1HYVA

Hiv integrase core domain complexed with tetraphenyl arsonium
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
154
structure length
142
Chain Sequence
b'SPGIWQLDTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAAWWAGIKQEFGQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNKKRKGGYSAGERIVDIIATDIQT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
publication title Identification of a small-molecule binding site at the dimer interface of the HIV integrase catalytic domain.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 54
structure length 142
sequence length 154
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2001-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1hyvA00
4CIGA 3OYGA 4DU3A 4KTWA 4CJ5A 4DSLA 1HYVA 1Z26A 3I0RA 4O5BA 1SUQA 4DTXA 4OJRA 3TABA 4K8ZA 4E7KA 1CXUA 4RW8A 4FCYA 4Z4FA 4OVLA 4CE9A 4I2PA 5CYQA 4NYNA 5FDLA 2QXFA 5D3GA 4CJWA 1BIZA 1LWEA 3QESA 4KTZA 1X9MA 4N47A 3HP9A 4DLGA 3AVIA 3TI0A 4JS4A 1WNSA 1TK0A 4DF4A 3HO1A 3SJJA 3HM9A 1TKDA 2OPSA 4N56A 3WNEA 2ZE2A 3P83D 3LZIA 2RPIA 1IKXA 4LH4A 1NOYA 3V1OA 4M3TA 3HL8A 1FXXA 3HP6A 1KVAA 1ZYQA 5HLFA 4CEQA 2HNYA 4DFPA 1BCOA 2EX3A 3BDPA 2IGIA 4E1NA 3KK1A 2OPRA 4IG0A 3T1AA 4K8XA 4FJIA 4CK3A 3U3GA 1NJZA 4AHTA 4CJTA 1REVA 1Q8IA 4DS5A 3DM2A 1WSEA 1FK9A 3C6UA 4MFBA 3L2WA 2X6NA 3DRPA 2HNDA 3U3YA 3TAGA 3S3MA 1NK0A 3ZT0A 4N41A 4NCBA 3O3GA 1RTHA 2F96A 3RR8A 1IKVA 3C6TA 1KFSA 4CIFA 3NH1A 2KFNA 4F2SA 1D8YA 3K5OA 4DTOA 4KV8A 5FRNA 4CEEA 2D0BA 3VQ9A 4IFVA 5J1EA 3NDKA 3TAEA 5FROA 4OLAA 3DI6A 3V9SA 4MQ3A 1ASVA 4CJPA 1WN7A 4FLUA 1NKBA 2YKMA 5DK5A 5KI6A 4C8MA 2WONA 1QHTA 4O55A 1QSSA 1NJYA 4CHNA 4F4KA 3RMCA 4HCBA 3B6PA 1S9EA 4M41A 4KB1A 4KHQA 2KW4A 4HVJA 1L3UA 1NOZA 3VQDA 4AHRA 3OJSA 2YNHA 2W42A 1IG9A 2P1JA 2Y1IA 1O1WA 3ZSZA 2VG6A 4Z4EA 1JLGA 4B9UA 3V81A 2O4IA 4O4GA 1EKEA 4DU1A 2F8SA 4EP5A 4KFBA 3QETA 2OA8A 4KHWA 2IAJA 2JLEA 3FFIA 4BE2A 2Y1JA 4M3ZA 4F8RA 4O0IA 4DQRA 3KLIA 3O4QA 3MXIA 1EXQA 4E7JA 1HJRA 3MXJA 1RT3A 2G8VA 1C1CA 1WAJA 3AVKA 4FJJA 1B9FA 3HPOA 5J2QA 4ID5A 4DQPA 1S1WA 3ZSWA 3OYFA 3LAMA 3OYCA 1LW2A 4RW9A 3H08A 3LZJA 1U49A 1ITGA 4KO0A 3ZSOA 4Z4HA 5JS2A 1LV5A 1Q9XA 4Y1CA 1KFDA 3QEWA 3CM5A 1NK5A 1LWFA 1LAWA 2IDOA 3QERA 1KVCA 4KRFA 3IRXA 5C24A 3OY9A 4JS5A 3NBPA 4DQIA 4YFUA 1HRHA 4R5PA 1BL3A 1A5VA 1RT2A 3HVRA 3NE6A 1WSHA 5I42A 1TKZA 1U04A 2HHQA 3QEIA 3TANA 1TKTA 4E1MA 1HNIA 1C0UA 3VA3A 3ZSQA 1X1PA 2IC3A 2ZQBA 1JLCA 1WSFA 1VRUA 2OPQA 3LP0A 3WNGA 4HUFA 3SZ2A 4B8CA 3NGIA 2A1RA 1T8EA 3L3VA 5KRTA 3RMBA 1JLFA 3AVJA 1RDAA 4RW6A 4BWJA 4DSFA 1J5OA 1B92A 1KVBA 4CJ3A 3AVMA 1QS4A 5HRSA 3MEEA 4DLEA 2HB5A 4CGHA 3V9WA 3K58A 3PO5A 4DWIA 4QAGA 4RW4A 3HT3A 2D5RA 4CK2A 4XIUA 2QKKA 2BGGA 3VQ5A 1GOCA 3LDSA 1NK9A 1K6YA 1BGXT 1Z25A 3NF9A 4LSNA 4G1QA 3QIPA 4B9TA 4HTUA 4W5TA 4CFAA 1DTQA 4CHYA 5I3UA 5HP1A 1VSEA 1TKXA 3RRGA 2YHAA 3V9XA 2BE2A 1UOCA 1NJWA 3QEPA 2YV0X 1FKOA 1ZBUA 2E4LA 4FZYA 5DMRA 1A5WA 3HYFA 4FJ8A 3M8QA 4CF9A 4FJKA 2OZSA 2P51A 1DTTA 4NCGA 3AA4A 3OVNA 1VSMA 2NUBA 4AILC 3CG7A 3MXMA 3OYLA 4F3TA 2FBYA 1EETA 2ATQA 3ZT1A 4J2EA 4OGCA 3RWUA 1VSKA 1UA1A 1QSLA 1QSYA 3VQ6A 4FJGA 3CFOA 3AVAA 4KHYA 3AO5A 3RMDA 1SKWA 1RT7A 1C6VA 4I2QA 4M3RA 4FK0A 2AJQA 3OYNA 1LWCA 3DRRA 3SUOA 5C42A 3O3HA 4DTJA 3SQ2A 1RNHA 4TSXA 4FLVA 3DLKA 2BDPA 3UIQA 2KFZA 4CJFA 5HRPA 3OS1A 1JL2A 1S9GA 1TGOA 4E0DA 4KB0A 1L3TA 4CJEA 1ZBFA 4OKEA 1UAXA 4CEDA 3VQPA 3KTQA 4B9SA 4DSIA 2PZSA 1SV5A 4EP4A 1JL1A 3ULDA 3HJFA 1KLNA 2E6LA 5HRRA 1YVUA 3TAQA 4FLZA 2B4JA 4FLTA 3MEDA 3HXMA 2P5OA 4F2RA 4FJ9A 4FM0A 1CZ9A 4LD0A 2HW3A 2E6MA 4OGEA 1XHXA 3O3FA 1SL2A 3AO4A 3ZSRA 3OYJA 4E19A 1KCFA 3ZT4A 1XC9A 4B9LA 4QOZB 3CQ8A 2HNZA 4KHNA 1U47A 1HQEA 3L3UA 4CF1A 4CEFA 3AA5X 4HHTA 3P5JA 4B9NA 2Z1JA 4JLHA 3NGYA 4DTNA 2XO7A 5C25A 3L2RA 3K2PA 3LPTA 1XHZA 4GVMA 1VSLA 1QE1A 1RT1A 2HVIA 4CFCA 3VQQA 2D0CA 4BE1A 1KSPA 2OYQA 1HMVA 1IH7A 3PX4A 2ETJA 2FBTA 4O44A 4AH9A 4J2AA 1S5JA 4M3XA 1IKYA 1RBUA 3K57A 4DF8A 2I5JA 3QEXA 4KAZA 1VSFA 1GOBA 3C94A 5EU7A 3KJVA 4CK1A 3EZ5A 5J2NA 4W5NA 2OPPA 2P5GA 5KGWA 4FM2A 4Z0UA 3AVHA 2YNGA 1WSJA 5CZ1A 2R7YA 2HHUA 3DLEA 3MEGA 5HRNA 1TK5A 3K5MA 1VSHA 4CHQA 1YTAA 3ZSYA 1RBSA 1C1BA 3CYMA 4ZTFA 4CGFA 4BACA 4CF8A 4M3WA 4CJSA 4E3SA 3OYBA 4HUGA 4ZHRA 4CJUA 2PYJA 4L8RB 1TK8A 3LALA 1RTDA 4F3OA 3AVCA 4BDZA 3S3OA 2JGUA 1HQUA 4DQQA 2RN2A 1BCMA 3P1GA 3VQ4A 3OYAA 3KD5E 4YNQA 4FJMA 1RBVA 4Z4CA 4N5SA 4ICLA 3NH0A 3PUFA 2YHBA 4C8KA 4DSJA 5CYMA 1XWLA 2BANA 4CHZA 4KHSA 2Q3SA 4C8OA 4CJLA 1SKSA 2HVHA 4CF0A 3HK2A 3AVBA 3RMAA 3OYMA 2HHSA 3TARA 2QKBA 2Z1GA 1U4BA 4ELTA 1B9DA 1WSIA 2ZD1A 1C0MA 1ZBLA 1TAUA 2FBXA 3SV3A 2VG5A 3D45A 1TL3A 3CM6A 3DLRA 1YT3A 4Y1DA 3NFAA 3HPGA 1ZBIA 3M8RA 4JRPA 3VQ7A 3KK2A 3M8PA 1D9FA 3K59A 4FK4A 3V9UA 1T05A 3BGRA 5HROA 1DLOA 4C8NA 5T7BA 3KK3A 4E7HA 1X9WA 3KD1E 4Z4GA 2OZMA 2HHWA 3LWLA 1J54A 3NHGA 4DTUA 1HYSA 4IKFA 4M45A 4FJLA 3I0SA 3WNHA 3AVLA 3KIOA 3LP1A 3OYEA 3TWHA 3PO4A 3IS9A 5J2PA 1WAFA 1S1VA 3AO1A 1T03A 4DFJA 1BQMA 3LP3A 3ZT3A 4Q0BA 1EX4A 4CGDA 1JXBA 3SUPA 3KLGA 4WE1A 1L3VA 3L8BA 4DS4A 1TVRA 3NGZA 4DFKA 1J53A 1KRPA 2KZZA 4DSKA 2XHBA 3ZSVA 2RF2A 4E7LA 4FW2A 1NJXA 1JKHA 1Y97A 3OS2A 3D0PA 2ITGA 3VQEA 3SNNA 1S1XA 1BIUA 3OYDA 1W9HA 1JLBA 3MAQA 3RRHA 3ASMA 4FVMA 1RDDA 4CJKA 2XY6A 4CJ4A 3NF7A 3QINA 4OLBA 4OPKA 1BHLA 1S6QA 3DMJA 4H8KA 1F21A 3EYZA 4RG8A 3NCIA 4CJQA 3PX0A 3SPYA 4B9VA 3NH2A 3G0ZA 2X78A 1UA0A 4FLWA 1S6PA 1UWBA 3KLHA 5SZTA 1SL1A 1RT6A 1JLQA 1QTMA 4ID1A 1A5XA 1S1UA 4IFYA 3DLBA 2G8FA 1FKPA 4CGJA 1BI4B 2Z1IA 3F9KA 1NKCA 3JSMA 4LY7A 1VRTA 2G8HA 4KREA 4N76A 1NKEA 3ZSXA 4B3OA 3B6OA 4OKJA 1NK4A 4W5RA 2KTQA 1RILA 2HHTA 2VWKA 1RTIA 4GMJB 1TL1A 4CF2A 3QNOA 1CLQA 3QNNA 2G8KA 4ELVA 3ITHA 3A2FA 3V1QA 4DG1A 5KRSA 1IKWA 1HYZA 3QIOA 4RW7A 4DQSA 3AO2A 3V9ZA 3VN5A 4FW1A 4EZ6A 1VK0A 3SQ4A 3OYKA 3DLHA 2B5JA 4KI4A 4B9MA 3DYAA 2XY8A 1U45A 4AHUA 4DMNA 1C1AA 3C95A 4FLXA 1N5YA 3AVFA 4B8AB 1Q9YA 4KHUA 3KKSA 4CEAA 4CEOA 4E7IA 1SKRA 3QEVA 1KLMA 3TAMA 1ASUA 2G8IA 3OYIA 4M3YA 3IAYA 2FBVA 3KLFA 3L2VA 2VWJA 3IG1A 4M3UA 4KTQA 2B6AA 3SI6A 1N6QA 4W5OA 1VSIA 3SQ1A 1S1TA 2HHXA 2X6SA 3JYTA 2G8WA 3L2UA 1RTJA 3AO3A 4Q5VA 4J2BA 2KZMA 3MECA 2LSNA 3F73A 3CFPA 4CEBA 2GUIA 3AA3A 3AVNA 1YTUA 2DFFA 5CZ2A 4BE0A 2XY5A 2XRIA 1ZBHA 3L2QA 1T7PA 1JLAA 1HPZA 1BI4A 3LANA 4NCAA 3QO9A 3T19A 3NF8A 4FJ7A 4KI6A 4BWMA 3V4IA 4OPJA 2O4GA 4DU4A 4PWDA 2IOCA 4I7FA 3VQ8A 1WSGA 3OS0A 2DFEA 4HUEA 1HNVA 1W0HA 1RBRA 3V1RA 5KGXA 3DRSA 5E41A 4DFMA 4BDYA 2IS3A 1RCHA 3VQBA 1D5AA 4QCLA 3DOKA 4CECA 3VQCA 1NK6A 1L5UA 4FJNA 1D9DA 1ASWA 4KKOA 5HBMA 3LWMA 3NAEA 3SYZA 4CJVA 1KTQA 2A1SA 4J2DA 2GBZA 4GW6A 1JLEA 4AHCA 3HVTA 3OYHA 4CHPA 4DTRA 1GOAA 3DOLA 3PV8A 3NF6A 3PX6A 3RR7A 3ISNC 2XY7A 4OKKA 3LP2A 3SUNA 1L3SA 4CEZA 1LAVA 3KKRA 2Z1HA 3O4NA 1I3AA 1TAQA 4NYFA 4CFBA 4CJRA 4FJHA 4FK2A 3RTVA 4CFDA 4O0JA 4LH5A 2HHVA 4IDKA 4ZTJA 2PYLA 4FJ5A 4IG3A 1BISA 1C0TA 2YNFA 2G8UA 3TAFA 2DY4A 3OJUA 3SUQA 1RDCA 4I9LA 3AV9A 4CERA 3AVGA 4CGGA 4H4OA 4LSLA 3WNFA 4ELUA 2F8TA 5KTQA 4AHSA 4FJXA 4PQUA 2VG7A 1U48A 3SPZA 3LPUA 3T3FA 3SQ0A 5CY4A 4IBNA 1TV6A 1NK8A 2QK9A 2X74A 1XI1A 3SV4A 5J2MA 4FM1A 4FZXC 1R0AA 4PUOA 3EY1A 1BQNA 3PY8A 4FXDA 4UQGA 4W5QA 1J9AA 4JRQA 3VQAA 4DTPA 1JXEA 2DTUA 1G15A 1CZBA 3I8DA 2WOMA 1IO2A 4BDPA 3LAKA 3V6DA 2FC0A 4EZ9A 4FYDA 3TR8A 4DSEA 3KLEA 4C8LA 4DTMA 4KPYA 3G10A 4FZZA 4E89A 4CESA 3ALYA 2KQ2A 1SL0A 4B08A 1RBTA 1QQCA 4Z4IA 4CGIA 4PY5A 4PA1A 3ZCMA 1VSJA 1RDBA 2GV9A 3E01A 4FLYA 3VA0A 1I39A 2EHGA 5K14A 3TAPA 3THVA 3S3NA 2DFHA 1LW0A 1VSDA 3HSTB 2HMIA 4H4MA 3QLHA 4CHOA 4AHVA 3SCXA 3U6FA 4M42A 5FRMA 1WLJA 4HCCA 1RT5A 5JS1A 1EP4A 2YNIA 1MU2A 1CXQA 2YKNA 4I9QA 3K5LA 1X9SA 3HPHA 3K5NA 2PY5A 4CCHA 2D0AA 3ZT2A 3M8SA 3S9HA 1NK7A 2RKIA 1RT4A 3AA2A 4CIEA 3CFRA 4DTSA 3DLGA 5SWMA
chains in the Genus database with same CATH superfamily
4CIGA 2AP1A 1K73O 2E88A 3I0RA 4O5BA 4DV1K 1SZ2A 4DTXA 4GV3A 3GL1A 4E7KA 4FCYA 4EFHA 4Z4FA 4B3TK 4JKGA 4BRHA 4PKHA 4NYNA 5D3GA 3QESA 1XNQK 1X9MA 2P9PA 5LJWA 4JS4A 1TK0A 3T69A 3LM2A 1Y64A 3HM9A 2OPSA 3D2FA 4N56A 3SMSA 3LZIA 4LH4A 3V1OA 1ZYQA 5HLFA 4LC9B 4DFPA 3ENHA 4GVEA 1QQOA 3T1AA 4K8XA 3U3GA 3CQXA 2NRZA 4LF4K 3DM2A 5KPRA 4DWIA 2GWJA 1NK0A 4IOXA 4PQUA 2P9LB 1WOQA 3ZT0A 1RTHA 2F96A 1HKGA 2KFNA 3ENOA 1D8YA 3K5OA 4JEPA 5LMUK 2D0BA 4CBXA 4IFVA 3TAEA 4BR9A 3O9RA 2A3ZA 2HF4A 2E20A 1QHTA 4O55A 4HCBA 1BUPA 3RMCA 4JYAK 2YJEA 3B6PA 2HSTA 4KB1A 2KW4A 1L3UA 4B3SK 3CJCA 1NOZA 1SQKA 4ISFA 2P1JA 2P9UB 3N4PA 3ZSZA 1VQ5N 4Y0WA 1EKEA 3KVGA 3VGLA 4KFBA 3QETA 2OA8A 3PLAA 2A41A 4BE2A 4M3ZA 4F8RA 5KPTA 1HJRA 2G8VA 2ASPA 5ADXA 1B9FA 1YXQA 4ID5A 4DQPA 3ZSWA 3OYFA 1U49A 3CIPA 1Q81O 3ZSOA 5JS2A 3L6QA 1ATRA 4Y1CA 4BRDA 4BR5A 1LAWA 4JKFA 3OY9A 2H3GX 4DQIA 1HJOA 1HRHA 2A42A 1A5VA 3VTIA 1HNWK 1U04A 2HHQA 2CGKA 1QHAA 2RHKA 4E1MA 3VA3A 2IC3A 1JLCA 2OPQA 1EO1A 5E26A 2W40A 1HNXK 4N76A 2HVIA 1T8EA 1HX1A 4BVPA 3RMBA 1SAZA 1ZXOA 3ZX2A 1Q86O 2F7TA 5HRSA 3V9WA 2WTUA 4XIUA 1BWFO 3TSPA 1NK9A 1K6YA 3NF9A 3VGKA 4NLBA 3UKUB 4HTUA 4CFAA 3A5NC 4CZKA 4X62K 1TKXA 4FOEA 2QI2A 3RRGA 3V9XA 2QWRA 3PIPL 1FKOA 2E4LA 4FZYA 2EWSA 3EKUA 1W97L 4FJ8A 2P51A 1DTTA 3AA4A 4ILGB 5CE3A 2O8DA 1VSMA 5GIOA 4F3TA 3L0QA 2FBYA 1EETA 3CHWA 4OGCA 2E2QA 3VQ6A 3CFOA 3CXCM 3AO5A 4I2QA 2AJQA 3SUOA 5C42A 1NGHA 4DTJA 3SQ2A 4BROA 3UIQA 4DV7K 3OS1A 1TGOA 1L3TA 4CEDA 3VQPA 3KTQA 4B9SA 4EP4A 3J80O 1YVUA 2P5OA 4FJ9A 3MEDA 1MWKA 3FGUA 4FWKA 2E6MA 3DXMB 3O3FA 2V7ZA 3ZSRA 3OYJA 1XC9A 4RWTA 3WEEA 4EAHD 2YHYA 4QS8A 2XO7A 3L2RA 4KH5A 3K2PA 3LPTA 1XHZA 4CBUA 5GINA 2OYQA 1IH7A 3LDNA 2ETJA 4BC2A 1S5JA 2CH6A 3K57A 3QEXA 4F9OA 1VSFA 4I6MB 3T1HK 3BEXA 2P5GA 4AQYK 4FM2A 5BPMA 1WSJA 4QS7A 5CZ1A 1OKJA 3C6AA 3MEGA 4DR7K 3J8AA 2P9NA 1YTAA 3CYMA 4ZTFA 4BACA 3H3NO 3A8YA 1RTDA 1C0FA 2RN2A 3VQ4A 3MN6A 1RBVA 4Z4CA 3U4LA 4ICLA 3NH0A 3AAQA 2YHBA 4DSJA 1M90O 4C8OA 1NLVA 2HVHA 4CF0A 3HK2A 3RMAA 3ZX3A 3ULEA 2QKBA 1B9DA 1JCFA 4YOVA 3W0LA 4LF5K 5GIPA 4JRPA 4B3RK 3NMUA 5A2QO 3V9UA 3AGKA 5HROA 3KK3A 1X9WA 1BA1A 2OZMA 4WQ4C 4JI6K 3LP1A 3OYEA 3NVKA 3IS9A 4LF9K 3EL2A 3ID6A 2OTLN 3TU5A 3GG4A 3LP3A 1EX4A 2CH5A 4CGDA 4DCHA 1NGIA 2Q36A 3BF1A 2HBMA 4WE1A 5CR4A 1KRPA 1TVRA 4DFKA 5AQQA 1J53A 2KZZA 3CJAA 4DSKA 4E7LA 3G71N 5JLFA 1JKHA 1GLBG 5EOYA 1BIUA 2D4WA 3ASMA 4FVMA 2WUSA 1RDDA 3QINA 4OLBA 2QW9A 1BHLA 3SPYA 3OBYA 3PX0A 2I7PA 1KXPA 4YOUA 4CD1A 3KLHA 4KBOA 1RT6A 1QTMA 1S1UA 2I7NA 4IFYA 2G8FA 3JSMA 4LY7A 3BZKA 1N32K 1NJIO 4QS9A 4B3OA 1NK4A 4W5RA 1TL1A 3P31A 3D2EA 1IKWA 4FW1A 5EXWA 3OYKA 3DYAA 1U45A 4AHUA 4DMNA 1R59O 5BREA 1E3MA 3AVFA 1Q9YA 4CEAA 1TUUA 1ASUA 1YJ9N 1TUYA 1HUXA 4CZMA 4BRPA 3IG1A 5JVHL 4M3UA 3CCLN 4H0YB 4KTQA 3O80A 4LFCK 2HHXA 3SJHA 2X6SA 2ASOA 2G8WA 4Q5VA 3CCVN 2KZMA 3F73A 4CEBA 2GUIA 3AA3A 4JK8A 4JI4K 1JLAA 3LANA 1K8KA 1NNEA 2IOCA 2DFEA 3H46O 1HNVA 4CJ7A 5KGXA 2W6LA 2WC9A 4DFMA 4JD2A 4BDYA 2IS3A 3VQBA 4BGAA 4AF1A 1NU0A 3VQCA 3LWMA 2UUCK 3NAEA 3SYZA 4WQ4A 2GBZA 1RGIA 4FSVA 4AHCA 3ISNC 5AQWA 3R1XA 4CEZA 1LAVA 3KKRA 2Z1HA 3O4NA 1I3AA 4NYFA 3VEVA 4CFBA 1VQ7N 2HHHK 4FJHA 4FK2A 2FXUA 4O0JA 4LH5A 2HHVA 1YIJN 4ZTJA 5JVGL 4BR2A 4FJ5A 4IG3A 3RSEA 2DY4A 3TAFA 3VEYA 1RDCA 4CW7B 4CERA 3AVGA 3H3OB 2IIRA 3P4IA 3WNFA 1NBWA 2VG7A 3T3FA 3SQ0A 5CY4A 2X74A 4BGBA 3SV4A 5J2MA 3R3LA 1R0AA 4H5WA 3EY1A 4FXDA 3WXJA 3R8EA 4UQGA 3THXB 3N4QA 2VGMA 4B1YB 3EZWA 3CCEN 1VQPN 3LDOA 2WOMA 1IO2A 4JV5K 4EZ9A 1I94K 4DTMA 4FZZA 1SL0A 5HOOA 1QQCA 4IWVA 2NRRA 4H5NA 3VA0A 4B1UB 2EHGA 4CZGA 3S3NA 1LW0A 2HOEA 4A2AA 2WBNA 4H4MA 3QLHA 4FWRA 5TKWA 3SCXA 4K0KK 5FRMA 5JS1A 1MU2A 2QWPA 3K5NA 3VERA 1IG8A 3AA2A 4JN4A 4UY8O 1QVFM 4DU3A 4DSLA 3BZCA 3A5OC 5GAHP 4K8ZA 4RW8A 3ZLJA 5LY3A 2IVNA 4OVLA 4CE9A 1BIZA 3AVIA 1WNSA 2ZF5O 5AQZA 2NRTA 5F2RA 3SJJA 4JI7K 2QEXN 2F9TA 3HL8A 1FXXA 3TTCA 2HNYA 1BCOA 5AQVA 2EX3A 2IGIA 1T6DA 3WT0A 3UKRB 4CK3A 1WUAA 4BG8A 3DRPA 3U3YA 2JWKA 1O13A 4IO8A 2UUAK 5AQPA 4BRLA 3O9QA 4CEEA 3NDKA 4OLAA 5F0XA 4CJPA 1WN7A 1NKBA 5DK5A 4J8FA 3C7NB 5KI6A 2GWKA 4C8MA 2WONA 4LF7K 2OTJN 4F4KA 4CHNA 2FF3B 4HVJA 3UE5A 3VQDA 3OJSA 1BO5O 1IG9A 2Y1IA 1BDGA 1NMDA 3V81A 2FLOA 2O4IA 2NNWA 5GADP 4KHWA 1NGFA 2IAJA 4EHUA 3KLIA 3O4QA 3EEQA 1EXQA 3O1BA 3VETA 1WAJA 4FJJA 1S1WA 3T7ZA 3LAMA 3OYCA 1LW2A 4RW9A 3LZJA 5AFUH 4MLHA 4KO0A 1LV5A 2PBDA 3QEWA 2O8BB 4B1ZA 1OH8A 3QBXA 1VQ9N 4ILJA 4R5PA 2KHOA 2F4VK 2O8EB 2NLXA 1RT2A 2QWQA 3NE6A 1WSHA 5F1XA 1TKZA 3TANA 1TKTA 2UXBK 1HNIA 1C0UA 3ZSQA 4Z4GA 1NGJA 1VRUA 3SZ2A 4B8CA 5KRTA 1JLFA 4RW6A 3TTFA 4DSFA 1J5OA 5MLCQ 1KVBA 3AVMA 1GLDG 4L3QA 5AQKA 3MEEA 4DLEA 2HB5A 4CGHA 3CCSN 3PO5A 3HT3A 3LDSA 1ZC6A 4U7BA 4KH4A 3QIPA 2NRWA 4B9TA 4IFEA 4CHYA 5I3UA 2YHAA 2BE2A 4JI1K 3L4IA 5FPDA 5C12A 2YV0X 1WB9A 5DMRA 4JAXA 1A5WA 3HYFA 4DV5K 2HBLA 3OVNA 3CG7A 2P9IB 2ASMA 4J2EA 3FE1A 1VSKA 1UA1A 3WXKA 1QSYA 4FJGA 3AVAA 1OH5A 4KHYA 1RT7A 2QTDA 4M3RA 4FK0A 1LWCA 3O3HA 3CCQN 2BDPA 2KFZA 3DLKA 4CJFA 1S9GA 4KB0A 4DSIA 1K8AO 4OKEA 1UAXA 3EE9A 3OW2M 1JL1A 2E6LA 2B4JA 4FM0A 4C1NI 4LD0A 3P38A 4CZFA 2YI1A 5C2FA 4KHNA 1GLCG 4CEFA 2QXLA 3CC7N 4B9NA 4JLHA 3NGYA 4JKBA 5H1SQ 3MN5A 4DTNA 3WXMB 1KC8O 1VQMN 3E1YA 4GVMA 3OA9A 5AQSA 5BR9A 3VQQA 3CERA 3EKSA 2O8FA 2FBTA 4O44A 4PL8A 4BY9C 3A5MC 5AQJA 4WQ5C 3ZX0A 1ILYA 4CK1A 1TYQB 4Z0UA 2HHUA 3QFUA 4JKAA 4FOIA 3K5MA 1VSHA 4OX9K 1Q82O 1C1BA 1NGEA 4CF8A 3I55N 3HBTA 3OYBA 4ZHRA 4F3OA 3CJ1A 3S3OA 4K25A 3OYAA 1IBLK 4YNQA 2O8CA 2JWLA 4N5SA 3F9MA 3PUFA 3DXKB 1QVGM 1XWLA 5AQRA 4CHZA 4KHSA 4A5AA 2NRHA 4CJLA 1SKSA 1GLLO 1J6ZA 3VEZA 1C0MA 2P9KA 2E5LK 1TAUA 2FBXA 5M1OA 3D45A 1TL3A 3CM6A 2UYTA 1U2VA 3NFAA 4DKWA 3HPGA 3M8RA 3VQ7A 3KK2A 3ZEUB 3BF3A 1D9FA 3IUCA 4FK4A 5AR0A 4E7HA 3KD1E 1HYSA 4NLCA 3I0SA 2GX9A 3KIOA 3TWHA 1XQSC 1RFQA 1VQLN 1BQMA 3GBTA 3ZT3A 5AQXA 3KLGA 1L3VA 4BC4A 3L8BA 2ZJRL 3OS2A 4H0VB 3PSFA 2YHWA 1JLBA 3MAQA 3RRHA 4IEIA 4LF8K 1QQNA 4CJKA 5IWAK 4M7XA 1ESVA 3NCIA 1F21A 4CJQA 4B9VA 1UA0A 1S6PA 4RTFD 3LDPA 1UWBA 5JLHA 5IT9O 5SZTA 2Z1IA 1NKCA 1DEJA 2HHTA 1RILA 2VWKA 1RTIA 4GMJB 4WCEL 3ITHA 3B8AX 2YHXA 4DG1A 3M5RA 3QIOA 4DR1K 3H6EA 3AO2A 3DWLA 3E66A 3O9UA 3VN5A 5AZJA 3THXA 4WQ5A 1N8RO 1NGDA 1U6ZA 4YOTA 4K42A 1LCUA 3KZBA 4B8AB 3VF2A 3KKSA 3C0BA 3AGRA 4E7IA 3QEVA 1MDUB 3O6WA 2G8IA 3OYIA 4X66K 2QWNA 3IAYA 2FBVA 5EVZA 4M3YA 2ZWHA 2PAVA 4E1JA 1S1TA 3JYTA 2QM1A 3L2UA 4J2BA 3MECA 4K41A 3AVNA 4EIAA 2DPNA 5CZ2A 2XRIA 3L2QA 1HPZA 1BI4A 3CJBA 1YITN 4FJ7A 3CPEA 2GELA 4BRNA 2NRXA 1NWKA 4I7FA 3OS0A 1QZ6A 2BUPA 2VYPA 1W0HA 1RBRA 5E41A 4YDUC 1RCHA 1D5AA 4CECA 1L5UA 4X65K 3H1VX 5GAGP 4DR2K 1ASWA 1DGKN 1YHQN 1KTQA 3SLCA 1Z6RA 3PX6A 3PV8A 3RR7A 3NF6A 3SUNA 4NXNK 2VWBA 1TAQA 3C6HA 2PYLA 2G8UA 3OJUA 5M1KA 3AV9A 3I8BA 4CGGA 4XH5A 5KTQA 2VGNA 3M1FA 3SPZA 3CI5A 4FZXC 1BQNA 1HR0K 3PY8A 1J9AA 4O8KA 4JKGB 4BC3A 4DTPA 4BRCA 4MO5A 1G15A 2D0PA 3J7YP 4FO0A 4MDAA 3FZLA 3IKMA 3J81O 3LAKA 4B1VA 1NM1A 3D2FB 3H1QA 3CETA 3THWA 1VQNN 2ZGYA 4CGIA 4PY5A 5AJ3K 4JK7A 3ZCMA 1VSJA 3E01A 4FWOA 3I33A 4JI0K 1I39A 3TAPA 2DFHA 5EY4A 4CBWA 3U6FA 4M42A 1KAYA 1EP4A 2YNIA 3BP8A 3HPHA 4PKGA 5FLXO 1NK7A 4A5BA 1YVNA 3Q7CA 3AY9A 4CIEA 4JHDA 3E9OA 5SWMA 4AM6A 3OYGA 4CJ5A 1Z26A 4JKHA 1SUQA 4OJRA 3TABA 1CXUA 3E9PA 3DAWA 4I2PA 5CYQA 5FDLA 4CJWA 5BRHA 1XMQK 1K9MO 1BG3A 4DLGA 3TI0A 3MWTA 3CQYA 2ZE2A 2RPIA 1IKXA 1NOYA 4M3TA 5AZIA 2UUBK 4FWQA 3THYA 1E4GT 4CEQA 4GV6A 2UXDK 4YDUA 3ZETA 4E1NA 3FZFA 2OPRA 4IG0A 4LF6K 1HLUA 4FJIA 4XEIA 4AHTA 4CJTA 1REVA 1Q8IA 3TAGA 1FK9A 3AARA 2P9SA 2X6NA 2HNDA 5FPMA 4NCBA 3O3GA 4DV0K 2IVPA 1IV0A 3NH1A 3HM8A 4WFNL 4DTOA 2Q0UA 5FRNA 3J7AP 5FROA 3V9SA 1YJWN 4FLUA 5LMNK 1NJYA 1VQON 4M41A 1BA0A 2W42A 4BQLA 1JLGA 4B9UA 4JKCA 2E8AA 3CCRN 4O0IA 4DQRA 4H5RA 4E7JA 3MXJA 3M6GA 5AQNA 1C1CA 1HKBA 3AVKA 3HPOA 2VQEK 1N34K 3QFPA 2P9LA 3H08A 4ELUA 2CGLA 4Z4HA 1J5EK 3VF6A 4YOXA 2ZJPL 2IDOA 4FL9A 5BRFA 3SMPA 4V19S 4JS5A 2O8DB 3NBPA 4YFUA 1BL3A 3HVRA 5I42A 3GDQA 2NRVA 1JJ2M 3QEIA 1XC3A 4A59A 1ZBSA 1X1PA 4HUFA 3NGIA 2A1RA 3SAHA 1RDAA 5JICA 4IEEA 4BWJA 1B92A 4CJ3A 1YJNN 1QS4A 2P9UA 5AQGA 4CZEA 4QAGA 1NGGA 4CK2A 2QKKA 2BGGA 3VQ5A 1BGXT 1Z25A 1WBDA 4LSNA 1T3VA 4IDHA 1DKGD 4M7YA 1DTQA 5HP1A 4HTLA 2VQFK 3QEPA 3WEEB 2W41A 1ZBUA 4JKEA 3M8QA 4CF9A 4FJKA 4NCGA 4AILC 3MMVA 4BR0A 2ATQA 3ZT1A 3RWUA 4GY2B 2FF6A 2GEMA 1BOTO 3RMDA 1C6VA 3DRRA 1KAZA 3FFKB 1RNHA 4BRQA 4BRAA 4CZJA 4PL7A 1JL2A 2P9NB 4CD3A 4Z4EA 2Q2RA 5C10A 1SV5A 2PZSA 1QQMA 2W6KA 1KLNA 5HRRA 3TAQA 4FLZA 3SAFA 4FLTA 4F2RA 4DR6K 3HXMA 3CCMN 4OPHA 3UKUA 2HW3A 4OGEA 5C0YA 1XHXA 4GNIA 3AO4A 3VEXA 1KCFA 4E19A 5BN8A 5M1NA 2HNZA 3PSIA 1HQEA 1KAXA 3L3UA 4CF1A 5FPEA 3CJ9A 3AA5X 2FSNA 3P5JA 4GV9A 1SS6A 2Z1JA 4CVNE 1EWRA 5C25A 3ULEB 1VSLA 4NXMK 4A2BA 2D0CA 4BE1A 1KSPA 1HMVA 3PX4A 3DLLL 1RBUA 2E2NA 4OPAA 2I5JA 4DF8A 1VQKN 4KAZA 4B3MK 2OANA 3F2KA 1GOBA 1X3MA 3EZ5A 4W5NA 2OPPA 4ILHA 3DLEA 4CHQA 5C15A 4FVUA 1YF5L 4M3WA 3SK3A 4CJSA 4HUGA 4CJUA 3LALA 3AVCA 4BDZA 1Z05A 2JGUA 3DXMA 1BCMA 3P1GA 3KD5E 1T6CA 2HF3A 1S3XA 3AVBA 2GUPA 3TARA 1WSIA 2FSKA 2ZD1A 1DT9A 1ZBLA 3SV3A 4YHHK 2PFUA 3KWIA 4XH4A 4CI6A 3DLRA 4Y1DA 1W7AA 3M8PA 4JI3K 3O8MA 4C1NK 3WXLA 3K59A 4I6MA 1T05A 5I9EB 5LJVA 2HHWA 3LWLA 1J54A 4DTUA 3BUZB 4M45A 3DJCA 4FJLA 3D2EB 3WNHA 3LM9A 4B1WB 1WAFA 1T03A 4GKKK 1G99A 2F9WA 4WFAL 3CC2N 4BRIA 3O5BA 4DS4A 3NGZA 4M63C 1Q7YO 4BR4A 4FW2A 4A57A 1NJXA 1Y97A 3D0PA 3FZMA 1S1XA 3U8XA 3OYDA 4FWNA 4JI2K 3I56N 3GE1A 4CJ4A 1S6QA 4H8KA 3EYZA 4RG8A 3D6RA 4WF9L 2E1ZA 3GOIA 1JLQA 1A5XA 4FPBA 4CGJA 4KREA 3F9KA 1VRTA 1X9JA 1NKEA 3O9SA 4OKJA 2KTQA 4CF2A 3QNOA 2G8KA 3A2FA 2V52B 1HYZA 4DQSA 3V9ZA 4EZ6A 4JD2B 2E2OA 3SQ4A 3DLHA 4KI4A 1D4XA 2XY8A 1FW6A 1C1AA 3C95A 1N5YA 1OVYA 1NMNA 4PHTX 3TTDA 4CEOA 1SKRA 4DV2K 1QZ5A 4DHYA 3KLFA 2VWJA 4DR4K 1KD1O 5DM6L 3ENBA 3SI6A 1N6QA 5B8HA 1VSIA 1H1VA 3UB5A 2ZGZA 3RSEB 4FWLA 3CFPA 4BG9A 4BE0A 2XY5A 3ID8A 3PIOL 5ADXH 3NF8A 2O4GA 4BVOA 4DU4A 1WSGA 1P8ZA 5AQMA 3O08A 3IFRA 2FSJA 4O8UA 3V1RA 4Z94A 2ITMA 3DOKA 1NK6A 4FJNA 2QA4N 4H0OA 5HBMA 1P90A 4CJVA 1NGBA 5FPNA 4GW6A 3OYHA 4CHPA 4DTRA 1RDWX 1GOAA 1CZAN 2XY7A 5HL7L 4OKKA 3LP2A 1L3SA 4CJRA 5BR8K 1V4TA 3MK6A 3JS6A 4CFDA 2V7YA 4IDKA 1BISA 2YNFA 3VESA 4I9LA 2IVOA 4H4OA 3JAMO 2F8TA 4AHSA 4BQZA 3LPUA 3KHYA 4IBNA 2Q1NA 2GTDA 1XI1A 3EN9A 2KKZA 1S22A 4JRQA 1JXEA 3KK7A 3I8DA 4CZLA 4BDPA 3V6DA 3TR8A 4B1XB 3KLEA 1W2BM 4KPYA 3G10A 4CESA 1EQYA 4B08A 3MX5A 3AAPA 4PA1A 2GV9A 1RDBA 3THVA 5M1PA 1VSDA 1NG9A 3OTOK 5KQ8A 4GKJK 4A61A 3WQUA 4CHOA 4AHVA 1WLJA 2YKNA 1ATNA 1CXQA 3ATUA 4FWPA 2PY5A 1JCEA 2D0AA 5CHIA 2RKIA 3TPQA 4CZHA 3CFRA 4DTSA 4CZIA 4H5TA 4KTWA 2A6AA 2HMPA 1HYVA 3ZYYX 3VOVA 2QXFA 4IOAL 1LWEA 4RCHA 4KTZA 2A5XA 3HP9A 4N47A 3VTHA 4DF4A 3HO1A 3VEWA 1TKDA 4MDBA 3WNEA 3P83D 4U67L 3HP6A 1KVAA 2VCPA 1GLJO 5ELZA 3BDPA 3KK1A 5AQTA 1YAGA 4WFBL 3CCUN 1NJZA 5BPLA 5AQHA 3MWPA 4DS5A 1WSEA 3C6UA 4DV4K 4MFBA 3L2WA 4HCCA 4N41A 3S3MA 1OH6A 4DV6K 3RR8A 1IKVA 3C6TA 4WYBA 1KFSA 4CIFA 4F2SA 2V51B 5M1QA 4KV8A 1MA9B 4JI5K 3O1WA 3VQ9A 1C0GA 5J1EA 3LL3A 3DI6A 4MQ3A 1ASVA 4R79A 1XNRK 3KWGA 2YKMA 5AQIA 2YX6A 5AQOA 4BRFA 2QWOA 1QSSA 2NZTA 2ZJQL 1OH7A 1S9EA 4KHQA 3CJ7A 4AHRA 2YNHA 1O1WA 2KLAA 2VG6A 4O4GA 4DU1A 2ZM6K 2F8SA 4EP5A 3LDQA 3OBWA 4H03B 2JLEA 3FFIA 2Y1JA 1NGAA 1VQ6N 1E4FT 3MXIA 3UKRA 1RT3A 5BN9A 3W3DA 4OO1J 3VGMA 5J2QA 4FWSA 1OVQA 2BH1A 1ITGA 1Q9XA 1KFDA 3CM5A 1NK5A 1LWFA 1HNZK 3QERA 1KVCA 4KRFA 3IRXA 5C24A 3CC4N 3C7NA 3U9ZA 4DUZK 2E1YA 5TKYA 3BY5A 4IO9L 2ZQBA 1WSFA 3LP0A 3WNGA 1SL2A 4QOZB 4H0TB 3HTVA 3L3VA 2P9PB 3AVJA 1HKCA 3FR0A 3MCAB 4FPAA 4MLEA 3F5TA 5BPNA 3K58A 4RW4A 2D5RA 3MDQA 3K9KA 1GOCA 4DR5K 4G1QA 1HPMA 4W5TA 1BU6O 3Q7BA 3FZKA 3MX2A 3NVMA 1VSEA 1S72N 1UOCA 1NJWA 1JCGA 2D1KA 3L4QA 2O8BA 2WFBA 4B9QA 2Q0RA 3TSQA 5C2DA 2OZSA 3VF4A 3O4WA 3MXMA 2NUBA 2O8EA 3OYLA 2O8FB 1QSLA 3K9JA 2A40A 3A0IX 3QBWA 1SKWA 2J4RA 3CMAN 3OYNA 4K43A 4TSXA 4BREA 4FLVA 4E0DA 5HRPA 3WUHA 4KI6A 3M3ZA 4CJEA 1ZBFA 3TSUA 3T1YK 3HI0A 3ULDA 3HJFA 1Q18A 4NO7A 4AM7A 3VPZA 1CZ9A 3VENA 3OHRA 2O8CB 4BR7A 1NGCA 4B9LA 1ATSA 3ZT4A 3CQ8A 3CMEN 1U47A 4HHTA 3HSCA 1M1KO 4HWIA 5M1FA 3QICA 3CCJN 1QE1A 1RT1A 2P9KB 3SBGA 2P9IA 4CFCA 3A5LC 3H45C 4YORA 1U2VB 4J2AA 4JK9A 4AH9A 4M3XA 1IKYA 1RDUA 3HOSA 3C94A 5EU7A 3KJVA 5J2NA 5KGWA 3AVHA 2YNGA 2R7YA 1MWMA 4XH1A 5AQUA 5HRNA 1FJGK 1TK5A 3ZSYA 1RBSA 4EHTA 4CGFA 3SBTA 2HBKA 4E3SA 2OCEA 1GLAG 3QB0A 2PYJA 4L8RB 1TK8A 4BRGA 1HQUA 1T44A 4ISEA 4DQQA 4FJMA 3O9TA 4C8KA 4KH6A 5CYMA 4IXCA 2BANA 4C23A 2Q3SA 1YI2N 3FLCO 2HHSA 3OYMA 2Z1GA 1U4BA 4ELTA 1N36K 2VG5A 5LL6Z 1YT3A 3IDHA 1ZBIA 1VAZA 2HBJA 3BGRA 1DLOA 4C8NA 5T7BA 1TYQA 4BRKA 3NHGA 4IKFA 3D7EO 3LDLA 4H0XB 3AVLA 1LOTB 3PO4A 5J2PA 1S1VA 3AO1A 5AZJB 4DFJA 3RVCA 4Q0BA 1JXBA 3SUPA 3K0SA 3QMLA 2XHBA 3R6MA 4YOWA 3ZSVA 2RF2A 4IJNA 4G9ZA 4A62A 2ITGA 3VQEA 3SNNA 3DXKA 5AQLA 1W9HA 5GAEP 2XY6A 3NF7A 3C65A 4OPKA 3DMJA 3NH2A 3G0ZA 2X78A 4FLWA 3MN7A 2RE2A 4BC5A 1SL1A 3ATVA 3DLBA 4ID1A 1FKPA 3ZEUA 1BI4B 2G8HA 3ZSXA 3B6OA 1GLEG 1CLQA 3QNNA 4ELVA 2YCHA 3V1QA 3JXUA 5KRSA 4RW7A 1IJJA 4JNEA 1VK0A 2B5JA 4B9MA 1VQ4N 3VMFB 2BTFA 3EO3A 1GLFO 5AQFA 4FLXA 4DR3K 3J7ZO 4KHUA 5EX5A 1KLMA 3E9LA 3TAMA 3MCPA 4NB4A 3L2VA 3U9DA 2B6AA 5KQDA 4W5OA 3CD6N 3SQ1A 1V4SA 5E84A 1EWQA 1RTJA 3AO3A 3P39A 4LFBK 1X3NA 2LSNA 3WQTA 1YTUA 2DFFA 4YOYA 1ZBHA 5JMVA 1T7PA 4JKDA 4NCAA 1N33K 1XUPO 3QO9A 3T19A 3G4SN 4BWMA 3G25A 3V4IA 2D0OA 4OPJA 4PWDA 2AA4A 4IZ9A 3VQ8A 4HUEA 3CF5L 5BRDA 3HZ6A 3DRSA 3HOTA 4QCLA 2QWMA 3R9PA 4YY3K 3G6EN 5AQYA 1D9DA 4KKOA 2UXCK 4LFAK 2A1SA 4J2DA 3THWB 1JLEA 3HVTA 3DOLA 3MN9A 4H0PA 2CGJA 2E2PA 1IBKK 2Q97A 3RTVA 5DM7L 3SAGA 4MO4A 1VHXA 4H5VA 1C0TA 3WXIA 3SUQA 4FWMA 4JI8K 4LSLA 4FJXA 3IMXA 4JHDB 1U48A 2YJFA 1NK8A 1YUWA 2QK9A 1TV6A 4X64K 1KQSM 1XMOK 2UU9K 5AFUA 4FM1A 4PUOA 4W5QA 3EE8A 3VQAA 2DTUA 1CZBA 5KPZA 4DV3K 2FC0A 4FYDA 4DSEA 4IJAA 4C8LA 4DB3A 3VEOA 4E89A 2KQ2A 3ALYA 3QDKA 5AZIB 1RBTA 1WBBA 3FZHA 3THYB 2Q31A 4KHPK 4Z4IA 3ZETB 4DQ8A 3S41A 4FLYA 5K14A 3HRGA 1IBMK 2QWLA 3HSTB 2HMIA 4ISGA 2P9SB 4PKIA 1RT5A 4IOCL 4I9QA 1VQ8N 3K5LA 1X9SA 4O5FA 4CCHA 4BRMA 3CPWM 3M8SA 1K8KB 3ZT2A 4DUYK 3S9HA 1RT4A 3DLGA
chains in the Genus database with same CATH topology
4CIGA 3OYGA 4DU3A 4KTWA 4CJ5A 4DSLA 1HYVA 1Z26A 3I0RA 4O5BA 1SUQA 4DTXA 4OJRA 3TABA 4K8ZA 4E7KA 1CXUA 4RW8A 4FCYA 4Z4FA 4OVLA 4CE9A 4I2PA 5CYQA 4NYNA 5FDLA 2QXFA 5D3GA 4CJWA 1BIZA 1LWEA 3QESA 4KTZA 1X9MA 4N47A 3HP9A 4DLGA 3AVIA 3TI0A 4JS4A 1WNSA 1TK0A 4DF4A 3HO1A 3SJJA 3HM9A 1TKDA 2OPSA 4N56A 3WNEA 2ZE2A 3P83D 3LZIA 2RPIA 1IKXA 4LH4A 1NOYA 3V1OA 4M3TA 3HL8A 1FXXA 3HP6A 1KVAA 1ZYQA 5HLFA 4CEQA 2HNYA 4DFPA 1BCOA 2EX3A 3BDPA 2IGIA 4E1NA 3KK1A 2OPRA 4IG0A 3T1AA 4K8XA 4FJIA 4CK3A 3U3GA 1NJZA 4AHTA 4CJTA 1REVA 1Q8IA 4DS5A 3DM2A 1WSEA 1FK9A 3C6UA 4MFBA 3L2WA 2X6NA 3DRPA 2HNDA 3U3YA 3TAGA 3S3MA 1NK0A 3ZT0A 4N41A 4NCBA 3O3GA 1RTHA 2F96A 3RR8A 1IKVA 3C6TA 1KFSA 4CIFA 3NH1A 2KFNA 4F2SA 1D8YA 3K5OA 4DTOA 4KV8A 5FRNA 4CEEA 2D0BA 3VQ9A 4IFVA 5J1EA 3NDKA 3TAEA 5FROA 4OLAA 3DI6A 3V9SA 4MQ3A 1ASVA 4CJPA 1WN7A 4FLUA 1NKBA 2YKMA 5DK5A 5KI6A 4C8MA 2WONA 1QHTA 4O55A 1QSSA 1NJYA 4CHNA 4F4KA 3RMCA 4HCBA 3B6PA 1S9EA 4M41A 4KB1A 4KHQA 2KW4A 4HVJA 1L3UA 1NOZA 3VQDA 4AHRA 3OJSA 2YNHA 2W42A 1IG9A 2P1JA 2Y1IA 1O1WA 3ZSZA 2VG6A 4Z4EA 1JLGA 4B9UA 3V81A 2O4IA 4O4GA 1EKEA 4DU1A 2F8SA 4EP5A 4KFBA 3QETA 2OA8A 4KHWA 2IAJA 2JLEA 3FFIA 4BE2A 2Y1JA 4M3ZA 4F8RA 4O0IA 4DQRA 3KLIA 3O4QA 3MXIA 1EXQA 4E7JA 1HJRA 3MXJA 1RT3A 2G8VA 1C1CA 1WAJA 3AVKA 4FJJA 1B9FA 3HPOA 5J2QA 4ID5A 4DQPA 1S1WA 3ZSWA 3OYFA 3LAMA 3OYCA 1LW2A 4RW9A 3H08A 3LZJA 1U49A 1ITGA 4KO0A 3ZSOA 4Z4HA 5JS2A 1LV5A 1Q9XA 4Y1CA 1KFDA 3QEWA 3CM5A 1NK5A 1LWFA 1LAWA 2IDOA 3QERA 1KVCA 4KRFA 3IRXA 5C24A 3OY9A 4JS5A 3NBPA 4DQIA 4YFUA 1HRHA 4R5PA 1BL3A 1A5VA 1RT2A 3HVRA 3NE6A 1WSHA 5I42A 1TKZA 1U04A 2HHQA 3QEIA 3TANA 1TKTA 4E1MA 1HNIA 1C0UA 3VA3A 3ZSQA 1X1PA 2IC3A 2ZQBA 1JLCA 1WSFA 1VRUA 2OPQA 3LP0A 3WNGA 4HUFA 3SZ2A 4B8CA 3NGIA 2A1RA 1T8EA 3L3VA 5KRTA 3RMBA 1JLFA 3AVJA 1RDAA 4RW6A 4BWJA 4DSFA 1J5OA 1B92A 1KVBA 4CJ3A 3AVMA 1QS4A 5HRSA 3MEEA 4DLEA 2HB5A 4CGHA 3V9WA 3K58A 3PO5A 4DWIA 4QAGA 4RW4A 3HT3A 2D5RA 4CK2A 4XIUA 2QKKA 2BGGA 3VQ5A 1GOCA 3LDSA 1NK9A 1K6YA 1BGXT 1Z25A 3NF9A 4LSNA 4G1QA 3QIPA 4B9TA 4HTUA 4W5TA 4CFAA 1DTQA 4CHYA 5I3UA 5HP1A 1VSEA 1TKXA 3RRGA 2YHAA 3V9XA 2BE2A 1UOCA 1NJWA 3QEPA 2YV0X 1FKOA 1ZBUA 2E4LA 4FZYA 5DMRA 1A5WA 3HYFA 4FJ8A 3M8QA 4CF9A 4FJKA 2OZSA 2P51A 1DTTA 4NCGA 3AA4A 3OVNA 1VSMA 2NUBA 4AILC 3CG7A 3MXMA 3OYLA 4F3TA 2FBYA 1EETA 2ATQA 3ZT1A 4J2EA 4OGCA 3RWUA 1VSKA 1UA1A 1QSLA 1QSYA 3VQ6A 4FJGA 3CFOA 3AVAA 4KHYA 3AO5A 3RMDA 1SKWA 1RT7A 1C6VA 4I2QA 4M3RA 4FK0A 2AJQA 3OYNA 1LWCA 3DRRA 3SUOA 5C42A 3O3HA 4DTJA 3SQ2A 1RNHA 4TSXA 4FLVA 3DLKA 2BDPA 3UIQA 2KFZA 4CJFA 5HRPA 3OS1A 1JL2A 1S9GA 1TGOA 4E0DA 4KB0A 1L3TA 4CJEA 1ZBFA 4OKEA 1UAXA 4CEDA 3VQPA 3KTQA 4B9SA 4DSIA 2PZSA 1SV5A 4EP4A 1JL1A 3ULDA 3HJFA 1KLNA 2E6LA 5HRRA 1YVUA 3TAQA 4FLZA 2B4JA 4FLTA 3MEDA 3HXMA 2P5OA 4F2RA 4FJ9A 4FM0A 1CZ9A 4LD0A 2HW3A 2E6MA 4OGEA 1XHXA 3O3FA 1SL2A 3AO4A 3ZSRA 3OYJA 4E19A 1KCFA 3ZT4A 1XC9A 4B9LA 4QOZB 3CQ8A 2HNZA 4KHNA 1U47A 1HQEA 3L3UA 4CF1A 4CEFA 3AA5X 4HHTA 3P5JA 4B9NA 2Z1JA 4JLHA 3NGYA 4DTNA 2XO7A 5C25A 3L2RA 3K2PA 3LPTA 1XHZA 4GVMA 1VSLA 1QE1A 1RT1A 2HVIA 4CFCA 3VQQA 2D0CA 4BE1A 1KSPA 2OYQA 1HMVA 1IH7A 3PX4A 2ETJA 2FBTA 4O44A 4AH9A 4J2AA 1S5JA 4M3XA 1IKYA 1RBUA 3K57A 4DF8A 2I5JA 3QEXA 4KAZA 1VSFA 1GOBA 3C94A 5EU7A 3KJVA 4CK1A 3EZ5A 5J2NA 4W5NA 2OPPA 2P5GA 5KGWA 4FM2A 4Z0UA 3AVHA 2YNGA 1WSJA 5CZ1A 2R7YA 2HHUA 3DLEA 3MEGA 5HRNA 1TK5A 3K5MA 1VSHA 4CHQA 1YTAA 3ZSYA 1RBSA 1C1BA 3CYMA 4ZTFA 4CGFA 4BACA 4CF8A 4M3WA 4CJSA 4E3SA 3OYBA 4HUGA 4ZHRA 4CJUA 2PYJA 4L8RB 1TK8A 3LALA 1RTDA 4F3OA 3AVCA 4BDZA 3S3OA 2JGUA 1HQUA 4DQQA 2RN2A 1BCMA 3P1GA 3VQ4A 3OYAA 3KD5E 4YNQA 4FJMA 1RBVA 4Z4CA 4N5SA 4ICLA 3NH0A 3PUFA 2YHBA 4C8KA 4DSJA 5CYMA 1XWLA 2BANA 4CHZA 4KHSA 2Q3SA 4C8OA 4CJLA 1SKSA 2HVHA 4CF0A 3HK2A 3AVBA 3RMAA 3OYMA 2HHSA 3TARA 2QKBA 2Z1GA 1U4BA 4ELTA 1B9DA 1WSIA 2ZD1A 1C0MA 1ZBLA 1TAUA 2FBXA 3SV3A 2VG5A 3D45A 1TL3A 3CM6A 3DLRA 1YT3A 4Y1DA 3NFAA 3HPGA 1ZBIA 3M8RA 4JRPA 3VQ7A 3KK2A 3M8PA 1D9FA 3K59A 4FK4A 3V9UA 1T05A 3BGRA 5HROA 1DLOA 4C8NA 5T7BA 3KK3A 4E7HA 1X9WA 3KD1E 4Z4GA 2OZMA 2HHWA 3LWLA 1J54A 3NHGA 4DTUA 1HYSA 4IKFA 4M45A 4FJLA 3I0SA 3WNHA 3AVLA 3KIOA 3LP1A 3OYEA 3TWHA 3PO4A 3IS9A 5J2PA 1WAFA 1S1VA 3AO1A 1T03A 4DFJA 1BQMA 3LP3A 3ZT3A 4Q0BA 1EX4A 4CGDA 1JXBA 3SUPA 3KLGA 4WE1A 1L3VA 3L8BA 4DS4A 1TVRA 3NGZA 4DFKA 1J53A 1KRPA 2KZZA 4DSKA 2XHBA 3ZSVA 2RF2A 4E7LA 4FW2A 1NJXA 1JKHA 1Y97A 3OS2A 3D0PA 2ITGA 3VQEA 3SNNA 1S1XA 1BIUA 3OYDA 1W9HA 1JLBA 3MAQA 3RRHA 3ASMA 4FVMA 1RDDA 4CJKA 2XY6A 4CJ4A 3NF7A 3QINA 4OLBA 4OPKA 1BHLA 1S6QA 3DMJA 4H8KA 1F21A 3EYZA 4RG8A 3NCIA 4CJQA 3PX0A 3SPYA 4B9VA 3NH2A 3G0ZA 2X78A 1UA0A 4FLWA 1S6PA 1UWBA 3KLHA 5SZTA 1SL1A 1RT6A 1JLQA 1QTMA 4ID1A 1A5XA 1S1UA 4IFYA 3DLBA 2G8FA 1FKPA 4CGJA 1BI4B 2Z1IA 3F9KA 1NKCA 3JSMA 4LY7A 1VRTA 2G8HA 4KREA 4N76A 1NKEA 3ZSXA 4B3OA 3B6OA 4OKJA 1NK4A 4W5RA 2KTQA 1RILA 2HHTA 2VWKA 1RTIA 4GMJB 1TL1A 4CF2A 3QNOA 1CLQA 3QNNA 2G8KA 4ELVA 3ITHA 3A2FA 3V1QA 4DG1A 5KRSA 1IKWA 1HYZA 3QIOA 4RW7A 4DQSA 3AO2A 3V9ZA 3VN5A 4FW1A 4EZ6A 1VK0A 3SQ4A 3OYKA 3DLHA 2B5JA 4KI4A 4B9MA 3DYAA 2XY8A 1U45A 4AHUA 4DMNA 1C1AA 3C95A 4FLXA 1N5YA 3AVFA 4B8AB 1Q9YA 4KHUA 3KKSA 4CEAA 4CEOA 4E7IA 1SKRA 3QEVA 1KLMA 3TAMA 1ASUA 2G8IA 3OYIA 4M3YA 3IAYA 2FBVA 3KLFA 3L2VA 2VWJA 3IG1A 4M3UA 4KTQA 2B6AA 3SI6A 1N6QA 4W5OA 1VSIA 3SQ1A 1S1TA 2HHXA 2X6SA 3JYTA 2G8WA 3L2UA 1RTJA 3AO3A 4Q5VA 4J2BA 2KZMA 3MECA 2LSNA 3F73A 3CFPA 4CEBA 2GUIA 3AA3A 3AVNA 1YTUA 2DFFA 5CZ2A 4BE0A 2XY5A 2XRIA 1ZBHA 3L2QA 1T7PA 1JLAA 1HPZA 1BI4A 3LANA 4NCAA 3QO9A 3T19A 3NF8A 4FJ7A 4KI6A 4BWMA 3V4IA 4OPJA 2O4GA 4DU4A 4PWDA 2IOCA 4I7FA 3VQ8A 1WSGA 3OS0A 2DFEA 4HUEA 1HNVA 1W0HA 1RBRA 3V1RA 5KGXA 3DRSA 5E41A 4DFMA 4BDYA 2IS3A 1RCHA 3VQBA 1D5AA 4QCLA 3DOKA 4CECA 3VQCA 1NK6A 1L5UA 4FJNA 1D9DA 1ASWA 4KKOA 5HBMA 3LWMA 3NAEA 3SYZA 4CJVA 1KTQA 2A1SA 4J2DA 2GBZA 4GW6A 1JLEA 4AHCA 3HVTA 3OYHA 4CHPA 4DTRA 1GOAA 3DOLA 3PV8A 3NF6A 3PX6A 3RR7A 3ISNC 2XY7A 4OKKA 3LP2A 3SUNA 1L3SA 4CEZA 1LAVA 3KKRA 2Z1HA 3O4NA 1I3AA 1TAQA 4NYFA 4CFBA 4CJRA 4FJHA 4FK2A 3RTVA 4CFDA 4O0JA 4LH5A 2HHVA 4IDKA 4ZTJA 2PYLA 4FJ5A 4IG3A 1BISA 1C0TA 2YNFA 2G8UA 3TAFA 2DY4A 3OJUA 3SUQA 1RDCA 4I9LA 3AV9A 4CERA 3AVGA 4CGGA 4H4OA 4LSLA 3WNFA 4ELUA 2F8TA 5KTQA 4AHSA 4FJXA 4PQUA 2VG7A 1U48A 3SPZA 3LPUA 3T3FA 3SQ0A 5CY4A 4IBNA 1TV6A 1NK8A 2QK9A 2X74A 1XI1A 3SV4A 5J2MA 4FM1A 4FZXC 1R0AA 4PUOA 3EY1A 1BQNA 3PY8A 4FXDA 4UQGA 4W5QA 1J9AA 4JRQA 3VQAA 4DTPA 1JXEA 2DTUA 1G15A 1CZBA 3I8DA 2WOMA 1IO2A 4BDPA 3LAKA 3V6DA 2FC0A 4EZ9A 4FYDA 3TR8A 4DSEA 3KLEA 4C8LA 4DTMA 4KPYA 3G10A 4FZZA 4E89A 4CESA 3ALYA 2KQ2A 1SL0A 4B08A 1RBTA 1QQCA 4Z4IA 4CGIA 4PY5A 4PA1A 3ZCMA 1VSJA 1RDBA 2GV9A 3E01A 4FLYA 3VA0A 1I39A 2EHGA 5K14A 3TAPA 3THVA 3S3NA 2DFHA 1LW0A 1VSDA 3HSTB 2HMIA 4H4MA 3QLHA 4CHOA 4AHVA 3SCXA 3U6FA 4M42A 5FRMA 1WLJA 4HCCA 1RT5A 5JS1A 1EP4A 2YNIA 1MU2A 1CXQA 2YKNA 4I9QA 3K5LA 1X9SA 3HPHA 3K5NA 2PY5A 4CCHA 2D0AA 3ZT2A 3M8SA 3S9HA 1NK7A 2RKIA 1RT4A 3AA2A 4CIEA 3CFRA 4DTSA 3DLGA 5SWMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CIG A;  3OYG A;  4DU3 A;  4KTW A;  4CJ5 A;  4DSL A;  1HYV A;  1Z26 A;  3I0R A;  4O5B A;  1SUQ A;  4DTX A;  4OJR A;  3TAB A;  4K8Z A;  4E7K A;  1CXU A;  4RW8 A;  4FCY A;  4Z4F A;  4OVL A;  4CE9 A;  4I2P A;  5CYQ A;  4NYN A;  5FDL A;  2QXF A;  5D3G A;  4CJW A;  1BIZ A;  1LWE A;  3QES A;  4KTZ A;  1X9M A;  4N47 A;  3HP9 A;  4DLG A;  3AVI A;  3TI0 A;  4JS4 A;  1WNS A;  1TK0 A;  4DF4 A;  3HO1 A;  3SJJ A;  3HM9 A;  1TKD A;  2OPS A;  4N56 A;  3WNE A;  2ZE2 A;  3P83 D;  3LZI A;  2RPI A;  1IKX A;  4LH4 A;  1NOY A;  3V1O A;  4M3T A;  3HL8 A;  1FXX A;  3HP6 A;  1KVA A;  1ZYQ A;  5HLF A;  4CEQ A;  2HNY A;  4DFP A;  1BCO A;  2EX3 A;  3BDP A;  2IGI A;  4E1N A;  3KK1 A;  2OPR A;  4IG0 A;  3T1A A;  4K8X A;  4FJI A;  4CK3 A;  3U3G A;  1NJZ A;  4AHT A;  4CJT A;  1REV A;  1Q8I A;  4DS5 A;  3DM2 A;  1WSE A;  1FK9 A;  3C6U A;  4MFB A;  3L2W A;  2X6N A;  3DRP A;  2HND A;  3U3Y A;  3TAG A;  3S3M A;  1NK0 A;  3ZT0 A;  4N41 A;  4NCB A;  3O3G A;  1RTH A;  2F96 A;  3RR8 A;  1IKV A;  3C6T A;  1KFS A;  4CIF A;  3NH1 A;  2KFN A;  4F2S A;  1D8Y A;  3K5O A;  4DTO A;  4KV8 A;  5FRN A;  4CEE A;  2D0B A;  3VQ9 A;  4IFV A;  5J1E A;  3NDK A;  3TAE A;  5FRO A;  4OLA A;  3DI6 A;  3V9S A;  4MQ3 A;  1ASV A;  4CJP A;  1WN7 A;  4FLU A;  1NKB A;  2YKM A;  5DK5 A;  5KI6 A;  4C8M A;  2WON A;  1QHT A;  4O55 A;  1QSS A;  1NJY A;  4CHN A;  4F4K A;  3RMC A;  4HCB A;  3B6P A;  1S9E A;  4M41 A;  4KB1 A;  4KHQ A;  2KW4 A;  4HVJ A;  1L3U A;  1NOZ A;  3VQD A;  4AHR A;  3OJS A;  2YNH A;  2W42 A;  1IG9 A;  2P1J A;  2Y1I A;  1O1W A;  3ZSZ A;  2VG6 A;  4Z4E A;  1JLG A;  4B9U A;  3V81 A;  2O4I A;  4O4G A;  1EKE A;  4DU1 A;  2F8S A;  4EP5 A;  4KFB A;  3QET A;  2OA8 A;  4KHW A;  2IAJ A;  2JLE A;  3FFI A;  4BE2 A;  2Y1J A;  4M3Z A;  4F8R A;  4O0I A;  4DQR A;  3KLI A;  3O4Q A;  3MXI A;  1EXQ A;  4E7J A;  1HJR A;  3MXJ A;  1RT3 A;  2G8V A;  1C1C A;  1WAJ A;  3AVK A;  4FJJ A;  1B9F A;  3HPO A;  5J2Q A;  4ID5 A;  4DQP A;  1S1W A;  3ZSW A;  3OYF A;  3LAM A;  3OYC A;  1LW2 A;  4RW9 A;  3H08 A;  3LZJ A;  1U49 A;  1ITG A;  4KO0 A;  3ZSO A;  4Z4H A;  5JS2 A;  1LV5 A;  1Q9X A;  4Y1C A;  1KFD A;  3QEW A;  3CM5 A;  1NK5 A;  1LWF A;  1LAW A;  2IDO A;  3QER A;  1KVC A;  4KRF A;  3IRX A;  5C24 A;  3OY9 A;  4JS5 A;  3NBP A;  4DQI A;  4YFU A;  1HRH A;  4R5P A;  1BL3 A;  1A5V A;  1RT2 A;  3HVR A;  3NE6 A;  1WSH A;  5I42 A;  1TKZ A;  1U04 A;  2HHQ A;  3QEI A;  3TAN A;  1TKT A;  4E1M A;  1HNI A;  1C0U A;  3VA3 A;  3ZSQ A;  1X1P A;  2IC3 A;  2ZQB A;  1JLC A;  1WSF A;  1VRU A;  2OPQ A;  3LP0 A;  3WNG A;  4HUF A;  3SZ2 A;  4B8C A;  3NGI A;  2A1R A;  1T8E A;  3L3V A;  5KRT A;  3RMB A;  1JLF A;  3AVJ A;  1RDA A;  4RW6 A;  4BWJ A;  4DSF A;  1J5O A;  1B92 A;  1KVB A;  4CJ3 A;  3AVM A;  1QS4 A;  5HRS A;  3MEE A;  4DLE A;  2HB5 A;  4CGH A;  3V9W A;  3K58 A;  3PO5 A;  4DWI A;  4QAG A;  4RW4 A;  3HT3 A;  2D5R A;  4CK2 A;  4XIU A;  2QKK A;  2BGG A;  3VQ5 A;  1GOC A;  3LDS A;  1NK9 A;  1K6Y A;  1BGX T;  1Z25 A;  3NF9 A;  4LSN A;  4G1Q A;  3QIP A;  4B9T A;  4HTU A;  4W5T A;  4CFA A;  1DTQ A;  4CHY A;  5I3U A;  5HP1 A;  1VSE A;  1TKX A;  3RRG A;  2YHA A;  3V9X A;  2BE2 A;  1UOC A;  1NJW A;  3QEP A;  2YV0 X;  1FKO A;  1ZBU A;  2E4L A;  4FZY A;  5DMR A;  1A5W A;  3HYF A;  4FJ8 A;  3M8Q A;  4CF9 A;  4FJK A;  2OZS A;  2P51 A;  1DTT A;  4NCG A;  3AA4 A;  3OVN A;  1VSM A;  2NUB A;  4AIL C;  3CG7 A;  3MXM A;  3OYL A;  4F3T A;  2FBY A;  1EET A;  2ATQ A;  3ZT1 A;  4J2E A;  4OGC A;  3RWU A;  1VSK A;  1UA1 A;  1QSL A;  1QSY A;  3VQ6 A;  4FJG A;  3CFO A;  3AVA A;  4KHY A;  3AO5 A;  3RMD A;  1SKW A;  1RT7 A;  1C6V A;  4I2Q A;  4M3R A;  4FK0 A;  2AJQ A;  3OYN A;  1LWC A;  3DRR A;  3SUO A;  5C42 A;  3O3H A;  4DTJ A;  3SQ2 A;  1RNH A;  4TSX A;  4FLV A;  3DLK A;  2BDP A;  3UIQ A;  2KFZ A;  4CJF A;  5HRP A;  3OS1 A;  1JL2 A;  1S9G A;  1TGO A;  4E0D A;  4KB0 A;  1L3T A;  4CJE A;  1ZBF A;  4OKE A;  1UAX A;  4CED A;  3VQP A;  3KTQ A;  4B9S A;  4DSI A;  2PZS A;  1SV5 A;  4EP4 A;  1JL1 A;  3ULD A;  3HJF A;  1KLN A;  2E6L A;  5HRR A;  1YVU A;  3TAQ A;  4FLZ A;  2B4J A;  4FLT A;  3MED A;  3HXM A;  2P5O A;  4F2R A;  4FJ9 A;  4FM0 A;  1CZ9 A;  4LD0 A;  2HW3 A;  2E6M A;  4OGE A;  1XHX A;  3O3F A;  1SL2 A;  3AO4 A;  3ZSR A;  3OYJ A;  4E19 A;  1KCF A;  3ZT4 A;  1XC9 A;  4B9L A;  4QOZ B;  3CQ8 A;  2HNZ A;  4KHN A;  1U47 A;  1HQE A;  3L3U A;  4CF1 A;  4CEF A;  3AA5 X;  4HHT A;  3P5J A;  4B9N A;  2Z1J A;  4JLH A;  3NGY A;  4DTN A;  2XO7 A;  5C25 A;  3L2R A;  3K2P A;  3LPT A;  1XHZ A;  4GVM A;  1VSL A;  1QE1 A;  1RT1 A;  2HVI A;  4CFC A;  3VQQ A;  2D0C A;  4BE1 A;  1KSP A;  2OYQ A;  1HMV A;  1IH7 A;  3PX4 A;  2ETJ A;  2FBT A;  4O44 A;  4AH9 A;  4J2A A;  1S5J A;  4M3X A;  1IKY A;  1RBU A;  3K57 A;  4DF8 A;  2I5J A;  3QEX A;  4KAZ A;  1VSF A;  1GOB A;  3C94 A;  5EU7 A;  3KJV A;  4CK1 A;  3EZ5 A;  5J2N A;  4W5N A;  2OPP A;  2P5G A;  5KGW A;  4FM2 A;  4Z0U A;  3AVH A;  2YNG A;  1WSJ A;  5CZ1 A;  2R7Y A;  2HHU A;  3DLE A;  3MEG A;  5HRN A;  1TK5 A;  3K5M A;  1VSH A;  4CHQ A;  1YTA A;  3ZSY A;  1RBS A;  1C1B A;  3CYM A;  4ZTF A;  4CGF A;  4BAC A;  4CF8 A;  4M3W A;  4CJS A;  4E3S A;  3OYB A;  4HUG A;  4ZHR A;  4CJU A;  2PYJ A;  4L8R B;  1TK8 A;  3LAL A;  1RTD A;  4F3O A;  3AVC A;  4BDZ A;  3S3O A;  2JGU A;  1HQU A;  4DQQ A;  2RN2 A;  1BCM A;  3P1G A;  3VQ4 A;  3OYA A;  3KD5 E;  4YNQ A;  4FJM A;  1RBV A;  4Z4C A;  4N5S A;  4ICL A;  3NH0 A;  3PUF A;  2YHB A;  4C8K A;  4DSJ A;  5CYM A;  1XWL A;  2BAN A;  4CHZ A;  4KHS A;  2Q3S A;  4C8O A;  4CJL A;  1SKS A;  2HVH A;  4CF0 A;  3HK2 A;  3AVB A;  3RMA A;  3OYM A;  2HHS A;  3TAR A;  2QKB A;  2Z1G A;  1U4B A;  4ELT A;  1B9D A;  1WSI A;  2ZD1 A;  1C0M A;  1ZBL A;  1TAU A;  2FBX A;  3SV3 A;  2VG5 A;  3D45 A;  1TL3 A;  3CM6 A;  3DLR A;  1YT3 A;  4Y1D A;  3NFA A;  3HPG A;  1ZBI A;  3M8R A;  4JRP A;  3VQ7 A;  3KK2 A;  3M8P A;  1D9F A;  3K59 A;  4FK4 A;  3V9U A;  1T05 A;  3BGR A;  5HRO A;  1DLO A;  4C8N A;  5T7B A;  3KK3 A;  4E7H A;  1X9W A;  3KD1 E;  4Z4G A;  2OZM A;  2HHW A;  3LWL A;  1J54 A;  3NHG A;  4DTU A;  1HYS A;  4IKF A;  4M45 A;  4FJL A;  3I0S A;  3WNH A;  3AVL A;  3KIO A;  3LP1 A;  3OYE A;  3TWH A;  3PO4 A;  3IS9 A;  5J2P A;  1WAF A;  1S1V A;  3AO1 A;  1T03 A;  4DFJ A;  1BQM A;  3LP3 A;  3ZT3 A;  4Q0B A;  1EX4 A;  4CGD A;  1JXB A;  3SUP A;  3KLG A;  4WE1 A;  1L3V A;  3L8B A;  4DS4 A;  1TVR A;  3NGZ A;  4DFK A;  1J53 A;  1KRP A;  2KZZ A;  4DSK A;  2XHB A;  3ZSV A;  2RF2 A;  4E7L A;  4FW2 A;  1NJX A;  1JKH A;  1Y97 A;  3OS2 A;  3D0P A;  2ITG A;  3VQE A;  3SNN A;  1S1X A;  1BIU A;  3OYD A;  1W9H A;  1JLB A;  3MAQ A;  3RRH A;  3ASM A;  4FVM A;  1RDD A;  4CJK A;  2XY6 A;  4CJ4 A;  3NF7 A;  3QIN A;  4OLB A;  4OPK A;  1BHL A;  1S6Q A;  3DMJ A;  4H8K A;  1F21 A;  3EYZ A;  4RG8 A;  3NCI A;  4CJQ A;  3PX0 A;  3SPY A;  4B9V A;  3NH2 A;  3G0Z A;  2X78 A;  1UA0 A;  4FLW A;  1S6P A;  1UWB A;  3KLH A;  5SZT A;  1SL1 A;  1RT6 A;  1JLQ A;  1QTM A;  4ID1 A;  1A5X A;  1S1U A;  4IFY A;  3DLB A;  2G8F A;  1FKP A;  4CGJ A;  1BI4 B;  2Z1I A;  3F9K A;  1NKC A;  3JSM A;  4LY7 A;  1VRT A;  2G8H A;  4KRE A;  4N76 A;  1NKE A;  3ZSX A;  4B3O A;  3B6O A;  4OKJ A;  1NK4 A;  4W5R A;  2KTQ A;  1RIL A;  2HHT A;  2VWK A;  1RTI A;  4GMJ B;  1TL1 A;  4CF2 A;  3QNO A;  1CLQ A;  3QNN A;  2G8K A;  4ELV A;  3ITH A;  3A2F A;  3V1Q A;  4DG1 A;  5KRS A;  1IKW A;  1HYZ A;  3QIO A;  4RW7 A;  4DQS A;  3AO2 A;  3V9Z A;  3VN5 A;  4FW1 A;  4EZ6 A;  1VK0 A;  3SQ4 A;  3OYK A;  3DLH A;  2B5J A;  4KI4 A;  4B9M A;  3DYA A;  2XY8 A;  1U45 A;  4AHU A;  4DMN A;  1C1A A;  3C95 A;  4FLX A;  1N5Y A;  3AVF A;  4B8A B;  1Q9Y A;  4KHU A;  3KKS A;  4CEA A;  4CEO A;  4E7I A;  1SKR A;  3QEV A;  1KLM A;  3TAM A;  1ASU A;  2G8I A;  3OYI A;  4M3Y A;  3IAY A;  2FBV A;  3KLF A;  3L2V A;  2VWJ A;  3IG1 A;  4M3U A;  4KTQ A;  2B6A A;  3SI6 A;  1N6Q A;  4W5O A;  1VSI A;  3SQ1 A;  1S1T A;  2HHX A;  2X6S A;  3JYT A;  2G8W A;  3L2U A;  1RTJ A;  3AO3 A;  4Q5V A;  4J2B A;  2KZM A;  3MEC A;  2LSN A;  3F73 A;  3CFP A;  4CEB A;  2GUI A;  3AA3 A;  3AVN A;  1YTU A;  2DFF A;  5CZ2 A;  4BE0 A;  2XY5 A;  2XRI A;  1ZBH A;  3L2Q A;  1T7P A;  1JLA A;  1HPZ A;  1BI4 A;  3LAN A;  4NCA A;  3QO9 A;  3T19 A;  3NF8 A;  4FJ7 A;  4KI6 A;  4BWM A;  3V4I A;  4OPJ A;  2O4G A;  4DU4 A;  4PWD A;  2IOC A;  4I7F A;  3VQ8 A;  1WSG A;  3OS0 A;  2DFE A;  4HUE A;  1HNV A;  1W0H A;  1RBR A;  3V1R A;  5KGX A;  3DRS A;  5E41 A;  4DFM A;  4BDY A;  2IS3 A;  1RCH A;  3VQB A;  1D5A A;  4QCL A;  3DOK A;  4CEC A;  3VQC A;  1NK6 A;  1L5U A;  4FJN A;  1D9D A;  1ASW A;  4KKO A;  5HBM A;  3LWM A;  3NAE A;  3SYZ A;  4CJV A;  1KTQ A;  2A1S A;  4J2D A;  2GBZ A;  4GW6 A;  1JLE A;  4AHC A;  3HVT A;  3OYH A;  4CHP A;  4DTR A;  1GOA A;  3DOL A;  3PV8 A;  3NF6 A;  3PX6 A;  3RR7 A;  3ISN C;  2XY7 A;  4OKK A;  3LP2 A;  3SUN A;  1L3S A;  4CEZ A;  1LAV A;  3KKR A;  2Z1H A;  3O4N A;  1I3A A;  1TAQ A;  4NYF A;  4CFB A;  4CJR A;  4FJH A;  4FK2 A;  3RTV A;  4CFD A;  4O0J A;  4LH5 A;  2HHV A;  4IDK A;  4ZTJ A;  2PYL A;  4FJ5 A;  4IG3 A;  1BIS A;  1C0T A;  2YNF A;  2G8U A;  3TAF A;  2DY4 A;  3OJU A;  3SUQ A;  1RDC A;  4I9L A;  3AV9 A;  4CER A;  3AVG A;  4CGG A;  4H4O A;  4LSL A;  3WNF A;  4ELU A;  2F8T A;  5KTQ A;  4AHS A;  4FJX A;  4PQU A;  2VG7 A;  1U48 A;  3SPZ A;  3LPU A;  3T3F A;  3SQ0 A;  5CY4 A;  4IBN A;  1TV6 A;  1NK8 A;  2QK9 A;  2X74 A;  1XI1 A;  3SV4 A;  5J2M A;  4FM1 A;  4FZX C;  1R0A A;  4PUO A;  3EY1 A;  1BQN A;  3PY8 A;  4FXD A;  4UQG A;  4W5Q A;  1J9A A;  4JRQ A;  3VQA A;  4DTP A;  1JXE A;  2DTU A;  1G15 A;  1CZB A;  3I8D A;  2WOM A;  1IO2 A;  4BDP A;  3LAK A;  3V6D A;  2FC0 A;  4EZ9 A;  4FYD A;  3TR8 A;  4DSE A;  3KLE A;  4C8L A;  4DTM A;  4KPY A;  3G10 A;  4FZZ A;  4E89 A;  4CES A;  3ALY A;  2KQ2 A;  1SL0 A;  4B08 A;  1RBT A;  1QQC A;  4Z4I A;  4CGI A;  4PY5 A;  4PA1 A;  3ZCM A;  1VSJ A;  1RDB A;  2GV9 A;  3E01 A;  4FLY A;  3VA0 A;  1I39 A;  2EHG A;  5K14 A;  3TAP A;  3THV A;  3S3N A;  2DFH A;  1LW0 A;  1VSD A;  3HST B;  2HMI A;  4H4M A;  3QLH A;  4CHO A;  4AHV A;  3SCX A;  3U6F A;  4M42 A;  5FRM A;  1WLJ A;  4HCC A;  1RT5 A;  5JS1 A;  1EP4 A;  2YNI A;  1MU2 A;  1CXQ A;  2YKN A;  4I9Q A;  3K5L A;  1X9S A;  3HPH A;  3K5N A;  2PY5 A;  4CCH A;  2D0A A;  3ZT2 A;  3M8S A;  3S9H A;  1NK7 A;  2RKI A;  1RT4 A;  3AA2 A;  4CIE A;  3CFR A;  4DTS A;  3DLG A;  5SWM A; 
#chains in the Genus database with same CATH topology
 4CIG A;  2AP1 A;  1K73 O;  2E88 A;  3I0R A;  4O5B A;  4DV1 K;  1SZ2 A;  4DTX A;  4GV3 A;  3GL1 A;  4E7K A;  4FCY A;  4EFH A;  4Z4F A;  4B3T K;  4JKG A;  4BRH A;  4PKH A;  4NYN A;  5D3G A;  3QES A;  1XNQ K;  1X9M A;  2P9P A;  5LJW A;  4JS4 A;  1TK0 A;  3T69 A;  3LM2 A;  1Y64 A;  3HM9 A;  2OPS A;  3D2F A;  4N56 A;  3SMS A;  3LZI A;  4LH4 A;  3V1O A;  1ZYQ A;  5HLF A;  4LC9 B;  4DFP A;  3ENH A;  4GVE A;  1QQO A;  3T1A A;  4K8X A;  3U3G A;  3CQX A;  2NRZ A;  4LF4 K;  3DM2 A;  5KPR A;  4DWI A;  2GWJ A;  1NK0 A;  4IOX A;  4PQU A;  2P9L B;  1WOQ A;  3ZT0 A;  1RTH A;  2F96 A;  1HKG A;  2KFN A;  3ENO A;  1D8Y A;  3K5O A;  4JEP A;  5LMU K;  2D0B A;  4CBX A;  4IFV A;  3TAE A;  4BR9 A;  3O9R A;  2A3Z A;  2HF4 A;  2E20 A;  1QHT A;  4O55 A;  4HCB A;  1BUP A;  3RMC A;  4JYA K;  2YJE A;  3B6P A;  2HST A;  4KB1 A;  2KW4 A;  1L3U A;  4B3S K;  3CJC A;  1NOZ A;  1SQK A;  4ISF A;  2P1J A;  2P9U B;  3N4P A;  3ZSZ A;  1VQ5 N;  4Y0W A;  1EKE A;  3KVG A;  3VGL A;  4KFB A;  3QET A;  2OA8 A;  3PLA A;  2A41 A;  4BE2 A;  4M3Z A;  4F8R A;  5KPT A;  1HJR A;  2G8V A;  2ASP A;  5ADX A;  1B9F A;  1YXQ A;  4ID5 A;  4DQP A;  3ZSW A;  3OYF A;  1U49 A;  3CIP A;  1Q81 O;  3ZSO A;  5JS2 A;  3L6Q A;  1ATR A;  4Y1C A;  4BRD A;  4BR5 A;  1LAW A;  4JKF A;  3OY9 A;  2H3G X;  4DQI A;  1HJO A;  1HRH A;  2A42 A;  1A5V A;  3VTI A;  1HNW K;  1U04 A;  2HHQ A;  2CGK A;  1QHA A;  2RHK A;  4E1M A;  3VA3 A;  2IC3 A;  1JLC A;  2OPQ A;  1EO1 A;  5E26 A;  2W40 A;  1HNX K;  4N76 A;  2HVI A;  1T8E A;  1HX1 A;  4BVP A;  3RMB A;  1SAZ A;  1ZXO A;  3ZX2 A;  1Q86 O;  2F7T A;  5HRS A;  3V9W A;  2WTU A;  4XIU A;  1BWF O;  3TSP A;  1NK9 A;  1K6Y A;  3NF9 A;  3VGK A;  4NLB A;  3UKU B;  4HTU A;  4CFA A;  3A5N C;  4CZK A;  4X62 K;  1TKX A;  4FOE A;  2QI2 A;  3RRG A;  3V9X A;  2QWR A;  3PIP L;  1FKO A;  2E4L A;  4FZY A;  2EWS A;  3EKU A;  1W97 L;  4FJ8 A;  2P51 A;  1DTT A;  3AA4 A;  4ILG B;  5CE3 A;  2O8D A;  1VSM A;  5GIO A;  4F3T A;  3L0Q A;  2FBY A;  1EET A;  3CHW A;  4OGC A;  2E2Q A;  3VQ6 A;  3CFO A;  3CXC M;  3AO5 A;  4I2Q A;  2AJQ A;  3SUO A;  5C42 A;  1NGH A;  4DTJ A;  3SQ2 A;  4BRO A;  3UIQ A;  4DV7 K;  3OS1 A;  1TGO A;  1L3T A;  4CED A;  3VQP A;  3KTQ A;  4B9S A;  4EP4 A;  3J80 O;  1YVU A;  2P5O A;  4FJ9 A;  3MED A;  1MWK A;  3FGU A;  4FWK A;  2E6M A;  3DXM B;  3O3F A;  2V7Z A;  3ZSR A;  3OYJ A;  1XC9 A;  4RWT A;  3WEE A;  4EAH D;  2YHY A;  4QS8 A;  2XO7 A;  3L2R A;  4KH5 A;  3K2P A;  3LPT A;  1XHZ A;  4CBU A;  5GIN A;  2OYQ A;  1IH7 A;  3LDN A;  2ETJ A;  4BC2 A;  1S5J A;  2CH6 A;  3K57 A;  3QEX A;  4F9O A;  1VSF A;  4I6M B;  3T1H K;  3BEX A;  2P5G A;  4AQY K;  4FM2 A;  5BPM A;  1WSJ A;  4QS7 A;  5CZ1 A;  1OKJ A;  3C6A A;  3MEG A;  4DR7 K;  3J8A A;  2P9N A;  1YTA A;  3CYM A;  4ZTF A;  4BAC A;  3H3N O;  3A8Y A;  1RTD A;  1C0F A;  2RN2 A;  3VQ4 A;  3MN6 A;  1RBV A;  4Z4C A;  3U4L A;  4ICL A;  3NH0 A;  3AAQ A;  2YHB A;  4DSJ A;  1M90 O;  4C8O A;  1NLV A;  2HVH A;  4CF0 A;  3HK2 A;  3RMA A;  3ZX3 A;  3ULE A;  2QKB A;  1B9D A;  1JCF A;  4YOV A;  3W0L A;  4LF5 K;  5GIP A;  4JRP A;  4B3R K;  3NMU A;  5A2Q O;  3V9U A;  3AGK A;  5HRO A;  3KK3 A;  1X9W A;  1BA1 A;  2OZM A;  4WQ4 C;  4JI6 K;  3LP1 A;  3OYE A;  3NVK A;  3IS9 A;  4LF9 K;  3EL2 A;  3ID6 A;  2OTL N;  3TU5 A;  3GG4 A;  3LP3 A;  1EX4 A;  2CH5 A;  4CGD A;  4DCH A;  1NGI A;  2Q36 A;  3BF1 A;  2HBM A;  4WE1 A;  5CR4 A;  1KRP A;  1TVR A;  4DFK A;  5AQQ A;  1J53 A;  2KZZ A;  3CJA A;  4DSK A;  4E7L A;  3G71 N;  5JLF A;  1JKH A;  1GLB G;  5EOY A;  1BIU A;  2D4W A;  3ASM A;  4FVM A;  2WUS A;  1RDD A;  3QIN A;  4OLB A;  2QW9 A;  1BHL A;  3SPY A;  3OBY A;  3PX0 A;  2I7P A;  1KXP A;  4YOU A;  4CD1 A;  3KLH A;  4KBO A;  1RT6 A;  1QTM A;  1S1U A;  2I7N A;  4IFY A;  2G8F A;  3JSM A;  4LY7 A;  3BZK A;  1N32 K;  1NJI O;  4QS9 A;  4B3O A;  1NK4 A;  4W5R A;  1TL1 A;  3P31 A;  3D2E A;  1IKW A;  4FW1 A;  5EXW A;  3OYK A;  3DYA A;  1U45 A;  4AHU A;  4DMN A;  1R59 O;  5BRE A;  1E3M A;  3AVF A;  1Q9Y A;  4CEA A;  1TUU A;  1ASU A;  1YJ9 N;  1TUY A;  1HUX A;  4CZM A;  4BRP A;  3IG1 A;  5JVH L;  4M3U A;  3CCL N;  4H0Y B;  4KTQ A;  3O80 A;  4LFC K;  2HHX A;  3SJH A;  2X6S A;  2ASO A;  2G8W A;  4Q5V A;  3CCV N;  2KZM A;  3F73 A;  4CEB A;  2GUI A;  3AA3 A;  4JK8 A;  4JI4 K;  1JLA A;  3LAN A;  1K8K A;  1NNE A;  2IOC A;  2DFE A;  3H46 O;  1HNV A;  4CJ7 A;  5KGX A;  2W6L A;  2WC9 A;  4DFM A;  4JD2 A;  4BDY A;  2IS3 A;  3VQB A;  4BGA A;  4AF1 A;  1NU0 A;  3VQC A;  3LWM A;  2UUC K;  3NAE A;  3SYZ A;  4WQ4 A;  2GBZ A;  1RGI A;  4FSV A;  4AHC A;  3ISN C;  5AQW A;  3R1X A;  4CEZ A;  1LAV A;  3KKR A;  2Z1H A;  3O4N A;  1I3A A;  4NYF A;  3VEV A;  4CFB A;  1VQ7 N;  2HHH K;  4FJH A;  4FK2 A;  2FXU A;  4O0J A;  4LH5 A;  2HHV A;  1YIJ N;  4ZTJ A;  5JVG L;  4BR2 A;  4FJ5 A;  4IG3 A;  3RSE A;  2DY4 A;  3TAF A;  3VEY A;  1RDC A;  4CW7 B;  4CER A;  3AVG A;  3H3O B;  2IIR A;  3P4I A;  3WNF A;  1NBW A;  2VG7 A;  3T3F A;  3SQ0 A;  5CY4 A;  2X74 A;  4BGB A;  3SV4 A;  5J2M A;  3R3L A;  1R0A A;  4H5W A;  3EY1 A;  4FXD A;  3WXJ A;  3R8E A;  4UQG A;  3THX B;  3N4Q A;  2VGM A;  4B1Y B;  3EZW A;  3CCE N;  1VQP N;  3LDO A;  2WOM A;  1IO2 A;  4JV5 K;  4EZ9 A;  1I94 K;  4DTM A;  4FZZ A;  1SL0 A;  5HOO A;  1QQC A;  4IWV A;  2NRR A;  4H5N A;  3VA0 A;  4B1U B;  2EHG A;  4CZG A;  3S3N A;  1LW0 A;  2HOE A;  4A2A A;  2WBN A;  4H4M A;  3QLH A;  4FWR A;  5TKW A;  3SCX A;  4K0K K;  5FRM A;  5JS1 A;  1MU2 A;  2QWP A;  3K5N A;  3VER A;  1IG8 A;  3AA2 A;  4JN4 A;  4UY8 O;  1QVF M;  4DU3 A;  4DSL A;  3BZC A;  3A5O C;  5GAH P;  4K8Z A;  4RW8 A;  3ZLJ A;  5LY3 A;  2IVN A;  4OVL A;  4CE9 A;  1BIZ A;  3AVI A;  1WNS A;  2ZF5 O;  5AQZ A;  2NRT A;  5F2R A;  3SJJ A;  4JI7 K;  2QEX N;  2F9T A;  3HL8 A;  1FXX A;  3TTC A;  2HNY A;  1BCO A;  5AQV A;  2EX3 A;  2IGI A;  1T6D A;  3WT0 A;  3UKR B;  4CK3 A;  1WUA A;  4BG8 A;  3DRP A;  3U3Y A;  2JWK A;  1O13 A;  4IO8 A;  2UUA K;  5AQP A;  4BRL A;  3O9Q A;  4CEE A;  3NDK A;  4OLA A;  5F0X A;  4CJP A;  1WN7 A;  1NKB A;  5DK5 A;  4J8F A;  3C7N B;  5KI6 A;  2GWK A;  4C8M A;  2WON A;  4LF7 K;  2OTJ N;  4F4K A;  4CHN A;  2FF3 B;  4HVJ A;  3UE5 A;  3VQD A;  3OJS A;  1BO5 O;  1IG9 A;  2Y1I A;  1BDG A;  1NMD A;  3V81 A;  2FLO A;  2O4I A;  2NNW A;  5GAD P;  4KHW A;  1NGF A;  2IAJ A;  4EHU A;  3KLI A;  3O4Q A;  3EEQ A;  1EXQ A;  3O1B A;  3VET A;  1WAJ A;  4FJJ A;  1S1W A;  3T7Z A;  3LAM A;  3OYC A;  1LW2 A;  4RW9 A;  3LZJ A;  5AFU H;  4MLH A;  4KO0 A;  1LV5 A;  2PBD A;  3QEW A;  2O8B B;  4B1Z A;  1OH8 A;  3QBX A;  1VQ9 N;  4ILJ A;  4R5P A;  2KHO A;  2F4V K;  2O8E B;  2NLX A;  1RT2 A;  2QWQ A;  3NE6 A;  1WSH A;  5F1X A;  1TKZ A;  3TAN A;  1TKT A;  2UXB K;  1HNI A;  1C0U A;  3ZSQ A;  4Z4G A;  1NGJ A;  1VRU A;  3SZ2 A;  4B8C A;  5KRT A;  1JLF A;  4RW6 A;  3TTF A;  4DSF A;  1J5O A;  5MLC Q;  1KVB A;  3AVM A;  1GLD G;  4L3Q A;  5AQK A;  3MEE A;  4DLE A;  2HB5 A;  4CGH A;  3CCS N;  3PO5 A;  3HT3 A;  3LDS A;  1ZC6 A;  4U7B A;  4KH4 A;  3QIP A;  2NRW A;  4B9T A;  4IFE A;  4CHY A;  5I3U A;  2YHA A;  2BE2 A;  4JI1 K;  3L4I A;  5FPD A;  5C12 A;  2YV0 X;  1WB9 A;  5DMR A;  4JAX A;  1A5W A;  3HYF A;  4DV5 K;  2HBL A;  3OVN A;  3CG7 A;  2P9I B;  2ASM A;  4J2E A;  3FE1 A;  1VSK A;  1UA1 A;  3WXK A;  1QSY A;  4FJG A;  3AVA A;  1OH5 A;  4KHY A;  1RT7 A;  2QTD A;  4M3R A;  4FK0 A;  1LWC A;  3O3H A;  3CCQ N;  2BDP A;  2KFZ A;  3DLK A;  4CJF A;  1S9G A;  4KB0 A;  4DSI A;  1K8A O;  4OKE A;  1UAX A;  3EE9 A;  3OW2 M;  1JL1 A;  2E6L A;  2B4J A;  4FM0 A;  4C1N I;  4LD0 A;  3P38 A;  4CZF A;  2YI1 A;  5C2F A;  4KHN A;  1GLC G;  4CEF A;  2QXL A;  3CC7 N;  4B9N A;  4JLH A;  3NGY A;  4JKB A;  5H1S Q;  3MN5 A;  4DTN A;  3WXM B;  1KC8 O;  1VQM N;  3E1Y A;  4GVM A;  3OA9 A;  5AQS A;  5BR9 A;  3VQQ A;  3CER A;  3EKS A;  2O8F A;  2FBT A;  4O44 A;  4PL8 A;  4BY9 C;  3A5M C;  5AQJ A;  4WQ5 C;  3ZX0 A;  1ILY A;  4CK1 A;  1TYQ B;  4Z0U A;  2HHU A;  3QFU A;  4JKA A;  4FOI A;  3K5M A;  1VSH A;  4OX9 K;  1Q82 O;  1C1B A;  1NGE A;  4CF8 A;  3I55 N;  3HBT A;  3OYB A;  4ZHR A;  4F3O A;  3CJ1 A;  3S3O A;  4K25 A;  3OYA A;  1IBL K;  4YNQ A;  2O8C A;  2JWL A;  4N5S A;  3F9M A;  3PUF A;  3DXK B;  1QVG M;  1XWL A;  5AQR A;  4CHZ A;  4KHS A;  4A5A A;  2NRH A;  4CJL A;  1SKS A;  1GLL O;  1J6Z A;  3VEZ A;  1C0M A;  2P9K A;  2E5L K;  1TAU A;  2FBX A;  5M1O A;  3D45 A;  1TL3 A;  3CM6 A;  2UYT A;  1U2V A;  3NFA A;  4DKW A;  3HPG A;  3M8R A;  3VQ7 A;  3KK2 A;  3ZEU B;  3BF3 A;  1D9F A;  3IUC A;  4FK4 A;  5AR0 A;  4E7H A;  3KD1 E;  1HYS A;  4NLC A;  3I0S A;  2GX9 A;  3KIO A;  3TWH A;  1XQS C;  1RFQ A;  1VQL N;  1BQM A;  3GBT A;  3ZT3 A;  5AQX A;  3KLG A;  1L3V A;  4BC4 A;  3L8B A;  2ZJR L;  3OS2 A;  4H0V B;  3PSF A;  2YHW A;  1JLB A;  3MAQ A;  3RRH A;  4IEI A;  4LF8 K;  1QQN A;  4CJK A;  5IWA K;  4M7X A;  1ESV A;  3NCI A;  1F21 A;  4CJQ A;  4B9V A;  1UA0 A;  1S6P A;  4RTF D;  3LDP A;  1UWB A;  5JLH A;  5IT9 O;  5SZT A;  2Z1I A;  1NKC A;  1DEJ A;  2HHT A;  1RIL A;  2VWK A;  1RTI A;  4GMJ B;  4WCE L;  3ITH A;  3B8A X;  2YHX A;  4DG1 A;  3M5R A;  3QIO A;  4DR1 K;  3H6E A;  3AO2 A;  3DWL A;  3E66 A;  3O9U A;  3VN5 A;  5AZJ A;  3THX A;  4WQ5 A;  1N8R O;  1NGD A;  1U6Z A;  4YOT A;  4K42 A;  1LCU A;  3KZB A;  4B8A B;  3VF2 A;  3KKS A;  3C0B A;  3AGR A;  4E7I A;  3QEV A;  1MDU B;  3O6W A;  2G8I A;  3OYI A;  4X66 K;  2QWN A;  3IAY A;  2FBV A;  5EVZ A;  4M3Y A;  2ZWH A;  2PAV A;  4E1J A;  1S1T A;  3JYT A;  2QM1 A;  3L2U A;  4J2B A;  3MEC A;  4K41 A;  3AVN A;  4EIA A;  2DPN A;  5CZ2 A;  2XRI A;  3L2Q A;  1HPZ A;  1BI4 A;  3CJB A;  1YIT N;  4FJ7 A;  3CPE A;  2GEL A;  4BRN A;  2NRX A;  1NWK A;  4I7F A;  3OS0 A;  1QZ6 A;  2BUP A;  2VYP A;  1W0H A;  1RBR A;  5E41 A;  4YDU C;  1RCH A;  1D5A A;  4CEC A;  1L5U A;  4X65 K;  3H1V X;  5GAG P;  4DR2 K;  1ASW A;  1DGK N;  1YHQ N;  1KTQ A;  3SLC A;  1Z6R A;  3PX6 A;  3PV8 A;  3RR7 A;  3NF6 A;  3SUN A;  4NXN K;  2VWB A;  1TAQ A;  3C6H A;  2PYL A;  2G8U A;  3OJU A;  5M1K A;  3AV9 A;  3I8B A;  4CGG A;  4XH5 A;  5KTQ A;  2VGN A;  3M1F A;  3SPZ A;  3CI5 A;  4FZX C;  1BQN A;  1HR0 K;  3PY8 A;  1J9A A;  4O8K A;  4JKG B;  4BC3 A;  4DTP A;  4BRC A;  4MO5 A;  1G15 A;  2D0P A;  3J7Y P;  4FO0 A;  4MDA A;  3FZL A;  3IKM A;  3J81 O;  3LAK A;  4B1V A;  1NM1 A;  3D2F B;  3H1Q A;  3CET A;  3THW A;  1VQN N;  2ZGY A;  4CGI A;  4PY5 A;  5AJ3 K;  4JK7 A;  3ZCM A;  1VSJ A;  3E01 A;  4FWO A;  3I33 A;  4JI0 K;  1I39 A;  3TAP A;  2DFH A;  5EY4 A;  4CBW A;  3U6F A;  4M42 A;  1KAY A;  1EP4 A;  2YNI A;  3BP8 A;  3HPH A;  4PKG A;  5FLX O;  1NK7 A;  4A5B A;  1YVN A;  3Q7C A;  3AY9 A;  4CIE A;  4JHD A;  3E9O A;  5SWM A;  4AM6 A;  3OYG A;  4CJ5 A;  1Z26 A;  4JKH A;  1SUQ A;  4OJR A;  3TAB A;  1CXU A;  3E9P A;  3DAW A;  4I2P A;  5CYQ A;  5FDL A;  4CJW A;  5BRH A;  1XMQ K;  1K9M O;  1BG3 A;  4DLG A;  3TI0 A;  3MWT A;  3CQY A;  2ZE2 A;  2RPI A;  1IKX A;  1NOY A;  4M3T A;  5AZI A;  2UUB K;  4FWQ A;  3THY A;  1E4G T;  4CEQ A;  4GV6 A;  2UXD K;  4YDU A;  3ZET A;  4E1N A;  3FZF A;  2OPR A;  4IG0 A;  4LF6 K;  1HLU A;  4FJI A;  4XEI A;  4AHT A;  4CJT A;  1REV A;  1Q8I A;  3TAG A;  1FK9 A;  3AAR A;  2P9S A;  2X6N A;  2HND A;  5FPM A;  4NCB A;  3O3G A;  4DV0 K;  2IVP A;  1IV0 A;  3NH1 A;  3HM8 A;  4WFN L;  4DTO A;  2Q0U A;  5FRN A;  3J7A P;  5FRO A;  3V9S A;  1YJW N;  4FLU A;  5LMN K;  1NJY A;  1VQO N;  4M41 A;  1BA0 A;  2W42 A;  4BQL A;  1JLG A;  4B9U A;  4JKC A;  2E8A A;  3CCR N;  4O0I A;  4DQR A;  4H5R A;  4E7J A;  3MXJ A;  3M6G A;  5AQN A;  1C1C A;  1HKB A;  3AVK A;  3HPO A;  2VQE K;  1N34 K;  3QFP A;  2P9L A;  3H08 A;  4ELU A;  2CGL A;  4Z4H A;  1J5E K;  3VF6 A;  4YOX A;  2ZJP L;  2IDO A;  4FL9 A;  5BRF A;  3SMP A;  4V19 S;  4JS5 A;  2O8D B;  3NBP A;  4YFU A;  1BL3 A;  3HVR A;  5I42 A;  3GDQ A;  2NRV A;  1JJ2 M;  3QEI A;  1XC3 A;  4A59 A;  1ZBS A;  1X1P A;  4HUF A;  3NGI A;  2A1R A;  3SAH A;  1RDA A;  5JIC A;  4IEE A;  4BWJ A;  1B92 A;  4CJ3 A;  1YJN N;  1QS4 A;  2P9U A;  5AQG A;  4CZE A;  4QAG A;  1NGG A;  4CK2 A;  2QKK A;  2BGG A;  3VQ5 A;  1BGX T;  1Z25 A;  1WBD A;  4LSN A;  1T3V A;  4IDH A;  1DKG D;  4M7Y A;  1DTQ A;  5HP1 A;  4HTL A;  2VQF K;  3QEP A;  3WEE B;  2W41 A;  1ZBU A;  4JKE A;  3M8Q A;  4CF9 A;  4FJK A;  4NCG A;  4AIL C;  3MMV A;  4BR0 A;  2ATQ A;  3ZT1 A;  3RWU A;  4GY2 B;  2FF6 A;  2GEM A;  1BOT O;  3RMD A;  1C6V A;  3DRR A;  1KAZ A;  3FFK B;  1RNH A;  4BRQ A;  4BRA A;  4CZJ A;  4PL7 A;  1JL2 A;  2P9N B;  4CD3 A;  4Z4E A;  2Q2R A;  5C10 A;  1SV5 A;  2PZS A;  1QQM A;  2W6K A;  1KLN A;  5HRR A;  3TAQ A;  4FLZ A;  3SAF A;  4FLT A;  4F2R A;  4DR6 K;  3HXM A;  3CCM N;  4OPH A;  3UKU A;  2HW3 A;  4OGE A;  5C0Y A;  1XHX A;  4GNI A;  3AO4 A;  3VEX A;  1KCF A;  4E19 A;  5BN8 A;  5M1N A;  2HNZ A;  3PSI A;  1HQE A;  1KAX A;  3L3U A;  4CF1 A;  5FPE A;  3CJ9 A;  3AA5 X;  2FSN A;  3P5J A;  4GV9 A;  1SS6 A;  2Z1J A;  4CVN E;  1EWR A;  5C25 A;  3ULE B;  1VSL A;  4NXM K;  4A2B A;  2D0C A;  4BE1 A;  1KSP A;  1HMV A;  3PX4 A;  3DLL L;  1RBU A;  2E2N A;  4OPA A;  2I5J A;  4DF8 A;  1VQK N;  4KAZ A;  4B3M K;  2OAN A;  3F2K A;  1GOB A;  1X3M A;  3EZ5 A;  4W5N A;  2OPP A;  4ILH A;  3DLE A;  4CHQ A;  5C15 A;  4FVU A;  1YF5 L;  4M3W A;  3SK3 A;  4CJS A;  4HUG A;  4CJU A;  3LAL A;  3AVC A;  4BDZ A;  1Z05 A;  2JGU A;  3DXM A;  1BCM A;  3P1G A;  3KD5 E;  1T6C A;  2HF3 A;  1S3X A;  3AVB A;  2GUP A;  3TAR A;  1WSI A;  2FSK A;  2ZD1 A;  1DT9 A;  1ZBL A;  3SV3 A;  4YHH K;  2PFU A;  3KWI A;  4XH4 A;  4CI6 A;  3DLR A;  4Y1D A;  1W7A A;  3M8P A;  4JI3 K;  3O8M A;  4C1N K;  3WXL A;  3K59 A;  4I6M A;  1T05 A;  5I9E B;  5LJV A;  2HHW A;  3LWL A;  1J54 A;  4DTU A;  3BUZ B;  4M45 A;  3DJC A;  4FJL A;  3D2E B;  3WNH A;  3LM9 A;  4B1W B;  1WAF A;  1T03 A;  4GKK K;  1G99 A;  2F9W A;  4WFA L;  3CC2 N;  4BRI A;  3O5B A;  4DS4 A;  3NGZ A;  4M63 C;  1Q7Y O;  4BR4 A;  4FW2 A;  4A57 A;  1NJX A;  1Y97 A;  3D0P A;  3FZM A;  1S1X A;  3U8X A;  3OYD A;  4FWN A;  4JI2 K;  3I56 N;  3GE1 A;  4CJ4 A;  1S6Q A;  4H8K A;  3EYZ A;  4RG8 A;  3D6R A;  4WF9 L;  2E1Z A;  3GOI A;  1JLQ A;  1A5X A;  4FPB A;  4CGJ A;  4KRE A;  3F9K A;  1VRT A;  1X9J A;  1NKE A;  3O9S A;  4OKJ A;  2KTQ A;  4CF2 A;  3QNO A;  2G8K A;  3A2F A;  2V52 B;  1HYZ A;  4DQS A;  3V9Z A;  4EZ6 A;  4JD2 B;  2E2O A;  3SQ4 A;  3DLH A;  4KI4 A;  1D4X A;  2XY8 A;  1FW6 A;  1C1A A;  3C95 A;  1N5Y A;  1OVY A;  1NMN A;  4PHT X;  3TTD A;  4CEO A;  1SKR A;  4DV2 K;  1QZ5 A;  4DHY A;  3KLF A;  2VWJ A;  4DR4 K;  1KD1 O;  5DM6 L;  3ENB A;  3SI6 A;  1N6Q A;  5B8H A;  1VSI A;  1H1V A;  3UB5 A;  2ZGZ A;  3RSE B;  4FWL A;  3CFP A;  4BG9 A;  4BE0 A;  2XY5 A;  3ID8 A;  3PIO L;  5ADX H;  3NF8 A;  2O4G A;  4BVO A;  4DU4 A;  1WSG A;  1P8Z A;  5AQM A;  3O08 A;  3IFR A;  2FSJ A;  4O8U A;  3V1R A;  4Z94 A;  2ITM A;  3DOK A;  1NK6 A;  4FJN A;  2QA4 N;  4H0O A;  5HBM A;  1P90 A;  4CJV A;  1NGB A;  5FPN A;  4GW6 A;  3OYH A;  4CHP A;  4DTR A;  1RDW X;  1GOA A;  1CZA N;  2XY7 A;  5HL7 L;  4OKK A;  3LP2 A;  1L3S A;  4CJR A;  5BR8 K;  1V4T A;  3MK6 A;  3JS6 A;  4CFD A;  2V7Y A;  4IDK A;  1BIS A;  2YNF A;  3VES A;  4I9L A;  2IVO A;  4H4O A;  3JAM O;  2F8T A;  4AHS A;  4BQZ A;  3LPU A;  3KHY A;  4IBN A;  2Q1N A;  2GTD A;  1XI1 A;  3EN9 A;  2KKZ A;  1S22 A;  4JRQ A;  1JXE A;  3KK7 A;  3I8D A;  4CZL A;  4BDP A;  3V6D A;  3TR8 A;  4B1X B;  3KLE A;  1W2B M;  4KPY A;  3G10 A;  4CES A;  1EQY A;  4B08 A;  3MX5 A;  3AAP A;  4PA1 A;  2GV9 A;  1RDB A;  3THV A;  5M1P A;  1VSD A;  1NG9 A;  3OTO K;  5KQ8 A;  4GKJ K;  4A61 A;  3WQU A;  4CHO A;  4AHV A;  1WLJ A;  2YKN A;  1ATN A;  1CXQ A;  3ATU A;  4FWP A;  2PY5 A;  1JCE A;  2D0A A;  5CHI A;  2RKI A;  3TPQ A;  4CZH A;  3CFR A;  4DTS A;  4CZI A;  4H5T A;  4KTW A;  2A6A A;  2HMP A;  1HYV A;  3ZYY X;  3VOV A;  2QXF A;  4IOA L;  1LWE A;  4RCH A;  4KTZ A;  2A5X A;  3HP9 A;  4N47 A;  3VTH A;  4DF4 A;  3HO1 A;  3VEW A;  1TKD A;  4MDB A;  3WNE A;  3P83 D;  4U67 L;  3HP6 A;  1KVA A;  2VCP A;  1GLJ O;  5ELZ A;  3BDP A;  3KK1 A;  5AQT A;  1YAG A;  4WFB L;  3CCU N;  1NJZ A;  5BPL A;  5AQH A;  3MWP A;  4DS5 A;  1WSE A;  3C6U A;  4DV4 K;  4MFB A;  3L2W A;  4HCC A;  4N41 A;  3S3M A;  1OH6 A;  4DV6 K;  3RR8 A;  1IKV A;  3C6T A;  4WYB A;  1KFS A;  4CIF A;  4F2S A;  2V51 B;  5M1Q A;  4KV8 A;  1MA9 B;  4JI5 K;  3O1W A;  3VQ9 A;  1C0G A;  5J1E A;  3LL3 A;  3DI6 A;  4MQ3 A;  1ASV A;  4R79 A;  1XNR K;  3KWG A;  2YKM A;  5AQI A;  2YX6 A;  5AQO A;  4BRF A;  2QWO A;  1QSS A;  2NZT A;  2ZJQ L;  1OH7 A;  1S9E A;  4KHQ A;  3CJ7 A;  4AHR A;  2YNH A;  1O1W A;  2KLA A;  2VG6 A;  4O4G A;  4DU1 A;  2ZM6 K;  2F8S A;  4EP5 A;  3LDQ A;  3OBW A;  4H03 B;  2JLE A;  3FFI A;  2Y1J A;  1NGA A;  1VQ6 N;  1E4F T;  3MXI A;  3UKR A;  1RT3 A;  5BN9 A;  3W3D A;  4OO1 J;  3VGM A;  5J2Q A;  4FWS A;  1OVQ A;  2BH1 A;  1ITG A;  1Q9X A;  1KFD A;  3CM5 A;  1NK5 A;  1LWF A;  1HNZ K;  3QER A;  1KVC A;  4KRF A;  3IRX A;  5C24 A;  3CC4 N;  3C7N A;  3U9Z A;  4DUZ K;  2E1Y A;  5TKY A;  3BY5 A;  4IO9 L;  2ZQB A;  1WSF A;  3LP0 A;  3WNG A;  1SL2 A;  4QOZ B;  4H0T B;  3HTV A;  3L3V A;  2P9P B;  3AVJ A;  1HKC A;  3FR0 A;  3MCA B;  4FPA A;  4MLE A;  3F5T A;  5BPN A;  3K58 A;  4RW4 A;  2D5R A;  3MDQ A;  3K9K A;  1GOC A;  4DR5 K;  4G1Q A;  1HPM A;  4W5T A;  1BU6 O;  3Q7B A;  3FZK A;  3MX2 A;  3NVM A;  1VSE A;  1S72 N;  1UOC A;  1NJW A;  1JCG A;  2D1K A;  3L4Q A;  2O8B A;  2WFB A;  4B9Q A;  2Q0R A;  3TSQ A;  5C2D A;  2OZS A;  3VF4 A;  3O4W A;  3MXM A;  2NUB A;  2O8E A;  3OYL A;  2O8F B;  1QSL A;  3K9J A;  2A40 A;  3A0I X;  3QBW A;  1SKW A;  2J4R A;  3CMA N;  3OYN A;  4K43 A;  4TSX A;  4BRE A;  4FLV A;  4E0D A;  5HRP A;  3WUH A;  4KI6 A;  3M3Z A;  4CJE A;  1ZBF A;  3TSU A;  3T1Y K;  3HI0 A;  3ULD A;  3HJF A;  1Q18 A;  4NO7 A;  4AM7 A;  3VPZ A;  1CZ9 A;  3VEN A;  3OHR A;  2O8C B;  4BR7 A;  1NGC A;  4B9L A;  1ATS A;  3ZT4 A;  3CQ8 A;  3CME N;  1U47 A;  4HHT A;  3HSC A;  1M1K O;  4HWI A;  5M1F A;  3QIC A;  3CCJ N;  1QE1 A;  1RT1 A;  2P9K B;  3SBG A;  2P9I A;  4CFC A;  3A5L C;  3H45 C;  4YOR A;  1U2V B;  4J2A A;  4JK9 A;  4AH9 A;  4M3X A;  1IKY A;  1RDU A;  3HOS A;  3C94 A;  5EU7 A;  3KJV A;  5J2N A;  5KGW A;  3AVH A;  2YNG A;  2R7Y A;  1MWM A;  4XH1 A;  5AQU A;  5HRN A;  1FJG K;  1TK5 A;  3ZSY A;  1RBS A;  4EHT A;  4CGF A;  3SBT A;  2HBK A;  4E3S A;  2OCE A;  1GLA G;  3QB0 A;  2PYJ A;  4L8R B;  1TK8 A;  4BRG A;  1HQU A;  1T44 A;  4ISE A;  4DQQ A;  4FJM A;  3O9T A;  4C8K A;  4KH6 A;  5CYM A;  4IXC A;  2BAN A;  4C23 A;  2Q3S A;  1YI2 N;  3FLC O;  2HHS A;  3OYM A;  2Z1G A;  1U4B A;  4ELT A;  1N36 K;  2VG5 A;  5LL6 Z;  1YT3 A;  3IDH A;  1ZBI A;  1VAZ A;  2HBJ A;  3BGR A;  1DLO A;  4C8N A;  5T7B A;  1TYQ A;  4BRK A;  3NHG A;  4IKF A;  3D7E O;  3LDL A;  4H0X B;  3AVL A;  1LOT B;  3PO4 A;  5J2P A;  1S1V A;  3AO1 A;  5AZJ B;  4DFJ A;  3RVC A;  4Q0B A;  1JXB A;  3SUP A;  3K0S A;  3QML A;  2XHB A;  3R6M A;  4YOW A;  3ZSV A;  2RF2 A;  4IJN A;  4G9Z A;  4A62 A;  2ITG A;  3VQE A;  3SNN A;  3DXK A;  5AQL A;  1W9H A;  5GAE P;  2XY6 A;  3NF7 A;  3C65 A;  4OPK A;  3DMJ A;  3NH2 A;  3G0Z A;  2X78 A;  4FLW A;  3MN7 A;  2RE2 A;  4BC5 A;  1SL1 A;  3ATV A;  3DLB A;  4ID1 A;  1FKP A;  3ZEU A;  1BI4 B;  2G8H A;  3ZSX A;  3B6O A;  1GLE G;  1CLQ A;  3QNN A;  4ELV A;  2YCH A;  3V1Q A;  3JXU A;  5KRS A;  4RW7 A;  1IJJ A;  4JNE A;  1VK0 A;  2B5J A;  4B9M A;  1VQ4 N;  3VMF B;  2BTF A;  3EO3 A;  1GLF O;  5AQF A;  4FLX A;  4DR3 K;  3J7Z O;  4KHU A;  5EX5 A;  1KLM A;  3E9L A;  3TAM A;  3MCP A;  4NB4 A;  3L2V A;  3U9D A;  2B6A A;  5KQD A;  4W5O A;  3CD6 N;  3SQ1 A;  1V4S A;  5E84 A;  1EWQ A;  1RTJ A;  3AO3 A;  3P39 A;  4LFB K;  1X3N A;  2LSN A;  3WQT A;  1YTU A;  2DFF A;  4YOY A;  1ZBH A;  5JMV A;  1T7P A;  4JKD A;  4NCA A;  1N33 K;  1XUP O;  3QO9 A;  3T19 A;  3G4S N;  4BWM A;  3G25 A;  3V4I A;  2D0O A;  4OPJ A;  4PWD A;  2AA4 A;  4IZ9 A;  3VQ8 A;  4HUE A;  3CF5 L;  5BRD A;  3HZ6 A;  3DRS A;  3HOT A;  4QCL A;  2QWM A;  3R9P A;  4YY3 K;  3G6E N;  5AQY A;  1D9D A;  4KKO A;  2UXC K;  4LFA K;  2A1S A;  4J2D A;  3THW B;  1JLE A;  3HVT A;  3DOL A;  3MN9 A;  4H0P A;  2CGJ A;  2E2P A;  1IBK K;  2Q97 A;  3RTV A;  5DM7 L;  3SAG A;  4MO4 A;  1VHX A;  4H5V A;  1C0T A;  3WXI A;  3SUQ A;  4FWM A;  4JI8 K;  4LSL A;  4FJX A;  3IMX A;  4JHD B;  1U48 A;  2YJF A;  1NK8 A;  1YUW A;  2QK9 A;  1TV6 A;  4X64 K;  1KQS M;  1XMO K;  2UU9 K;  5AFU A;  4FM1 A;  4PUO A;  4W5Q A;  3EE8 A;  3VQA A;  2DTU A;  1CZB A;  5KPZ A;  4DV3 K;  2FC0 A;  4FYD A;  4DSE A;  4IJA A;  4C8L A;  4DB3 A;  3VEO A;  4E89 A;  2KQ2 A;  3ALY A;  3QDK A;  5AZI B;  1RBT A;  1WBB A;  3FZH A;  3THY B;  2Q31 A;  4KHP K;  4Z4I A;  3ZET B;  4DQ8 A;  3S41 A;  4FLY A;  5K14 A;  3HRG A;  1IBM K;  2QWL A;  3HST B;  2HMI A;  4ISG A;  2P9S B;  4PKI A;  1RT5 A;  4IOC L;  4I9Q A;  1VQ8 N;  3K5L A;  1X9S A;  4O5F A;  4CCH A;  4BRM A;  3CPW M;  3M8S A;  1K8K B;  3ZT2 A;  4DUY K;  3S9H A;  1RT4 A;  3DLG A; 
#chains in the Genus database with same CATH homology
 4CIG A;  3OYG A;  4DU3 A;  4KTW A;  4CJ5 A;  4DSL A;  1HYV A;  1Z26 A;  3I0R A;  4O5B A;  1SUQ A;  4DTX A;  4OJR A;  3TAB A;  4K8Z A;  4E7K A;  1CXU A;  4RW8 A;  4FCY A;  4Z4F A;  4OVL A;  4CE9 A;  4I2P A;  5CYQ A;  4NYN A;  5FDL A;  2QXF A;  5D3G A;  4CJW A;  1BIZ A;  1LWE A;  3QES A;  4KTZ A;  1X9M A;  4N47 A;  3HP9 A;  4DLG A;  3AVI A;  3TI0 A;  4JS4 A;  1WNS A;  1TK0 A;  4DF4 A;  3HO1 A;  3SJJ A;  3HM9 A;  1TKD A;  2OPS A;  4N56 A;  3WNE A;  2ZE2 A;  3P83 D;  3LZI A;  2RPI A;  1IKX A;  4LH4 A;  1NOY A;  3V1O A;  4M3T A;  3HL8 A;  1FXX A;  3HP6 A;  1KVA A;  1ZYQ A;  5HLF A;  4CEQ A;  2HNY A;  4DFP A;  1BCO A;  2EX3 A;  3BDP A;  2IGI A;  4E1N A;  3KK1 A;  2OPR A;  4IG0 A;  3T1A A;  4K8X A;  4FJI A;  4CK3 A;  3U3G A;  1NJZ A;  4AHT A;  4CJT A;  1REV A;  1Q8I A;  4DS5 A;  3DM2 A;  1WSE A;  1FK9 A;  3C6U A;  4MFB A;  3L2W A;  2X6N A;  3DRP A;  2HND A;  3U3Y A;  3TAG A;  3S3M A;  1NK0 A;  3ZT0 A;  4N41 A;  4NCB A;  3O3G A;  1RTH A;  2F96 A;  3RR8 A;  1IKV A;  3C6T A;  1KFS A;  4CIF A;  3NH1 A;  2KFN A;  4F2S A;  1D8Y A;  3K5O A;  4DTO A;  4KV8 A;  5FRN A;  4CEE A;  2D0B A;  3VQ9 A;  4IFV A;  5J1E A;  3NDK A;  3TAE A;  5FRO A;  4OLA A;  3DI6 A;  3V9S A;  4MQ3 A;  1ASV A;  4CJP A;  1WN7 A;  4FLU A;  1NKB A;  2YKM A;  5DK5 A;  5KI6 A;  4C8M A;  2WON A;  1QHT A;  4O55 A;  1QSS A;  1NJY A;  4CHN A;  4F4K A;  3RMC A;  4HCB A;  3B6P A;  1S9E A;  4M41 A;  4KB1 A;  4KHQ A;  2KW4 A;  4HVJ A;  1L3U A;  1NOZ A;  3VQD A;  4AHR A;  3OJS A;  2YNH A;  2W42 A;  1IG9 A;  2P1J A;  2Y1I A;  1O1W A;  3ZSZ A;  2VG6 A;  4Z4E A;  1JLG A;  4B9U A;  3V81 A;  2O4I A;  4O4G A;  1EKE A;  4DU1 A;  2F8S A;  4EP5 A;  4KFB A;  3QET A;  2OA8 A;  4KHW A;  2IAJ A;  2JLE A;  3FFI A;  4BE2 A;  2Y1J A;  4M3Z A;  4F8R A;  4O0I A;  4DQR A;  3KLI A;  3O4Q A;  3MXI A;  1EXQ A;  4E7J A;  1HJR A;  3MXJ A;  1RT3 A;  2G8V A;  1C1C A;  1WAJ A;  3AVK A;  4FJJ A;  1B9F A;  3HPO A;  5J2Q A;  4ID5 A;  4DQP A;  1S1W A;  3ZSW A;  3OYF A;  3LAM A;  3OYC A;  1LW2 A;  4RW9 A;  3H08 A;  3LZJ A;  1U49 A;  1ITG A;  4KO0 A;  3ZSO A;  4Z4H A;  5JS2 A;  1LV5 A;  1Q9X A;  4Y1C A;  1KFD A;  3QEW A;  3CM5 A;  1NK5 A;  1LWF A;  1LAW A;  2IDO A;  3QER A;  1KVC A;  4KRF A;  3IRX A;  5C24 A;  3OY9 A;  4JS5 A;  3NBP A;  4DQI A;  4YFU A;  1HRH A;  4R5P A;  1BL3 A;  1A5V A;  1RT2 A;  3HVR A;  3NE6 A;  1WSH A;  5I42 A;  1TKZ A;  1U04 A;  2HHQ A;  3QEI A;  3TAN A;  1TKT A;  4E1M A;  1HNI A;  1C0U A;  3VA3 A;  3ZSQ A;  1X1P A;  2IC3 A;  2ZQB A;  1JLC A;  1WSF A;  1VRU A;  2OPQ A;  3LP0 A;  3WNG A;  4HUF A;  3SZ2 A;  4B8C A;  3NGI A;  2A1R A;  1T8E A;  3L3V A;  5KRT A;  3RMB A;  1JLF A;  3AVJ A;  1RDA A;  4RW6 A;  4BWJ A;  4DSF A;  1J5O A;  1B92 A;  1KVB A;  4CJ3 A;  3AVM A;  1QS4 A;  5HRS A;  3MEE A;  4DLE A;  2HB5 A;  4CGH A;  3V9W A;  3K58 A;  3PO5 A;  4DWI A;  4QAG A;  4RW4 A;  3HT3 A;  2D5R A;  4CK2 A;  4XIU A;  2QKK A;  2BGG A;  3VQ5 A;  1GOC A;  3LDS A;  1NK9 A;  1K6Y A;  1BGX T;  1Z25 A;  3NF9 A;  4LSN A;  4G1Q A;  3QIP A;  4B9T A;  4HTU A;  4W5T A;  4CFA A;  1DTQ A;  4CHY A;  5I3U A;  5HP1 A;  1VSE A;  1TKX A;  3RRG A;  2YHA A;  3V9X A;  2BE2 A;  1UOC A;  1NJW A;  3QEP A;  2YV0 X;  1FKO A;  1ZBU A;  2E4L A;  4FZY A;  5DMR A;  1A5W A;  3HYF A;  4FJ8 A;  3M8Q A;  4CF9 A;  4FJK A;  2OZS A;  2P51 A;  1DTT A;  4NCG A;  3AA4 A;  3OVN A;  1VSM A;  2NUB A;  4AIL C;  3CG7 A;  3MXM A;  3OYL A;  4F3T A;  2FBY A;  1EET A;  2ATQ A;  3ZT1 A;  4J2E A;  4OGC A;  3RWU A;  1VSK A;  1UA1 A;  1QSL A;  1QSY A;  3VQ6 A;  4FJG A;  3CFO A;  3AVA A;  4KHY A;  3AO5 A;  3RMD A;  1SKW A;  1RT7 A;  1C6V A;  4I2Q A;  4M3R A;  4FK0 A;  2AJQ A;  3OYN A;  1LWC A;  3DRR A;  3SUO A;  5C42 A;  3O3H A;  4DTJ A;  3SQ2 A;  1RNH A;  4TSX A;  4FLV A;  3DLK A;  2BDP A;  3UIQ A;  2KFZ A;  4CJF A;  5HRP A;  3OS1 A;  1JL2 A;  1S9G A;  1TGO A;  4E0D A;  4KB0 A;  1L3T A;  4CJE A;  1ZBF A;  4OKE A;  1UAX A;  4CED A;  3VQP A;  3KTQ A;  4B9S A;  4DSI A;  2PZS A;  1SV5 A;  4EP4 A;  1JL1 A;  3ULD A;  3HJF A;  1KLN A;  2E6L A;  5HRR A;  1YVU A;  3TAQ A;  4FLZ A;  2B4J A;  4FLT A;  3MED A;  3HXM A;  2P5O A;  4F2R A;  4FJ9 A;  4FM0 A;  1CZ9 A;  4LD0 A;  2HW3 A;  2E6M A;  4OGE A;  1XHX A;  3O3F A;  1SL2 A;  3AO4 A;  3ZSR A;  3OYJ A;  4E19 A;  1KCF A;  3ZT4 A;  1XC9 A;  4B9L A;  4QOZ B;  3CQ8 A;  2HNZ A;  4KHN A;  1U47 A;  1HQE A;  3L3U A;  4CF1 A;  4CEF A;  3AA5 X;  4HHT A;  3P5J A;  4B9N A;  2Z1J A;  4JLH A;  3NGY A;  4DTN A;  2XO7 A;  5C25 A;  3L2R A;  3K2P A;  3LPT A;  1XHZ A;  4GVM A;  1VSL A;  1QE1 A;  1RT1 A;  2HVI A;  4CFC A;  3VQQ A;  2D0C A;  4BE1 A;  1KSP A;  2OYQ A;  1HMV A;  1IH7 A;  3PX4 A;  2ETJ A;  2FBT A;  4O44 A;  4AH9 A;  4J2A A;  1S5J A;  4M3X A;  1IKY A;  1RBU A;  3K57 A;  4DF8 A;  2I5J A;  3QEX A;  4KAZ A;  1VSF A;  1GOB A;  3C94 A;  5EU7 A;  3KJV A;  4CK1 A;  3EZ5 A;  5J2N A;  4W5N A;  2OPP A;  2P5G A;  5KGW A;  4FM2 A;  4Z0U A;  3AVH A;  2YNG A;  1WSJ A;  5CZ1 A;  2R7Y A;  2HHU A;  3DLE A;  3MEG A;  5HRN A;  1TK5 A;  3K5M A;  1VSH A;  4CHQ A;  1YTA A;  3ZSY A;  1RBS A;  1C1B A;  3CYM A;  4ZTF A;  4CGF A;  4BAC A;  4CF8 A;  4M3W A;  4CJS A;  4E3S A;  3OYB A;  4HUG A;  4ZHR A;  4CJU A;  2PYJ A;  4L8R B;  1TK8 A;  3LAL A;  1RTD A;  4F3O A;  3AVC A;  4BDZ A;  3S3O A;  2JGU A;  1HQU A;  4DQQ A;  2RN2 A;  1BCM A;  3P1G A;  3VQ4 A;  3OYA A;  3KD5 E;  4YNQ A;  4FJM A;  1RBV A;  4Z4C A;  4N5S A;  4ICL A;  3NH0 A;  3PUF A;  2YHB A;  4C8K A;  4DSJ A;  5CYM A;  1XWL A;  2BAN A;  4CHZ A;  4KHS A;  2Q3S A;  4C8O A;  4CJL A;  1SKS A;  2HVH A;  4CF0 A;  3HK2 A;  3AVB A;  3RMA A;  3OYM A;  2HHS A;  3TAR A;  2QKB A;  2Z1G A;  1U4B A;  4ELT A;  1B9D A;  1WSI A;  2ZD1 A;  1C0M A;  1ZBL A;  1TAU A;  2FBX A;  3SV3 A;  2VG5 A;  3D45 A;  1TL3 A;  3CM6 A;  3DLR A;  1YT3 A;  4Y1D A;  3NFA A;  3HPG A;  1ZBI A;  3M8R A;  4JRP A;  3VQ7 A;  3KK2 A;  3M8P A;  1D9F A;  3K59 A;  4FK4 A;  3V9U A;  1T05 A;  3BGR A;  5HRO A;  1DLO A;  4C8N A;  5T7B A;  3KK3 A;  4E7H A;  1X9W A;  3KD1 E;  4Z4G A;  2OZM A;  2HHW A;  3LWL A;  1J54 A;  3NHG A;  4DTU A;  1HYS A;  4IKF A;  4M45 A;  4FJL A;  3I0S A;  3WNH A;  3AVL A;  3KIO A;  3LP1 A;  3OYE A;  3TWH A;  3PO4 A;  3IS9 A;  5J2P A;  1WAF A;  1S1V A;  3AO1 A;  1T03 A;  4DFJ A;  1BQM A;  3LP3 A;  3ZT3 A;  4Q0B A;  1EX4 A;  4CGD A;  1JXB A;  3SUP A;  3KLG A;  4WE1 A;  1L3V A;  3L8B A;  4DS4 A;  1TVR A;  3NGZ A;  4DFK A;  1J53 A;  1KRP A;  2KZZ A;  4DSK A;  2XHB A;  3ZSV A;  2RF2 A;  4E7L A;  4FW2 A;  1NJX A;  1JKH A;  1Y97 A;  3OS2 A;  3D0P A;  2ITG A;  3VQE A;  3SNN A;  1S1X A;  1BIU A;  3OYD A;  1W9H A;  1JLB A;  3MAQ A;  3RRH A;  3ASM A;  4FVM A;  1RDD A;  4CJK A;  2XY6 A;  4CJ4 A;  3NF7 A;  3QIN A;  4OLB A;  4OPK A;  1BHL A;  1S6Q A;  3DMJ A;  4H8K A;  1F21 A;  3EYZ A;  4RG8 A;  3NCI A;  4CJQ A;  3PX0 A;  3SPY A;  4B9V A;  3NH2 A;  3G0Z A;  2X78 A;  1UA0 A;  4FLW A;  1S6P A;  1UWB A;  3KLH A;  5SZT A;  1SL1 A;  1RT6 A;  1JLQ A;  1QTM A;  4ID1 A;  1A5X A;  1S1U A;  4IFY A;  3DLB A;  2G8F A;  1FKP A;  4CGJ A;  1BI4 B;  2Z1I A;  3F9K A;  1NKC A;  3JSM A;  4LY7 A;  1VRT A;  2G8H A;  4KRE A;  4N76 A;  1NKE A;  3ZSX A;  4B3O A;  3B6O A;  4OKJ A;  1NK4 A;  4W5R A;  2KTQ A;  1RIL A;  2HHT A;  2VWK A;  1RTI A;  4GMJ B;  1TL1 A;  4CF2 A;  3QNO A;  1CLQ A;  3QNN A;  2G8K A;  4ELV A;  3ITH A;  3A2F A;  3V1Q A;  4DG1 A;  5KRS A;  1IKW A;  1HYZ A;  3QIO A;  4RW7 A;  4DQS A;  3AO2 A;  3V9Z A;  3VN5 A;  4FW1 A;  4EZ6 A;  1VK0 A;  3SQ4 A;  3OYK A;  3DLH A;  2B5J A;  4KI4 A;  4B9M A;  3DYA A;  2XY8 A;  1U45 A;  4AHU A;  4DMN A;  1C1A A;  3C95 A;  4FLX A;  1N5Y A;  3AVF A;  4B8A B;  1Q9Y A;  4KHU A;  3KKS A;  4CEA A;  4CEO A;  4E7I A;  1SKR A;  3QEV A;  1KLM A;  3TAM A;  1ASU A;  2G8I A;  3OYI A;  4M3Y A;  3IAY A;  2FBV A;  3KLF A;  3L2V A;  2VWJ A;  3IG1 A;  4M3U A;  4KTQ A;  2B6A A;  3SI6 A;  1N6Q A;  4W5O A;  1VSI A;  3SQ1 A;  1S1T A;  2HHX A;  2X6S A;  3JYT A;  2G8W A;  3L2U A;  1RTJ A;  3AO3 A;  4Q5V A;  4J2B A;  2KZM A;  3MEC A;  2LSN A;  3F73 A;  3CFP A;  4CEB A;  2GUI A;  3AA3 A;  3AVN A;  1YTU A;  2DFF A;  5CZ2 A;  4BE0 A;  2XY5 A;  2XRI A;  1ZBH A;  3L2Q A;  1T7P A;  1JLA A;  1HPZ A;  1BI4 A;  3LAN A;  4NCA A;  3QO9 A;  3T19 A;  3NF8 A;  4FJ7 A;  4KI6 A;  4BWM A;  3V4I A;  4OPJ A;  2O4G A;  4DU4 A;  4PWD A;  2IOC A;  4I7F A;  3VQ8 A;  1WSG A;  3OS0 A;  2DFE A;  4HUE A;  1HNV A;  1W0H A;  1RBR A;  3V1R A;  5KGX A;  3DRS A;  5E41 A;  4DFM A;  4BDY A;  2IS3 A;  1RCH A;  3VQB A;  1D5A A;  4QCL A;  3DOK A;  4CEC A;  3VQC A;  1NK6 A;  1L5U A;  4FJN A;  1D9D A;  1ASW A;  4KKO A;  5HBM A;  3LWM A;  3NAE A;  3SYZ A;  4CJV A;  1KTQ A;  2A1S A;  4J2D A;  2GBZ A;  4GW6 A;  1JLE A;  4AHC A;  3HVT A;  3OYH A;  4CHP A;  4DTR A;  1GOA A;  3DOL A;  3PV8 A;  3NF6 A;  3PX6 A;  3RR7 A;  3ISN C;  2XY7 A;  4OKK A;  3LP2 A;  3SUN A;  1L3S A;  4CEZ A;  1LAV A;  3KKR A;  2Z1H A;  3O4N A;  1I3A A;  1TAQ A;  4NYF A;  4CFB A;  4CJR A;  4FJH A;  4FK2 A;  3RTV A;  4CFD A;  4O0J A;  4LH5 A;  2HHV A;  4IDK A;  4ZTJ A;  2PYL A;  4FJ5 A;  4IG3 A;  1BIS A;  1C0T A;  2YNF A;  2G8U A;  3TAF A;  2DY4 A;  3OJU A;  3SUQ A;  1RDC A;  4I9L A;  3AV9 A;  4CER A;  3AVG A;  4CGG A;  4H4O A;  4LSL A;  3WNF A;  4ELU A;  2F8T A;  5KTQ A;  4AHS A;  4FJX A;  4PQU A;  2VG7 A;  1U48 A;  3SPZ A;  3LPU A;  3T3F A;  3SQ0 A;  5CY4 A;  4IBN A;  1TV6 A;  1NK8 A;  2QK9 A;  2X74 A;  1XI1 A;  3SV4 A;  5J2M A;  4FM1 A;  4FZX C;  1R0A A;  4PUO A;  3EY1 A;  1BQN A;  3PY8 A;  4FXD A;  4UQG A;  4W5Q A;  1J9A A;  4JRQ A;  3VQA A;  4DTP A;  1JXE A;  2DTU A;  1G15 A;  1CZB A;  3I8D A;  2WOM A;  1IO2 A;  4BDP A;  3LAK A;  3V6D A;  2FC0 A;  4EZ9 A;  4FYD A;  3TR8 A;  4DSE A;  3KLE A;  4C8L A;  4DTM A;  4KPY A;  3G10 A;  4FZZ A;  4E89 A;  4CES A;  3ALY A;  2KQ2 A;  1SL0 A;  4B08 A;  1RBT A;  1QQC A;  4Z4I A;  4CGI A;  4PY5 A;  4PA1 A;  3ZCM A;  1VSJ A;  1RDB A;  2GV9 A;  3E01 A;  4FLY A;  3VA0 A;  1I39 A;  2EHG A;  5K14 A;  3TAP A;  3THV A;  3S3N A;  2DFH A;  1LW0 A;  1VSD A;  3HST B;  2HMI A;  4H4M A;  3QLH A;  4CHO A;  4AHV A;  3SCX A;  3U6F A;  4M42 A;  5FRM A;  1WLJ A;  4HCC A;  1RT5 A;  5JS1 A;  1EP4 A;  2YNI A;  1MU2 A;  1CXQ A;  2YKN A;  4I9Q A;  3K5L A;  1X9S A;  3HPH A;  3K5N A;  2PY5 A;  4CCH A;  2D0A A;  3ZT2 A;  3M8S A;  3S9H A;  1NK7 A;  2RKI A;  1RT4 A;  3AA2 A;  4CIE A;  3CFR A;  4DTS A;  3DLG A;  5SWM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...