B7Y C;  3LRQ A;  2ECJ A;  3O70 A;  4BBQ A;  5FEY A;  4A49 A;  3M99 A;  2KWO A;  2G43 A;  5B77 A;  2E6S A;  4GND A;  2VNF A;  5G04 B;  2HDP A;  1RMD A;  2LGK A;  2ZET C;  5D1M B;  3RTR B;  2KU3 A;  5TRB A;  4IC3 A;  1LDJ B;  2KGI A;  3N9O A;  2I50 A;  2EGP A;  1WEP A;  3KQI A;  2VJE B;  1VD4 A;  4AVX A;  3HCS A;  2M3H A;  2Y1N A;  4YAT A;  2MNY A;  4I7C A;  2L43 A;  2YRE A;  5H9M A;  4YBS A;  4WA6 A;  2LXP C;  5KH7 A;  3VK6 A;  4B86 C;  3DQV R;  2YQL A;  5C13 A;  4TKP B;  2MD7 B;  2PUY A;  5KH3 A;  1JM7 B;  2C2V S;  3EB6 A;  1E4U A;  2LGG A;  4S3O C;  1WEN A;  4XI1 A;  2KIZ A;  5JG6 A;  1LDK C;  2KWN A;  2ECT A;  4V3L C;  2YSM A;  2YYR A;  3N9M A;  3O34 A;  2ECN A;  2K1J A;  3DPL R;  2MUM A;  2KR4 A;  2JMI A;  5B76 A;  4YBM A;  2F42 A;  3M63 A;  2MIQ A;  5B75 A;  4ZDT A;  4LLB A;  4LKA A;  2QIC A;  3SOX A;  2CSZ A;  3C5K A;  5B79 A;  2MD8 C;  1K2F A;  3N9N A;  4IC2 A;  5H1T A;  4FK5 A;  1WEU A;  3O37 A;  4MVT A;  4N4F A;  1X4I A;  4BHW A;  3FL2 A;  5KH9 A;  2VJF A;  3KNV A;  5FB0 A;  3ZVY A;  5FER A;  1WEW A;  4CA1 A;  3SHB A;  3PUQ A;  2EA6 A;  2LDR A;  4ZQL A;  2H0D A;  1FP0 A;  3U5M A;  2YSJ A;  2L80 A;  2YHO A;  3C6W A;  2BAY A;  1X4J A;  3NG2 A;  1WGM A;  2UZG A;  3T6R A;  4A0C D;  1MM2 A;  1WIL A;  2MA5 A;  1MM3 A;  2L75 A;  3U5N A;  3T7L A;  2KWK A;  4YAD A;  2YUC A;  2G6Q A;  5D1L B;  2MA6 A;  3MHH A;  4I7D A;  5FB1 A;  3SOU A;  2EOD A;  4YC9 A;  1WEV A;  1JOC A;  3EB5 A;  3LQH A;  1X4U A;  2Y43 A;  2YT5 A;  5C11 A;  4WZ0 A;  3GL6 A;  2FUU A;  1DVP A;  2LGV A;  3L1X A;  2FUI A;  3U5O A;  2VPB A;  1FBV A;  3O7A A;  2PNX A;  4R2Y A;  2G45 A;  2HYE D;  4R8P K;  2CKL B;  2ECV A;  2Y1M A;  3RPG B;  5LKX A;  5G0F A;  2OXQ C;  4UP5 A;  3PHD A;  2L5U A;  4V3K C;  3V43 A;  2DX8 A;  2H0D B;  4WZ2 A;  3ZVZ B;  4UI9 B;  2KYU A;  2QIZ A;  3O33 A;  2F6J A;  4R7E A;  2AN6 A;  2NAA A;  2L0B A;  4LJN A;  5I3L A;  1ZBD B;  2VPG A;  4PPE A;  3N9P A;  2YW8 A;  2D8S A;  2LQ6 A;  4WZ3 B;  4GNE A;  3HCT A;  2LGL A;  5D1K B;  1HYI A;  4N3W A;  3I2D A;  4YBT A;  4P5O B;  5H1U A;  3GV4 A;  2JMD A;  3SOW A;  1XWH A; 
#chains in the Genus database with same CATH topology
 2EXU A;  5AIU A;  4CCG X;  4A4C A;  4W4U A;  5LKZ A;  5EYA F;  2E6R A;  2KWJ A;  5TDW A;  4H9D A;  1HYJ A;  2MNZ A;  2VP7 A;  2LRI C;  5AIT A;  2C2L A;  2XP0 A;  2JMJ A;  2ECI A;  4LAD B;  2KGG A;  4AYC A;  5LCW B;  2DJA A;  2KRE A;  2RSD A;  3ZNI A;  2LXH C;  1IYM A;  2VPE A;  2K16 A;  3L1Z B;  4L7X A;  4QF3 A;  4NN2 A;  1T1H A;  4O64 A;  4LK9 A;  4GNG A;  2XB1 A;  3H7H A;  2M85 A;  1CHC A;  4C9Z A;  1Z2Q A;  5G05 B;  5LKT A;  3KV5 A;  4AUQ B;  4YAX A;  4GB0 A;  1WES A;  3IHP A;  3N9L A;  5B78 A;  4S3O B;  1WEO A;  3FEH A;  4F52 B;  3HCU A;  2ECW A;  5H1V A;  1N87 A;  2XEU A;  2FSA A;  4AP4 A;  4UP0 A;  3MDB C;  1VFY A;  2YU4 A;  3U5P A;  2M1R A;  1VYX A;  2YUR A;  5B8D A;  2KKX A;  3ZTG A;  3FAO A;  5J3X A;  4A4B A;  2KKY A;  3MHS A;  5LKU A;  5TAB A;  1WEQ A;  3O47 A;  2VJF B;  2KE1 A;  3O35 A;  4YAB A;  5DKA A;  1WE9 A;  3M62 A;  1G25 A;  4PTB A;  1V87 A;  4GNF A;  5TBN A;  2D8U A;  1WEM A;  2CRR A;  4AYC B;  3O36 A;  2CT2 A;  4FIP A;  2YHN A;  2VPD A;  3LQJ A;  3LQI A;  1DCQ A;  1Z60 A;  5SVI B;  4X3G A;  4FO9 A;  2F6N A;  1WFK A;  1F62 A;  2ECG A;  2M6M A;  1WIM A;  1Z6U A;  2K4D A;  2IQJ A;  2MT5 A;  2YVR A;  3ASL A;  4I7B A;  1WEE A;  2YQM A;  5SVY A;  2RI7 A;  3N9Q A;  3KV6 A;  3PUR A;  4O62 A;  3ZYQ A;  2VJE A;  3ZPV 1;  3RPG C;  2KFT A;  2JRJ A;  4FJC A;  5SVX A;  2LN0 A;  4OGE A;  5TDR A;  2CSY A;  3HTK C;  4QF2 A;  3L11 A;  1MBM A;  2JM3 A;  2DSM A;  2QJ0 A;  2CKL A;  5DIN A;  2CSV A;  4Q6F A;  2IDA A;  4L58 A;  1JM7 A;  3ZPV E;  2K17 A;  2E61 A;  4ZUX U;  1BOR A;  1U6G B;  4MSX A;  3QZV A;  2LV9 A;  4B7Y C;  3LRQ A;  2ECJ A;  3O70 A;  5K3Q A;  4BBQ A;  5FEY A;  4A49 A;  3M99 A;  2KWO A;  2G43 A;  5B77 A;  2E6S A;  4GND A;  2VNF A;  5G04 B;  2HDP A;  1RMD A;  2LGK A;  2ZET C;  5D1M B;  3RTR B;  4OGC A;  2KU3 A;  5TRB A;  4IC3 A;  1LDJ B;  2KGI A;  4Z0R A;  3N9O A;  2I50 A;  3E2D A;  2EGP A;  1WEP A;  3KQI A;  2VJE B;  1VD4 A;  4AVX A;  3HCS A;  2M3H A;  2JUN A;  2Y1N A;  4YAT A;  2MNY A;  4I7C A;  2L43 A;  2YRE A;  5H9M A;  4YBS A;  4WA6 A;  2LXP C;  5KH7 A;  3VK6 A;  4B86 C;  3DQV R;  2YQL A;  5C13 A;  4TKP B;  2MD7 B;  2PUY A;  5KH3 A;  1JM7 B;  2C2V S;  3EB6 A;  2XOY A;  1E4U A;  2LGG A;  4S3O C;  1WEN A;  4XI1 A;  2KIZ A;  5JG6 A;  1LDK C;  2KWN A;  2ECT A;  4V3L C;  2YSM A;  2YYR A;  3N9M A;  3O34 A;  2ECN A;  3T9K A;  2K1J A;  3DPL R;  3SUB A;  2MUM A;  2KR4 A;  2JMI A;  5B76 A;  4YBM A;  2F42 A;  3M63 A;  2MIQ A;  5B75 A;  4ZDT A;  3LJU X;  3Q1D A;  4LLB A;  4LKA A;  2QIC A;  3SOX A;  2EGM A;  2CSZ A;  3C5K A;  5B79 A;  2MD8 C;  1K2F A;  2CON A;  3N9N A;  4IC2 A;  5H1T A;  2P57 A;  4FK5 A;  1WEU A;  2OWA A;  3FJU B;  3O37 A;  2LAU A;  4QQ4 A;  4MVT A;  4N4F A;  1X4I A;  4BHW A;  3FL2 A;  5KH9 A;  2VJF A;  3KNV A;  5FB0 A;  3ZVY A;  5FER A;  1WEW A;  4CA1 A;  3SHB A;  2M13 A;  3PUQ A;  3DWD A;  2MKE A;  4F1P A;  2EA6 A;  2LDR A;  4ZQL A;  2H0D A;  1FP0 A;  3U5M A;  3JUE A;  2YSJ A;  2L80 A;  2YHO A;  3C6W A;  2BAY A;  1X4J A;  2CRW A;  3NG2 A;  5SVI A;  1WGM A;  2UZG A;  3T6R A;  4A0C D;  1MM2 A;  1WIL A;  2MA5 A;  1MM3 A;  2L75 A;  2B0O E;  3U5N A;  3FM8 C;  3T7L A;  2KWK A;  4YAD A;  2YUC A;  2G6Q A;  5D1L B;  2MA6 A;  3MHH A;  4I7D A;  5FB1 A;  3SOU A;  2EOD A;  2FFW A;  4YC9 A;  1WEV A;  1JOC A;  3EB5 A;  3LQH A;  1X4U A;  2Y43 A;  2YT5 A;  5C11 A;  4WZ0 A;  3GL6 A;  2FUU A;  4Z0O A;  1DVP A;  2LGV A;  3L1X A;  2FUI A;  3U5O A;  3PLW A;  2VPB A;  1FBV A;  3M7K A;  3O7A A;  2PNX A;  3DDT A;  4R2Y A;  2G45 A;  2HYE D;  4R8P K;  2CKL B;  2ECV A;  2Y1M A;  3RPG B;  2FD4 A;  5LKX A;  5G0F A;  2XOZ A;  2OXQ C;  4UP5 A;  3LVQ E;  3KDE C;  3PHD A;  2L5U A;  4V3K C;  3V43 A;  2DX8 A;  2H0D B;  4WZ2 A;  3ZVZ B;  4UI9 B;  2KYU A;  3LVR E;  2QIZ A;  3O33 A;  2F6J A;  3LDY A;  4R7E A;  3FAN A;  2AN6 A;  2NAA A;  2L0B A;  4LJN A;  5I3L A;  1ZBD B;  2VPG A;  4PPE A;  3N9P A;  2YW8 A;  2D8S A;  2LQ6 A;  4WZ3 B;  4GNE A;  3HCT A;  2RR4 A;  2L7P A;  2LGL A;  5D1K B;  1HYI A;  4N3W A;  3I2D A;  4YBT A;  4P5O B;  5H1U A;  2XOC A;  3GV4 A;  2JMD A;  3SOW A;  1XWH A; 
#chains in the Genus database with same CATH homology
 5AIU A;  4CCG X;  4A4C A;  4W4U A;  5LKZ A;  5EYA F;  2E6R A;  2KWJ A;  5TDW A;  1HYJ A;  2MNZ A;  2VP7 A;  2LRI C;  5AIT A;  2C2L A;  2JMJ A;  2ECI A;  4LAD B;  2KGG A;  4AYC A;  5LCW B;  2KRE A;  2RSD A;  3ZNI A;  2LXH C;  1IYM A;  2VPE A;  2K16 A;  3L1Z B;  4L7X A;  4QF3 A;  4NN2 A;  1T1H A;  4O64 A;  4LK9 A;  4GNG A;  2XB1 A;  2M85 A;  1CHC A;  4C9Z A;  1Z2Q A;  5G05 B;  5LKT A;  3KV5 A;  4AUQ B;  4YAX A;  4GB0 A;  1WES A;  3IHP A;  3N9L A;  5B78 A;  4S3O B;  1WEO A;  4F52 B;  3HCU A;  2ECW A;  5H1V A;  1N87 A;  2XEU A;  2FSA A;  4AP4 A;  4UP0 A;  1VFY A;  2YU4 A;  3U5P A;  2M1R A;  1VYX A;  2YUR A;  5B8D A;  3ZTG A;  5J3X A;  4A4B A;  3MHS A;  5LKU A;  5TAB A;  1WEQ A;  2VJF B;  2KE1 A;  3O35 A;  4YAB A;  5DKA A;  1WE9 A;  3M62 A;  1G25 A;  4PTB A;  1V87 A;  4GNF A;  5TBN A;  1WEM A;  4AYC B;  3O36 A;  2CT2 A;  4FIP A;  2YHN A;  2VPD A;  3LQJ A;  3LQI A;  1Z60 A;  4X3G A;  4FO9 A;  2F6N A;  1WFK A;  1F62 A;  2ECG A;  2M6M A;  1WIM A;  1Z6U A;  2K4D A;  2MT5 A;  3ASL A;  4I7B A;  1WEE A;  2YQM A;  2RI7 A;  3N9Q A;  3KV6 A;  3PUR A;  3ZYQ A;  2VJE A;  3ZPV 1;  3RPG C;  2KFT A;  2JRJ A;  4FJC A;  2LN0 A;  5TDR A;  2CSY A;  3HTK C;  4QF2 A;  3L11 A;  2QJ0 A;  2CKL A;  5DIN A;  4Q6F A;  2IDA A;  4L58 A;  1JM7 A;  3ZPV E;  2K17 A;  4ZUX U;  1BOR A;  1U6G B;  4MSX A;  3QZV A;  2LV9 A;  4B7Y C;  3LRQ A;  2ECJ A;  3O70 A;  4BBQ A;  5FEY A;  4A49 A;  3M99 A;  2KWO A;  2G43 A;  5B77 A;  2E6S A;  4GND A;  2VNF A;  5G04 B;  2HDP A;  1RMD A;  2LGK A;  2ZET C;  5D1M B;  3RTR B;  2KU3 A;  5TRB A;  4IC3 A;  1LDJ B;  2KGI A;  3N9O A;  2I50 A;  2EGP A;  1WEP A;  3KQI A;  2VJE B;  1VD4 A;  4AVX A;  3HCS A;  2M3H A;  2Y1N A;  4YAT A;  2MNY A;  4I7C A;  2L43 A;  2YRE A;  5H9M A;  4YBS A;  4WA6 A;  2LXP C;  5KH7 A;  3VK6 A;  4B86 C;  3DQV R;  2YQL A;  5C13 A;  4TKP B;  2MD7 B;  2PUY A;  5KH3 A;  1JM7 B;  2C2V S;  3EB6 A;  1E4U A;  2LGG A;  4S3O C;  1WEN A;  4XI1 A;  2KIZ A;  5JG6 A;  1LDK C;  2KWN A;  2ECT A;  4V3L C;  2YSM A;  2YYR A;  3N9M A;  3O34 A;  2ECN A;  2K1J A;  3DPL R;  2MUM A;  2KR4 A;  2JMI A;  5B76 A;  4YBM A;  2F42 A;  3M63 A;  2MIQ A;  5B75 A;  4ZDT A;  4LLB A;  4LKA A;  2QIC A;  3SOX A;  2CSZ A;  3C5K A;  5B79 A;  2MD8 C;  1K2F A;  3N9N A;  4IC2 A;  5H1T A;  4FK5 A;  1WEU A;  3O37 A;  4MVT A;  4N4F A;  1X4I A;  4BHW A;  3FL2 A;  5KH9 A;  2VJF A;  3KNV A;  5FB0 A;  3ZVY A;  5FER A;  1WEW A;  4CA1 A;  3SHB A;  3PUQ A;  2EA6 A;  2LDR A;  4ZQL A;  2H0D A;  1FP0 A;  3U5M A;  2YSJ A;  2L80 A;  2YHO A;  3C6W A;  2BAY A;  1X4J A;  3NG2 A;  1WGM A;  2UZG A;  3T6R A;  4A0C D;  1MM2 A;  1WIL A;  2MA5 A;  1MM3 A;  2L75 A;  3U5N A;  3T7L A;  2KWK A;  4YAD A;  2YUC A;  2G6Q A;  5D1L B;  2MA6 A;  3MHH A;  4I7D A;  5FB1 A;  3SOU A;  2EOD A;  4YC9 A;  1WEV A;  1JOC A;  3EB5 A;  3LQH A;  1X4U A;  2Y43 A;  2YT5 A;  5C11 A;  4WZ0 A;  3GL6 A;  2FUU A;  1DVP A;  2LGV A;  3L1X A;  2FUI A;  3U5O A;  2VPB A;  1FBV A;  3O7A A;  2PNX A;  4R2Y A;  2G45 A;  2HYE D;  4R8P K;  2CKL B;  2ECV A;  2Y1M A;  3RPG B;  5LKX A;  5G0F A;  2OXQ C;  4UP5 A;  3PHD A;  2L5U A;  4V3K C;  3V43 A;  2DX8 A;  2H0D B;  4WZ2 A;  3ZVZ B;  4UI9 B;  2KYU A;  2QIZ A;  3O33 A;  2F6J A;  4R7E A;  2AN6 A;  2NAA A;  2L0B A;  4LJN A;  5I3L A;  1ZBD B;  2VPG A;  4PPE A;  3N9P A;  2YW8 A;  2D8S A;  2LQ6 A;  4WZ3 B;  4GNE A;  3HCT A;  2LGL A;  5D1K B;  1HYI A;  4N3W A;  3I2D A;  4YBT A;  4P5O B;  5H1U A;  3GV4 A;  2JMD A;  3SOW A;  1XWH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...