1HYJA

Solution structure of the eea1 fyve domain
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
65
structure length
65
Chain Sequence
RKWAEDNEVQNCMACGKGFSVTVRRHHCRQCGNIFCAECSAKNALTPSSKKPVRVCDACFNDLQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural mechanism of endosome docking by the FYVE domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Endocytosis/exocytosis
molecule keywords ENDOSOME-ASSOCIATED PROTEIN
total genus 4
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2001-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01363 FYVE FYVE zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 1hyjA00
2Y1NA 4LKAA 2JMJA 2EODA 5KH9A 2FSAA 3U5PA 2KU3A 3T6RA 5D1MB 2M1RA 4ZDTA 4BHWA 1N87A 2KYUA 2FUIA 4ZQLA 4FIPA 3I2DA 4AP4A 4I7BA 1WESA 2VJEA 2ECNA 3N9OA 3KQIA 1FBVA 2LGGA 3ZYQA 2G45A 3ZVYA 3IHPA 3U5NA 1U6GB 3SOWA 4YABA 5LKTA 3PURA 2YREA 4B86C 3NG2A 5B78A 1VYXA 1WEWA 2YT5A 1WEPA 2Y1MA 1RMDA 1WEUA 2ECTA 4GNEA 1MM3A 3ASLA 2KWOA 2JRJA 3C5KA 4FO9A 4AUQB 4A4CA 2K1JA 3ZPVE 2YHOA 2EGPA 2L43A 2VJEB 2YURA 1Z60A 2YQMA 1K2FA 5EYAF 5TABA 1FP0A 3U5OA 4V3KC 3V43A 3SHBA 3C6WA 2H0DA 2YHNA 1WGMA 2VPDA 3ZTGA 4CCGX 2HYED 3MHSA 3SOXA 2KGGA 2ECIA 1HYJA 2CSYA 5D1KB 2VPGA 5DKAA 2E6SA 2VNFA 2KR4A 4TKPB 1E4UA 2LRIC 1WEQA 4WA6A 4YAXA 4Q6FA 1LDJB 5TDRA 3RPGC 5G04B 2VJFB 4YBMA 2QIZA 1WIMA 5G05B 3M99A 4LK9A 2F42A 1X4IA 2NAAA 3ZPV1 4GNFA 2KWNA 2HDPA 2LN0A 5B8DA 1CHCA 4F52B 2VPEA 2EA6A 1Z6UA 5B79A 5B77A 2C2VS 5KH7A 4YC9A 4PPEA 1WFKA 2XB1A 2VP7A 2H0DB 2UZGA 3N9LA 5FB1A 3U5MA 5DINA 2CSZA 1WEVA 4GNGA 4GNDA 2M6MA 2K17A 3O70A 3N9MA 4R7EA 4WZ0A 3N9PA 4IC3A 3FL2A 2LGVA 2I50A 1X4JA 2ECJA 4L7XA 2VPBA 5D1LB 4AYCA 1WEMA 1XWHA 4A0CD 5LCWB 4MSXA 1DVPA 2ECVA 3HCUA 2MNYA 4V3LC 2PNXA 2RSDA 2L0BA 4R2YA 2L75A 5C11A 2OXQC 4UP5A 2YW8A 4AVXA 4I7CA 1VD4A 5C13A 3M63A 4I7DA 1WEEA 1JM7B 2L80A 4FK5A 4B7YC 2L5UA 3N9QA 3M62A 3EB6A 5JG6A 5FEYA 4LLBA 2YQLA 5H1UA 4IC2A 1WILA 2LQ6A 1WEOA 1WE9A 3O37A 4O64A 4XI1A 2MUMA 3LQHA 2LDRA 5J3XA 3RTRB 2KWKA 4N4FA 5KH3A 2D8SA 5LKZA 4MVTA 3N9NA 2LGKA 2LXPC 4AYCB 2KGIA 5LKXA 3ZNIA 3DQVR 3VK6A 2KE1A 4YBSA 2F6JA 4N3WA 1X4UA 5B76A 3KV6A 4X3GA 4R8PK 5G0FA 5TDWA 3RPGB 1V87A 4S3OB 2YUCA 4NN2A 4BBQA 5LKUA 2KWJA 2MA5A 1WENA 1JOCA 1JM7A 3PUQA 2BAYA 2G43A 2CKLA 1MM2A 2FUUA 2Y43A 3O34A 4UI9B 1VFYA 2M3HA 4L58A 2G6QA 4P5OB 2YYRA 4A49A 2YU4A 4LJNA 2KFTA 2LGLA 4W4UA 4CA1A 4UP0A 2ECWA 2ZETC 3KV5A 4WZ3B 3HTKC 3L11A 5FB0A 4YADA 2E6RA 4QF3A 1ZBDB 3L1XA 2MA6A 4LADB 3L1ZB 5B75A 2IDAA 5AITA 1Z2QA 2MD7B 1F62A 2JMIA 4YBTA 5TBNA 3HCSA 3T7LA 3KNVA 3LQIA 2MD8C 2KIZA 3SOUA 1BORA 2CKLB 3ZVZB 2DX8A 4YATA 1LDKC 4S3OC 2ECGA 3QZVA 3MHHA 5H9MA 3GV4A 4C9ZA 2QJ0A 3DPLR 5H1VA 5TRBA 3HCTA 2K16A 2CT2A 2PUYA 2XEUA 3EB5A 2F6NA 5FERA 2AN6A 2LV9A 2YSMA 3O36A 2C2LA 2RI7A 4A4BA 3GL6A 3O33A 5AIUA 4GB0A 2MT5A 3PHDA 2JMDA 4FJCA 2YSJA 1HYIA 2MNZA 2VJFA 3LQJA 1T1HA 2K4DA 5I3LA 2M85A 2MIQA 3LRQA 4ZUXU 3O35A 4QF2A 2LXHC 2QICA 3O7AA 4WZ2A 2KREA 1G25A 1IYMA 4PTBA 5H1TA
chains in the Genus database with same CATH superfamily
2Y1NA 4LKAA 2JMJA 2EODA 5KH9A 4OGCA 2FSAA 3U5PA 2KU3A 3T6RA 2FFWA 5D1MB 2M1RA 4ZDTA 4BHWA 1N87A 2KYUA 2FUIA 4ZQLA 4FIPA 3I2DA 4AP4A 2B0OE 3LDYA 4I7BA 1WESA 2VJEA 2ECNA 3N9OA 3KQIA 1FBVA 3FJUB 2LGGA 3ZYQA 2G45A 3ZVYA 3IHPA 3U5NA 1U6GB 3M7KA 3SOWA 4YABA 5LKTA 3PURA 2YREA 4B86C 3FEHA 3NG2A 5B78A 1VYXA 1MBMA 1WEWA 2YT5A 1WEPA 2Y1MA 1RMDA 1WEUA 2ECTA 4GNEA 1MM3A 3ASLA 2KWOA 2JRJA 3SUBA 3C5KA 4FO9A 2RR4A 4AUQB 2EXUA 4QQ4A 3LJUX 4A4CA 2K1JA 3ZPVE 2YHOA 2EGPA 2L43A 2VJEB 2YURA 1Z60A 2YQMA 1K2FA 5EYAF 5TABA 1FP0A 3U5OA 4V3KC 3V43A 3T9KA 3SHBA 3C6WA 2H0DA 2YHNA 1WGMA 2VPDA 3ZTGA 4CCGX 2HYED 3MHSA 3SOXA 2KGGA 2ECIA 1HYJA 2CSYA 5D1KB 2LAUA 2DSMA 2VPGA 5DKAA 3O47A 2E6SA 2VNFA 2KR4A 4TKPB 1E4UA 3FM8C 2LRIC 2YVRA 1WEQA 4WA6A 4YAXA 4Q6FA 1LDJB 2CSVA 5TDRA 3RPGC 5G04B 2VJFB 4YBMA 2QIZA 1WIMA 5G05B 3M99A 4LK9A 2F42A 1X4IA 2NAAA 3FANA 3ZPV1 4GNFA 2KWNA 2E61A 2HDPA 2LN0A 5B8DA 1CHCA 4F52B 2VPEA 2EA6A 2IQJA 1Z6UA 5B79A 5B77A 2C2VS 5KH7A 4YC9A 4PPEA 1WFKA 2XB1A 2VP7A 2H0DB 2UZGA 3N9LA 3DWDA 5FB1A 3U5MA 5SVXA 5DINA 2CSZA 1WEVA 4GNGA 4GNDA 2M6MA 2K17A 3O70A 3N9MA 4R7EA 4WZ0A 3N9PA 4IC3A 3FL2A 2CONA 4Z0OA 2LGVA 2I50A 1X4JA 4L7XA 2D8UA 2ECJA 2VPBA 3Q1DA 5D1LB 4AYCA 1WEMA 1XWHA 4A0CD 3LVQE 5LCWB 4MSXA 1DVPA 2ECVA 3HCUA 2MNYA 4V3LC 2PNXA 2RSDA 2L0BA 4R2YA 2L75A 4O62A 5C11A 2OXQC 4UP5A 2YW8A 2XP0A 4I7CA 4AVXA 1VD4A 5C13A 3M63A 4I7DA 1WEEA 1JM7B 2L80A 2OWAA 4FK5A 4B7YC 2L5UA 3N9QA 3M62A 3EB6A 2L7PA 5JG6A 5FEYA 4LLBA 3LVRE 2YQLA 5H1UA 4IC2A 1WILA 2LQ6A 1WEOA 1WE9A 3O37A 4O64A 4XI1A 2MUMA 3LQHA 2LDRA 5J3XA 3RTRB 2KWKA 4N4FA 2DJAA 5KH3A 2D8SA 5LKZA 4MVTA 3N9NA 2LGKA 2LXPC 3FAOA 4AYCB 2KGIA 5LKXA 2CRWA 3ZNIA 3DQVR 3VK6A 2KE1A 4YBSA 2F6JA 4N3WA 1X4UA 5B76A 3KV6A 4X3GA 4R8PK 5G0FA 5TDWA 3RPGB 1V87A 4S3OB 2YUCA 4NN2A 4BBQA 5LKUA 2JM3A 2KWJA 2MA5A 1WENA 1JOCA 1JM7A 3PUQA 2BAYA 2G43A 2CKLA 2XOCA 3PLWA 1MM2A 2FUUA 2Y43A 3O34A 4UI9B 1VFYA 2M3HA 4L58A 2G6QA 4P5OB 5SVIB 3DDTA 2YYRA 4A49A 2YU4A 4LJNA 2KFTA 2LGLA 2M13A 4W4UA 4CA1A 4UP0A 2ECWA 2ZETC 3KV5A 4WZ3B 3H7HA 3E2DA 3HTKC 3L11A 5FB0A 4YADA 2E6RA 4QF3A 1ZBDB 3L1XA 2MA6A 4LADB 3L1ZB 5B75A 2IDAA 5AITA 3KDEC 1Z2QA 3MDBC 2MD7B 1F62A 2JMIA 4YBTA 2FD4A 2KKXA 5TBNA 3HCSA 3T7LA 5K3QA 3KNVA 3LQIA 4OGEA 2MD8C 2KIZA 2XOYA 3SOUA 2P57A 1BORA 2CKLB 3ZVZB 2DX8A 4YATA 1LDKC 4S3OC 2ECGA 2EGMA 2XOZA 3QZVA 3MHHA 5H9MA 3GV4A 5SVIA 4C9ZA 2QJ0A 3DPLR 5H1VA 5TRBA 3HCTA 2K16A 2CT2A 2PUYA 2XEUA 3EB5A 2CRRA 2F6NA 5FERA 2AN6A 2LV9A 2YSMA 3O36A 2C2LA 2RI7A 4A4BA 3GL6A 3O33A 2MKEA 5AIUA 4GB0A 2MT5A 4F1PA 3PHDA 2JMDA 4FJCA 2YSJA 2KKYA 1HYIA 2MNZA 2VJFA 3LQJA 1T1HA 2K4DA 5I3LA 5SVYA 2M85A 2MIQA 3LRQA 4ZUXU 3O35A 2JUNA 1DCQA 4QF2A 4Z0RA 2LXHC 3JUEA 2QICA 3O7AA 4WZ2A 2KREA 4H9DA 1G25A 1IYMA 4PTBA 5H1TA
chains in the Genus database with same CATH topology
2Y1NA 4LKAA 2JMJA 2EODA 5KH9A 2FSAA 3U5PA 2KU3A 3T6RA 5D1MB 2M1RA 4ZDTA 4BHWA 1N87A 2KYUA 2FUIA 4ZQLA 4FIPA 3I2DA 4AP4A 4I7BA 1WESA 2VJEA 2ECNA 3N9OA 3KQIA 1FBVA 2LGGA 3ZYQA 2G45A 3ZVYA 3IHPA 3U5NA 1U6GB 3SOWA 4YABA 5LKTA 3PURA 2YREA 4B86C 3NG2A 5B78A 1VYXA 1WEWA 2YT5A 1WEPA 2Y1MA 1RMDA 1WEUA 2ECTA 4GNEA 1MM3A 3ASLA 2KWOA 2JRJA 3C5KA 4FO9A 4AUQB 4A4CA 2K1JA 3ZPVE 2YHOA 2EGPA 2L43A 2VJEB 2YURA 1Z60A 2YQMA 1K2FA 5EYAF 5TABA 1FP0A 3U5OA 4V3KC 3V43A 3SHBA 3C6WA 2H0DA 2YHNA 1WGMA 2VPDA 3ZTGA 4CCGX 2HYED 3MHSA 3SOXA 2KGGA 2ECIA 1HYJA 2CSYA 5D1KB 2VPGA 5DKAA 2E6SA 2VNFA 2KR4A 4TKPB 1E4UA 2LRIC 1WEQA 4WA6A 4YAXA 4Q6FA 1LDJB 5TDRA 3RPGC 5G04B 2VJFB 4YBMA 2QIZA 1WIMA 5G05B 3M99A 4LK9A 2F42A 1X4IA 2NAAA 3ZPV1 4GNFA 2KWNA 2HDPA 2LN0A 5B8DA 1CHCA 4F52B 2VPEA 2EA6A 1Z6UA 5B79A 5B77A 2C2VS 5KH7A 4YC9A 4PPEA 1WFKA 2XB1A 2VP7A 2H0DB 2UZGA 3N9LA 5FB1A 3U5MA 5DINA 2CSZA 1WEVA 4GNGA 4GNDA 2M6MA 2K17A 3O70A 3N9MA 4R7EA 4WZ0A 3N9PA 4IC3A 3FL2A 2LGVA 2I50A 1X4JA 2ECJA 4L7XA 2VPBA 5D1LB 4AYCA 1WEMA 1XWHA 4A0CD 5LCWB 4MSXA 1DVPA 2ECVA 3HCUA 2MNYA 4V3LC 2PNXA 2RSDA 2L0BA 4R2YA 2L75A 5C11A 2OXQC 4UP5A 2YW8A 4AVXA 4I7CA 1VD4A 5C13A 3M63A 4I7DA 1WEEA 1JM7B 2L80A 4FK5A 4B7YC 2L5UA 3N9QA 3M62A 3EB6A 5JG6A 5FEYA 4LLBA 2YQLA 5H1UA 4IC2A 1WILA 2LQ6A 1WEOA 1WE9A 3O37A 4O64A 4XI1A 2MUMA 3LQHA 2LDRA 5J3XA 3RTRB 2KWKA 4N4FA 5KH3A 2D8SA 5LKZA 4MVTA 3N9NA 2LGKA 2LXPC 4AYCB 2KGIA 5LKXA 3ZNIA 3DQVR 3VK6A 2KE1A 4YBSA 2F6JA 4N3WA 1X4UA 5B76A 3KV6A 4X3GA 4R8PK 5G0FA 5TDWA 3RPGB 1V87A 4S3OB 2YUCA 4NN2A 4BBQA 5LKUA 2KWJA 2MA5A 1WENA 1JOCA 1JM7A 3PUQA 2BAYA 2G43A 2CKLA 1MM2A 2FUUA 2Y43A 3O34A 4UI9B 1VFYA 2M3HA 4L58A 2G6QA 4P5OB 2YYRA 4A49A 2YU4A 4LJNA 2KFTA 2LGLA 4W4UA 4CA1A 4UP0A 2ECWA 2ZETC 3KV5A 4WZ3B 3HTKC 3L11A 5FB0A 4YADA 2E6RA 4QF3A 1ZBDB 3L1XA 2MA6A 4LADB 3L1ZB 5B75A 2IDAA 5AITA 1Z2QA 2MD7B 1F62A 2JMIA 4YBTA 5TBNA 3HCSA 3T7LA 3KNVA 3LQIA 2MD8C 2KIZA 3SOUA 1BORA 2CKLB 3ZVZB 2DX8A 4YATA 1LDKC 4S3OC 2ECGA 3QZVA 3MHHA 5H9MA 3GV4A 4C9ZA 2QJ0A 3DPLR 5H1VA 5TRBA 3HCTA 2K16A 2CT2A 2PUYA 2XEUA 3EB5A 2F6NA 5FERA 2AN6A 2LV9A 2YSMA 3O36A 2C2LA 2RI7A 4A4BA 3GL6A 3O33A 5AIUA 4GB0A 2MT5A 3PHDA 2JMDA 4FJCA 2YSJA 1HYIA 2MNZA 2VJFA 3LQJA 1T1HA 2K4DA 5I3LA 2M85A 2MIQA 3LRQA 4ZUXU 3O35A 4QF2A 2LXHC 2QICA 3O7AA 4WZ2A 2KREA 1G25A 1IYMA 4PTBA 5H1TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y1N A;  4LKA A;  2JMJ A;  2EOD A;  5KH9 A;  2FSA A;  3U5P A;  2KU3 A;  3T6R A;  5D1M B;  2M1R A;  4ZDT A;  4BHW A;  1N87 A;  2KYU A;  2FUI A;  4ZQL A;  4FIP A;  3I2D A;  4AP4 A;  4I7B A;  1WES A;  2VJE A;  2ECN A;  3N9O A;  3KQI A;  1FBV A;  2LGG A;  3ZYQ A;  2G45 A;  3ZVY A;  3IHP A;  3U5N A;  1U6G B;  3SOW A;  4YAB A;  5LKT A;  3PUR A;  2YRE A;  4B86 C;  3NG2 A;  5B78 A;  1VYX A;  1WEW A;  2YT5 A;  1WEP A;  2Y1M A;  1RMD A;  1WEU A;  2ECT A;  4GNE A;  1MM3 A;  3ASL A;  2KWO A;  2JRJ A;  3C5K A;  4FO9 A;  4AUQ B;  4A4C A;  2K1J A;  3ZPV E;  2YHO A;  2EGP A;  2L43 A;  2VJE B;  2YUR A;  1Z60 A;  2YQM A;  1K2F A;  5EYA F;  5TAB A;  1FP0 A;  3U5O A;  4V3K C;  3V43 A;  3SHB A;  3C6W A;  2H0D A;  2YHN A;  1WGM A;  2VPD A;  3ZTG A;  4CCG X;  2HYE D;  3MHS A;  3SOX A;  2KGG A;  2ECI A;  1HYJ A;  2CSY A;  5D1K B;  2VPG A;  5DKA A;  2E6S A;  2VNF A;  2KR4 A;  4TKP B;  1E4U A;  2LRI C;  1WEQ A;  4WA6 A;  4YAX A;  4Q6F A;  1LDJ B;  5TDR A;  3RPG C;  5G04 B;  2VJF B;  4YBM A;  2QIZ A;  1WIM A;  5G05 B;  3M99 A;  4LK9 A;  2F42 A;  1X4I A;  2NAA A;  3ZPV 1;  4GNF A;  2KWN A;  2HDP A;  2LN0 A;  5B8D A;  1CHC A;  4F52 B;  2VPE A;  2EA6 A;  1Z6U A;  5B79 A;  5B77 A;  2C2V S;  5KH7 A;  4YC9 A;  4PPE A;  1WFK A;  2XB1 A;  2VP7 A;  2H0D B;  2UZG A;  3N9L A;  5FB1 A;  3U5M A;  5DIN A;  2CSZ A;  1WEV A;  4GNG A;  4GND A;  2M6M A;  2K17 A;  3O70 A;  3N9M A;  4R7E A;  4WZ0 A;  3N9P A;  4IC3 A;  3FL2 A;  2LGV A;  2I50 A;  1X4J A;  2ECJ A;  4L7X A;  2VPB A;  5D1L B;  4AYC A;  1WEM A;  1XWH A;  4A0C D;  5LCW B;  4MSX A;  1DVP A;  2ECV A;  3HCU A;  2MNY A;  4V3L C;  2PNX A;  2RSD A;  2L0B A;  4R2Y A;  2L75 A;  5C11 A;  2OXQ C;  4UP5 A;  2YW8 A;  4AVX A;  4I7C A;  1VD4 A;  5C13 A;  3M63 A;  4I7D A;  1WEE A;  1JM7 B;  2L80 A;  4FK5 A;  4B7Y C;  2L5U A;  3N9Q A;  3M62 A;  3EB6 A;  5JG6 A;  5FEY A;  4LLB A;  2YQL A;  5H1U A;  4IC2 A;  1WIL A;  2LQ6 A;  1WEO A;  1WE9 A;  3O37 A;  4O64 A;  4XI1 A;  2MUM A;  3LQH A;  2LDR A;  5J3X A;  3RTR B;  2KWK A;  4N4F A;  5KH3 A;  2D8S A;  5LKZ A;  4MVT A;  3N9N A;  2LGK A;  2LXP C;  4AYC B;  2KGI A;  5LKX A;  3ZNI A;  3DQV R;  3VK6 A;  2KE1 A;  4YBS A;  2F6J A;  4N3W A;  1X4U A;  5B76 A;  3KV6 A;  4X3G A;  4R8P K;  5G0F A;  5TDW A;  3RPG B;  1V87 A;  4S3O B;  2YUC A;  4NN2 A;  4BBQ A;  5LKU A;  2KWJ A;  2MA5 A;  1WEN A;  1JOC A;  1JM7 A;  3PUQ A;  2BAY A;  2G43 A;  2CKL A;  1MM2 A;  2FUU A;  2Y43 A;  3O34 A;  4UI9 B;  1VFY A;  2M3H A;  4L58 A;  2G6Q A;  4P5O B;  2YYR A;  4A49 A;  2YU4 A;  4LJN A;  2KFT A;  2LGL A;  4W4U A;  4CA1 A;  4UP0 A;  2ECW A;  2ZET C;  3KV5 A;  4WZ3 B;  3HTK C;  3L11 A;  5FB0 A;  4YAD A;  2E6R A;  4QF3 A;  1ZBD B;  3L1X A;  2MA6 A;  4LAD B;  3L1Z B;  5B75 A;  2IDA A;  5AIT A;  1Z2Q A;  2MD7 B;  1F62 A;  2JMI A;  4YBT A;  5TBN A;  3HCS A;  3T7L A;  3KNV A;  3LQI A;  2MD8 C;  2KIZ A;  3SOU A;  1BOR A;  2CKL B;  3ZVZ B;  2DX8 A;  4YAT A;  1LDK C;  4S3O C;  2ECG A;  3QZV A;  3MHH A;  5H9M A;  3GV4 A;  4C9Z A;  2QJ0 A;  3DPL R;  5H1V A;  5TRB A;  3HCT A;  2K16 A;  2CT2 A;  2PUY A;  2XEU A;  3EB5 A;  2F6N A;  5FER A;  2AN6 A;  2LV9 A;  2YSM A;  3O36 A;  2C2L A;  2RI7 A;  4A4B A;  3GL6 A;  3O33 A;  5AIU A;  4GB0 A;  2MT5 A;  3PHD A;  2JMD A;  4FJC A;  2YSJ A;  1HYI A;  2MNZ A;  2VJF A;  3LQJ A;  1T1H A;  2K4D A;  5I3L A;  2M85 A;  2MIQ A;  3LRQ A;  4ZUX U;  3O35 A;  4QF2 A;  2LXH C;  2QIC A;  3O7A A;  4WZ2 A;  2KRE A;  1G25 A;  1IYM A;  4PTB A;  5H1T A; 
#chains in the Genus database with same CATH topology
 2Y1N A;  4LKA A;  2JMJ A;  2EOD A;  5KH9 A;  4OGC A;  2FSA A;  3U5P A;  2KU3 A;  3T6R A;  2FFW A;  5D1M B;  2M1R A;  4ZDT A;  4BHW A;  1N87 A;  2KYU A;  2FUI A;  4ZQL A;  4FIP A;  3I2D A;  4AP4 A;  2B0O E;  3LDY A;  4I7B A;  1WES A;  2VJE A;  2ECN A;  3N9O A;  3KQI A;  1FBV A;  3FJU B;  2LGG A;  3ZYQ A;  2G45 A;  3ZVY A;  3IHP A;  3U5N A;  1U6G B;  3M7K A;  3SOW A;  4YAB A;  5LKT A;  3PUR A;  2YRE A;  4B86 C;  3FEH A;  3NG2 A;  5B78 A;  1VYX A;  1MBM A;  1WEW A;  2YT5 A;  1WEP A;  2Y1M A;  1RMD A;  1WEU A;  2ECT A;  4GNE A;  1MM3 A;  3ASL A;  2KWO A;  2JRJ A;  3SUB A;  3C5K A;  4FO9 A;  2RR4 A;  4AUQ B;  2EXU A;  4QQ4 A;  3LJU X;  4A4C A;  2K1J A;  3ZPV E;  2YHO A;  2EGP A;  2L43 A;  2VJE B;  2YUR A;  1Z60 A;  2YQM A;  1K2F A;  5EYA F;  5TAB A;  1FP0 A;  3U5O A;  4V3K C;  3V43 A;  3T9K A;  3SHB A;  3C6W A;  2H0D A;  2YHN A;  1WGM A;  2VPD A;  3ZTG A;  4CCG X;  2HYE D;  3MHS A;  3SOX A;  2KGG A;  2ECI A;  1HYJ A;  2CSY A;  5D1K B;  2LAU A;  2DSM A;  2VPG A;  5DKA A;  3O47 A;  2E6S A;  2VNF A;  2KR4 A;  4TKP B;  1E4U A;  3FM8 C;  2LRI C;  2YVR A;  1WEQ A;  4WA6 A;  4YAX A;  4Q6F A;  1LDJ B;  2CSV A;  5TDR A;  3RPG C;  5G04 B;  2VJF B;  4YBM A;  2QIZ A;  1WIM A;  5G05 B;  3M99 A;  4LK9 A;  2F42 A;  1X4I A;  2NAA A;  3FAN A;  3ZPV 1;  4GNF A;  2KWN A;  2E61 A;  2HDP A;  2LN0 A;  5B8D A;  1CHC A;  4F52 B;  2VPE A;  2EA6 A;  2IQJ A;  1Z6U A;  5B79 A;  5B77 A;  2C2V S;  5KH7 A;  4YC9 A;  4PPE A;  1WFK A;  2XB1 A;  2VP7 A;  2H0D B;  2UZG A;  3N9L A;  3DWD A;  5FB1 A;  3U5M A;  5SVX A;  5DIN A;  2CSZ A;  1WEV A;  4GNG A;  4GND A;  2M6M A;  2K17 A;  3O70 A;  3N9M A;  4R7E A;  4WZ0 A;  3N9P A;  4IC3 A;  3FL2 A;  2CON A;  4Z0O A;  2LGV A;  2I50 A;  1X4J A;  4L7X A;  2D8U A;  2ECJ A;  2VPB A;  3Q1D A;  5D1L B;  4AYC A;  1WEM A;  1XWH A;  4A0C D;  3LVQ E;  5LCW B;  4MSX A;  1DVP A;  2ECV A;  3HCU A;  2MNY A;  4V3L C;  2PNX A;  2RSD A;  2L0B A;  4R2Y A;  2L75 A;  4O62 A;  5C11 A;  2OXQ C;  4UP5 A;  2YW8 A;  2XP0 A;  4I7C A;  4AVX A;  1VD4 A;  5C13 A;  3M63 A;  4I7D A;  1WEE A;  1JM7 B;  2L80 A;  2OWA A;  4FK5 A;  4B7Y C;  2L5U A;  3N9Q A;  3M62 A;  3EB6 A;  2L7P A;  5JG6 A;  5FEY A;  4LLB A;  3LVR E;  2YQL A;  5H1U A;  4IC2 A;  1WIL A;  2LQ6 A;  1WEO A;  1WE9 A;  3O37 A;  4O64 A;  4XI1 A;  2MUM A;  3LQH A;  2LDR A;  5J3X A;  3RTR B;  2KWK A;  4N4F A;  2DJA A;  5KH3 A;  2D8S A;  5LKZ A;  4MVT A;  3N9N A;  2LGK A;  2LXP C;  3FAO A;  4AYC B;  2KGI A;  5LKX A;  2CRW A;  3ZNI A;  3DQV R;  3VK6 A;  2KE1 A;  4YBS A;  2F6J A;  4N3W A;  1X4U A;  5B76 A;  3KV6 A;  4X3G A;  4R8P K;  5G0F A;  5TDW A;  3RPG B;  1V87 A;  4S3O B;  2YUC A;  4NN2 A;  4BBQ A;  5LKU A;  2JM3 A;  2KWJ A;  2MA5 A;  1WEN A;  1JOC A;  1JM7 A;  3PUQ A;  2BAY A;  2G43 A;  2CKL A;  2XOC A;  3PLW A;  1MM2 A;  2FUU A;  2Y43 A;  3O34 A;  4UI9 B;  1VFY A;  2M3H A;  4L58 A;  2G6Q A;  4P5O B;  5SVI B;  3DDT A;  2YYR A;  4A49 A;  2YU4 A;  4LJN A;  2KFT A;  2LGL A;  2M13 A;  4W4U A;  4CA1 A;  4UP0 A;  2ECW A;  2ZET C;  3KV5 A;  4WZ3 B;  3H7H A;  3E2D A;  3HTK C;  3L11 A;  5FB0 A;  4YAD A;  2E6R A;  4QF3 A;  1ZBD B;  3L1X A;  2MA6 A;  4LAD B;  3L1Z B;  5B75 A;  2IDA A;  5AIT A;  3KDE C;  1Z2Q A;  3MDB C;  2MD7 B;  1F62 A;  2JMI A;  4YBT A;  2FD4 A;  2KKX A;  5TBN A;  3HCS A;  3T7L A;  5K3Q A;  3KNV A;  3LQI A;  4OGE A;  2MD8 C;  2KIZ A;  2XOY A;  3SOU A;  2P57 A;  1BOR A;  2CKL B;  3ZVZ B;  2DX8 A;  4YAT A;  1LDK C;  4S3O C;  2ECG A;  2EGM A;  2XOZ A;  3QZV A;  3MHH A;  5H9M A;  3GV4 A;  5SVI A;  4C9Z A;  2QJ0 A;  3DPL R;  5H1V A;  5TRB A;  3HCT A;  2K16 A;  2CT2 A;  2PUY A;  2XEU A;  3EB5 A;  2CRR A;  2F6N A;  5FER A;  2AN6 A;  2LV9 A;  2YSM A;  3O36 A;  2C2L A;  2RI7 A;  4A4B A;  3GL6 A;  3O33 A;  2MKE A;  5AIU A;  4GB0 A;  2MT5 A;  4F1P A;  3PHD A;  2JMD A;  4FJC A;  2YSJ A;  2KKY A;  1HYI A;  2MNZ A;  2VJF A;  3LQJ A;  1T1H A;  2K4D A;  5I3L A;  5SVY A;  2M85 A;  2MIQ A;  3LRQ A;  4ZUX U;  3O35 A;  2JUN A;  1DCQ A;  4QF2 A;  4Z0R A;  2LXH C;  3JUE A;  2QIC A;  3O7A A;  4WZ2 A;  2KRE A;  4H9D A;  1G25 A;  1IYM A;  4PTB A;  5H1T A; 
#chains in the Genus database with same CATH homology
 2Y1N A;  4LKA A;  2JMJ A;  2EOD A;  5KH9 A;  2FSA A;  3U5P A;  2KU3 A;  3T6R A;  5D1M B;  2M1R A;  4ZDT A;  4BHW A;  1N87 A;  2KYU A;  2FUI A;  4ZQL A;  4FIP A;  3I2D A;  4AP4 A;  4I7B A;  1WES A;  2VJE A;  2ECN A;  3N9O A;  3KQI A;  1FBV A;  2LGG A;  3ZYQ A;  2G45 A;  3ZVY A;  3IHP A;  3U5N A;  1U6G B;  3SOW A;  4YAB A;  5LKT A;  3PUR A;  2YRE A;  4B86 C;  3NG2 A;  5B78 A;  1VYX A;  1WEW A;  2YT5 A;  1WEP A;  2Y1M A;  1RMD A;  1WEU A;  2ECT A;  4GNE A;  1MM3 A;  3ASL A;  2KWO A;  2JRJ A;  3C5K A;  4FO9 A;  4AUQ B;  4A4C A;  2K1J A;  3ZPV E;  2YHO A;  2EGP A;  2L43 A;  2VJE B;  2YUR A;  1Z60 A;  2YQM A;  1K2F A;  5EYA F;  5TAB A;  1FP0 A;  3U5O A;  4V3K C;  3V43 A;  3SHB A;  3C6W A;  2H0D A;  2YHN A;  1WGM A;  2VPD A;  3ZTG A;  4CCG X;  2HYE D;  3MHS A;  3SOX A;  2KGG A;  2ECI A;  1HYJ A;  2CSY A;  5D1K B;  2VPG A;  5DKA A;  2E6S A;  2VNF A;  2KR4 A;  4TKP B;  1E4U A;  2LRI C;  1WEQ A;  4WA6 A;  4YAX A;  4Q6F A;  1LDJ B;  5TDR A;  3RPG C;  5G04 B;  2VJF B;  4YBM A;  2QIZ A;  1WIM A;  5G05 B;  3M99 A;  4LK9 A;  2F42 A;  1X4I A;  2NAA A;  3ZPV 1;  4GNF A;  2KWN A;  2HDP A;  2LN0 A;  5B8D A;  1CHC A;  4F52 B;  2VPE A;  2EA6 A;  1Z6U A;  5B79 A;  5B77 A;  2C2V S;  5KH7 A;  4YC9 A;  4PPE A;  1WFK A;  2XB1 A;  2VP7 A;  2H0D B;  2UZG A;  3N9L A;  5FB1 A;  3U5M A;  5DIN A;  2CSZ A;  1WEV A;  4GNG A;  4GND A;  2M6M A;  2K17 A;  3O70 A;  3N9M A;  4R7E A;  4WZ0 A;  3N9P A;  4IC3 A;  3FL2 A;  2LGV A;  2I50 A;  1X4J A;  2ECJ A;  4L7X A;  2VPB A;  5D1L B;  4AYC A;  1WEM A;  1XWH A;  4A0C D;  5LCW B;  4MSX A;  1DVP A;  2ECV A;  3HCU A;  2MNY A;  4V3L C;  2PNX A;  2RSD A;  2L0B A;  4R2Y A;  2L75 A;  5C11 A;  2OXQ C;  4UP5 A;  2YW8 A;  4AVX A;  4I7C A;  1VD4 A;  5C13 A;  3M63 A;  4I7D A;  1WEE A;  1JM7 B;  2L80 A;  4FK5 A;  4B7Y C;  2L5U A;  3N9Q A;  3M62 A;  3EB6 A;  5JG6 A;  5FEY A;  4LLB A;  2YQL A;  5H1U A;  4IC2 A;  1WIL A;  2LQ6 A;  1WEO A;  1WE9 A;  3O37 A;  4O64 A;  4XI1 A;  2MUM A;  3LQH A;  2LDR A;  5J3X A;  3RTR B;  2KWK A;  4N4F A;  5KH3 A;  2D8S A;  5LKZ A;  4MVT A;  3N9N A;  2LGK A;  2LXP C;  4AYC B;  2KGI A;  5LKX A;  3ZNI A;  3DQV R;  3VK6 A;  2KE1 A;  4YBS A;  2F6J A;  4N3W A;  1X4U A;  5B76 A;  3KV6 A;  4X3G A;  4R8P K;  5G0F A;  5TDW A;  3RPG B;  1V87 A;  4S3O B;  2YUC A;  4NN2 A;  4BBQ A;  5LKU A;  2KWJ A;  2MA5 A;  1WEN A;  1JOC A;  1JM7 A;  3PUQ A;  2BAY A;  2G43 A;  2CKL A;  1MM2 A;  2FUU A;  2Y43 A;  3O34 A;  4UI9 B;  1VFY A;  2M3H A;  4L58 A;  2G6Q A;  4P5O B;  2YYR A;  4A49 A;  2YU4 A;  4LJN A;  2KFT A;  2LGL A;  4W4U A;  4CA1 A;  4UP0 A;  2ECW A;  2ZET C;  3KV5 A;  4WZ3 B;  3HTK C;  3L11 A;  5FB0 A;  4YAD A;  2E6R A;  4QF3 A;  1ZBD B;  3L1X A;  2MA6 A;  4LAD B;  3L1Z B;  5B75 A;  2IDA A;  5AIT A;  1Z2Q A;  2MD7 B;  1F62 A;  2JMI A;  4YBT A;  5TBN A;  3HCS A;  3T7L A;  3KNV A;  3LQI A;  2MD8 C;  2KIZ A;  3SOU A;  1BOR A;  2CKL B;  3ZVZ B;  2DX8 A;  4YAT A;  1LDK C;  4S3O C;  2ECG A;  3QZV A;  3MHH A;  5H9M A;  3GV4 A;  4C9Z A;  2QJ0 A;  3DPL R;  5H1V A;  5TRB A;  3HCT A;  2K16 A;  2CT2 A;  2PUY A;  2XEU A;  3EB5 A;  2F6N A;  5FER A;  2AN6 A;  2LV9 A;  2YSM A;  3O36 A;  2C2L A;  2RI7 A;  4A4B A;  3GL6 A;  3O33 A;  5AIU A;  4GB0 A;  2MT5 A;  3PHD A;  2JMD A;  4FJC A;  2YSJ A;  1HYI A;  2MNZ A;  2VJF A;  3LQJ A;  1T1H A;  2K4D A;  5I3L A;  2M85 A;  2MIQ A;  3LRQ A;  4ZUX U;  3O35 A;  4QF2 A;  2LXH C;  2QIC A;  3O7A A;  4WZ2 A;  2KRE A;  1G25 A;  1IYM A;  4PTB A;  5H1T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...