1HYVA

Hiv integrase core domain complexed with tetraphenyl arsonium
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
154
structure length
142
Chain Sequence
SPGIWQLDTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAAWWAGIKQEFGQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNKKRKGGYSAGERIVDIIATDIQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
publication title Identification of a small-molecule binding site at the dimer interface of the HIV integrase catalytic domain.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 54
structure length 142
sequence length 154
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2001-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1hyvA00
5HBMA 4HUEA 2G8UA 2A1SA 3F73A 3HXMA 4FLXA 3RRGA 1NOZA 3CM6A 4NYNA 4MFBA 4PA1A 3RTVA 4CFBA 4DFJA 3T19A 3TAPA 4N76A 4J2DA 4CJLA 3MEEA 1X9WA 4DQIA 1HQUA 3SPZA 3FFIA 1KFSA 4FJXA 4CGFA 3NH2A 4ELTA 1RBUA 3ZSRA 3OS1A 4DFPA 3RMCA 3V4IA 1WLJA 4N47A 5HRPA 4FW2A 3SQ1A 2X74A 2IDOA 1SKRA 4I2PA 1KTQA 3ZSOA 3TWHA 1L3VA 1S6PA 2X78A 3U3GA 3S9HA 4FM2A 4ELUA 2HNZA 3THVA 4WE1A 3O4NA 3QEPA 4NCGA 3U3YA 3L8BA 1VSHA 1WAJA 3AO1A 3TAGA 3HK2A 2X6SA 1X9SA 1XHXA 1NJYA 1NK9A 3KIOA 4LSLA 4BWJA 4N41A 3G0ZA 2Z1JA 3NH0A 1N6QA 3TARA 4GMJB 1SKSA 1HNVA 4OVLA 1JLCA 3VQ6A 1JLEA 2WOMA 3ZT4A 4OPKA 3HVRA 1IKXA 3VQBA 4JLHA 1GOAA 5C42A 4F3OA 3MEGA 2IAJA 3QLHA 4CHOA 3U6FA 3ZSYA 4CJVA 2IOCA 4DF4A 2BE2A 1KVCA 4BE1A 4LH4A 5DK5A 1CXQA 4FLWA 2A1RA 1T05A 3T1AA 1TKXA 1UAXA 3LP2A 4CK2A 3LZJA 1NKEA 2HW3A 1RT5A 1VSIA 4HUFA 4CERA 4Y1CA 1RDDA 1BIZA 1EX4A 3CFPA 4AHRA 4DQSA 3EYZA 4O0IA 2R7YA 1JL1A 3AVGA 5KTQA 1O1WA 4CJKA 4W5QA 1BISA 2G8HA 1KCFA 3CG7A 5JS2A 4CK3A 1KRPA 4CCHA 1BL3A 5DMRA 4FLYA 3T3FA 4KB0A 3NE6A 4ELVA 3TAFA 1XWLA 2PZSA 3EY1A 4CJ3A 1BI4A 3DLGA 3JYTA 2G8VA 1W9HA 2OZMA 3QEXA 3HO1A 4PY5A 4DSEA 1FKOA 4FJ5A 2VWKA 3SZ2A 4CHZA 4W5NA 4LD0A 2P5OA 3LANA 4O4GA 1X1PA 5CYMA 3HL8A 4OKEA 1TK0A 4J2AA 4Z4EA 4CGGA 4I7FA 3PO5A 4CJFA 2HHTA 2HHXA 4DTXA 3NHGA 4N56A 1NJZA 1B9DA 3OS0A 3QO9A 3QESA 4CJSA 3OVNA 1HRHA 3RR8A 4E0DA 3HM9A 2OYQA 2FC0A 3CM5A 3RMBA 3RWUA 4FYDA 3VN5A 4FM1A 1UA0A 2PYJA 2ATQA 3AO3A 4FZXC 4IG3A 3M8SA 4FK2A 3ASMA 2ZD1A 1U4BA 1TL3A 2RPIA 4B08A 3PY8A 1YVUA 2D0BA 4N5SA 4EZ9A 3DMJA 1HQEA 4BDZA 4CESA 1B92A 2HVIA 1ASUA 1BGXT 4F4KA 4DSIA 4QAGA 3AVMA 3DRPA 3VQPA 3WNFA 4HTUA 2BGGA 1HYVA 4IG0A 1S1VA 1RDAA 4Y1DA 3L2VA 2ITGA 1UWBA 3L2QA 1IH7A 1J53A 3EZ5A 3TABA 1U48A 1KSPA 4Z4FA 4JRPA 4C8MA 1NKCA 3MXIA 3DLEA 4RW8A 4KHSA 3OS2A 1C0MA 4M41A 1S1WA 4ZHRA 3A2FA 3O3FA 1HNIA 2DFHA 5HRRA 2YHAA 2ZQBA 4FJKA 3NGIA 5JS1A 4DTOA 1RT4A 5FROA 4KHUA 1I3AA 1RILA 4AHCA 4CFDA 4FJ9A 1BQNA 1HYZA 1TKTA 5CYQA 1RTDA 4C8LA 3OYKA 2HNDA 2D0CA 4B9LA 2NUBA 4GW6A 3NGZA 4DTMA 1UOCA 3AO5A 4LH5A 3VQCA 3KK1A 1NK7A 4CFCA 4F2SA 1DLOA 1LAVA 1QHTA 1VRUA 1EP4A 3S3NA 3DOKA 3ZT3A 3HP9A 1RBSA 5E41A 1T03A 3C94A 4W5OA 3O4QA 3VA0A 4KPYA 3KLEA 2QK9A 4B9UA 4DTPA 3KK3A 2BANA 4FJHA 3ZT2A 4KHYA 2FBVA 2Z1IA 4JS5A 2FBXA 4OKJA 4RW7A 4CEAA 3OYAA 4JS4A 4B9NA 1TGOA 3NH1A 4DQQA 2HHSA 3C95A 1JXEA 4AHUA 4IKFA 4NCBA 3L2UA 4HUGA 1CZ9A 1I39A 3LALA 1C0UA 4DQPA 1S9EA 5D3GA 4DTJA 1BCOA 1BHLA 4IFVA 1TK5A 1QS4A 2QXFA 3CQ8A 2P5GA 2G8FA 1FK9A 4EP5A 1L3SA 4LSNA 2D5RA 3TAMA 3F9KA 3SV4A 1Q9YA 4KRFA 3HPGA 3TR8A 4DWIA 4KHWA 3AV9A 3WNGA 3O3GA 3SYZA 4CHPA 5C25A 4EP4A 5KRSA 2YHBA 3OYCA 3B6PA 4AHVA 4KAZA 4KI6A 1WNSA 4FJLA 4R5PA 4M3ZA 3BDPA 4OJRA 4CK1A 4DF8A 1BCMA 1BIUA 3IS9A 3KTQA 3CFOA 2G8WA 4HCBA 3NF6A 2B6AA 3ZSWA 4KO0A 3JSMA 1EKEA 4L8RB 4FZZA 4Z4IA 3LPUA 3PX4A 1RBRA 4F8RA 4OPJA 3L2RA 2G8KA 3SNNA 2YNFA 4DFKA 1RCHA 3AA2A 4E19A 5HRSA 1TL1A 1HJRA 5T7BA 2KTQA 3L3VA 1XHZA 3ZSVA 4O55A 1SKWA 1QQCA 2OPQA 4CECA 3M8QA 4CGJA 4KB1A 3DM2A 3HPHA 3LP3A 3PX6A 3TANA 4FLVA 3AA4A 3QIOA 5CZ2A 4ZTJA 1VSDA 5K14A 3K59A 4DSFA 3I8DA 4KKOA 1D9FA 2F8TA 4M45A 3B6OA 3AVCA 4M3UA 2EX3A 2YNGA 4Z4HA 4H4OA 2G8IA 1A5VA 1S6QA 2XY8A 3LAMA 4CF8A 2GV9A 1VSJA 3V1OA 4CGHA 3HP6A 3ZSZA 3SUNA 3SCXA 1ZBLA 3ZSQA 1XC9A 2O4GA 1NKBA 1VSLA 3K5NA 4YFUA 2IC3A 3DLRA 3MXJA 1BQMA 4DU1A 2P1JA 4XIUA 3QNOA 4E7JA 3RMAA 1S1XA 4KV8A 3SQ2A 5HROA 2F8SA 4OLBA 3AA3A 3LWMA 2YKMA 2WONA 5FRNA 3AVKA 5HLFA 1RBVA 1C6VA 3KLGA 4FXDA 4J2BA 4CE9A 1A5XA 5SWMA 3P5JA 1RT1A 4DSLA 4FJ7A 2KQ2A 4FJ8A 1WSHA 5KI6A 3D0PA 2XY7A 2O4IA 4M42A 4Z4CA 4DU3A 2FBTA 3WNHA 2RN2A 3AA5X 3HPOA 3P1GA 5SZTA 3KLFA 3PV8A 1NK0A 2B4JA 4C8OA 3AVHA 2E6LA 4CEEA 2Y1JA 4FK0A 3HT3A 3K5MA 4O44A 3AO4A 3ULDA 4KTQA 4NYFA 4CGIA 1JLQA 3HSTB 4DLEA 2VG6A 3SUQA 3IRXA 3DLKA 4CJEA 3RRHA 2RKIA 3OJUA 4KHNA 3OYGA 1RTJA 1TV6A 4DU4A 1ZBFA 2VG5A 4RW9A 1S5JA 1ZBUA 3KKSA 1KLMA 1RT3A 4DSJA 2DFEA 4CHYA 1KLNA 4HHTA 4E7IA 3S3MA 3DLBA 1Z26A 4QCLA 2GUIA 2HVHA 4DLGA 3KKRA 2YNIA 1RT6A 1TAQA 3K2PA 4G1QA 4B9TA 3VQ9A 4F3TA 2DY4A 2HHQA 1JL2A 1JXBA 3VQAA 3V9UA 3AO2A 2HB5A 1CXUA 1VSKA 1WSJA 4YNQA 2XHBA 4CF1A 1QSYA 3I0SA 1LWFA 4ID1A 3NDKA 4PUOA 4PWDA 1TAUA 1WSIA 3V81A 4BACA 4W5TA 2P51A 2JLEA 1CZBA 1RDBA 1BI4B 2X6NA 2XRIA 4I9QA 2VWJA 2RF2A 4CEZA 3OYNA 3C6UA 3TAEA 5J2MA 2QKKA 3NGYA 4FW1A 1RTHA 2IGIA 4KTWA 3PX0A 2FBYA 1J54A 1LWEA 2E6MA 4BE0A 4B8CA 4B9MA 2IS3A 3VQ8A 1U47A 3UIQA 3VQEA 3VQQA 2YKNA 3NF7A 1WSEA 4FLTA 1IKWA 4FJGA 1YTUA 4DG1A 4BWMA 1R0AA 2DFFA 1VSEA 5J2NA 4GVMA 3K57A 5EU7A 1ASVA 1TK8A 1YTAA 3HYFA 1VSMA 1F21A 3H08A 4M3RA 1VSFA 1L3UA 2KZZA 1QSLA 4FK4A 3DLHA 3MEDA 4IBNA 3DI6A 3LWLA 2F96A 3VQDA 1HPZA 2ETJA 4CJ4A 1JLFA 3DRSA 3ISNC 1Z25A 3AVBA 2I5JA 5HRNA 3LDSA 2W42A 3AVIA 1IO2A 1TKZA 3IG1A 3OYJA 4B8AB 2VG7A 1RBTA 3ZT0A 3SQ0A 3CYMA 3QETA 2Y1IA 5J1EA 1IKYA 1NK6A 1ZBIA 3AVNA 4OLAA 3SV3A 4BDPA 3AVLA 4TSXA 4DS5A 1SL2A 1B9FA 1QE1A 1SUQA 3PUFA 3VQ5A 4CFAA 4CGDA 4KI4A 4C8NA 4Z4GA 4CJTA 1S9GA 2D0AA 4CJUA 1RNHA 4CEQA 3WNEA 3QEWA 1SL0A 3HJFA 2GBZA 4CIGA 5J2QA 4CF0A 1NOYA 2Z1GA 1X9MA 1D9DA 5CY4A 1SL1A 2KFNA 1D8YA 4CEOA 3SJJA 5C24A 2EHGA 1ITGA 5KRTA 3LP1A 1IKVA 3E01A 1EETA 3L2WA 4CF2A 3SPYA 4CJWA 4CIFA 3LZIA 1Q9XA 4FZYA 1MU2A 1HYSA 1Y97A 2JGUA 5FRMA 3NAEA 4RW6A 3DYAA 1JLBA 3OJSA 3AVJA 3DRRA 3LPTA 4BDYA 3QEVA 4E1MA 1J9AA 4IFYA 2KFZA 4KHQA 4OGCA 1C1BA 4O0JA 3NCIA 3LP0A 5KGXA 3OYMA 4W5RA 4B3OA 3OYIA 1ZYQA 3O3HA 1YT3A 4I9LA 3ZT1A 5FDLA 4CHQA 1KVAA 4E7LA 1C1CA 4HVJA 3TAQA 4M3XA 1LAWA 4CJRA 3OYBA 4RW4A 3DOLA 3V1QA 5J2PA 1IG9A 5HP1A 4FJMA 3VQ7A 3VQ4A 1Q8IA 1N5YA 1WN7A 2OZSA 3KJVA 2AJQA 3SQ4A 3BGRA 1RT2A 4LY7A 4FCYA 1ZBHA 1U49A 3SI6A 4NCAA 5I42A 2HNYA 4CEFA 3MXMA 4Q0BA 4KTZA 4CIEA 3SUPA 2DTUA 1NJWA 2HHWA 3C6TA 4E3SA 3QEIA 1HMVA 1S1TA 1RT7A 2LSNA 3MECA 4ID5A 1L3TA 1DTQA 1TVRA 1QSSA 1RTIA 1CLQA 4MQ3A 4FVMA 2B5JA 4O5BA 3V9WA 2XY6A 4QOZB 1EXQA 3S3OA 1W0HA 3ITHA 4CF9A 4DTRA 2XY5A 2YV0X 1T8EA 4DQRA 1JLGA 1G15A 1TKDA 3VA3A 4JRQA 2Q3SA 3V9XA 4FJIA 4C8KA 4E7KA 4F2RA 1XI1A 1WAFA 4KFBA 1U45A 1NK5A 2PYLA 5I3UA 3TI0A 1J5OA 1SV5A 3NBPA 3NF9A 2KW4A 4Z0UA 4FM0A 4ZTFA 4FJJA 4K8ZA 1C0TA 3K58A 2ZE2A 4B9SA 3IAYA 4E7HA 2HHVA 4K8XA 1KVBA 3OYFA 1L5UA 4DTUA 2OPPA 4CJQA 4DTNA 3RR7A 1NJXA 4PQUA 3NF8A 4OKKA 3M8RA 3AVFA 3K5LA 1T7PA 4CJ5A 1NK4A 4CEBA 2QKBA 2E4LA 4E89A 1LWCA 4CEDA 4Q5VA 3V9ZA 2HMIA 3HVTA 4RG8A 4J2EA 4OGEA 3ZCMA 5KGWA 1VRTA 1DTTA 3OYEA 2XO7A 4DS4A 3OYHA 1LW0A 4E1NA 3OYDA 1REVA 1S1UA 2Z1HA 4EZ6A 4DTSA 1JLAA 4H4MA 3LAKA 3QINA 1RDCA 3NFAA 3QNNA 4DMNA 4I2QA 3QERA 3KLIA 3OYLA 3KK2A 4UQGA 4AHSA 1NK8A 4M3TA 4HCCA 2HHUA 4ICLA 1JKHA 3D45A 3I0RA 3MAQA 3PO4A 5CZ1A 2KZMA 3KD1E 1U04A 2YNHA 4AH9A 3KLHA 3RMDA 1A5WA 1GOBA 2BDPA 1ASWA 4BE2A 3ALYA 4AILC 1VK0A 3CFRA 3V1RA 3OY9A 3V6DA 4M3YA 3G10A 3K5OA 1C1AA 4FJNA 1LW2A 1KFDA 1D5AA 4DFMA 2OPSA 3QIPA 1FKPA 2PY5A 3SUOA 3ZSXA 4M3WA 4CHNA 3P83D 1WSGA 4AHTA 4FLZA 4FLUA 1QTMA 1GOCA 2OPRA 4KREA 3L3UA 1K6YA 3V9SA 2OA8A 4CJPA 1LV5A 3AVAA 1FXXA 4H8KA 1UA1A 4DSKA 1WSFA 4IDKA 3KD5E 4B9VA 3M8PA
chains in the Genus database with same CATH superfamily
5E26A 2P9IB 4CFBA 5E84A 4CJLA 5AQHA 3FFIA 3UB5A 3NH2A 4ELTA 2A40A 3OS1A 1WLJA 4N47A 3BF1A 5HRPA 4YY3K 3SQ1A 4O8UA 1SKRA 2HBMA 1S6PA 3U3GA 3THVA 3LM2A 4WE1A 4CZEA 4DKWA 4PKGA 1N8RO 1VSHA 3CERA 3R3LA 3FR0A 3TTFA 5AQQA 3PLAA 3KIOA 4N41A 2E2PA 2GWJA 4K42A 2GX9A 4Y0WA 3TARA 4GMJB 5AQYA 1JLEA 3HVRA 1IKXA 1GOAA 3MEGA 2IAJA 1ATRA 3ZSYA 2BE2A 2J4RA 4BE1A 5DK5A 5C2FA 1CXQA 2A1RA 3T1AA 4CK2A 4Y1CA 5BPMA 3CFPA 3EYZA 1YAGA 5KTQA 3JAMO 2VCPA 3L4IA 4DV0K 3CG7A 1QZ6A 4KB0A 5BR8K 1W9HA 2QA4N 1W7AA 4DSEA 4H5WA 4FJ5A 4AM6A 4CHZA 2HBLA 1NGAA 3I56N 2D0OA 2QWLA 4J8FA 4I7FA 1HPMA 1GLJO 3VENA 1GLLO 4CJSA 1HRHA 4FWSA 3RWUA 2NRZA 1T44A 4DV3K 2RPIA 3ID8A 3PY8A 4EZ9A 1HQEA 4CESA 1ASUA 1BGXT 4DSIA 4CZJA 4QAGA 3VQPA 2O8EB 1YIJN 4IG0A 1OVQA 3D2FA 3SK3A 3W0LA 3L2VA 3LDQA 1UWBA 4B3TK 3TABA 4JRPA 4C8MA 3OS2A 1S1WA 3DXKB 2YHAA 4KHUA 3HM8A 4BVPA 1I3AA 1T6CA 4FJ9A 3H1QA 1VQ7N 1TKTA 4C8LA 2D0CA 2GELA 4H0YB 4B9LA 4GW6A 1UOCA 3VQCA 1Q86O 2P9KB 4I6MB 4F2SA 3T69A 1IBMK 1LAVA 4BR2A 4GKKK 3SBGA 3HP9A 3C6AA 3VTIA 1T03A 4FJHA 3A0IX 4JS5A 2FBXA 3ULEB 4DQQA 1JXEA 1Q7YO 4KBOA 3L2UA 1I39A 2V51B 4BR4A 1VQON 2CGLA 5KQ8A 4IFVA 1GLFO 3GG4A 4KRFA 4BROA 3O3GA 2P9UA 4PHTX 5C25A 4UY8O 4BG9A 4ISFA 4KAZA 4KI6A 2QWOA 4M3ZA 2W6KA 3BDPA 4CK1A 1BIUA 1VQ9N 3IS9A 3CC4N 5GIOA 1XMQK 3NF6A 2ZGYA 2WFBA 1EKEA 5ELZA 3L2RA 3SNNA 4H5VA 4IEEA 3AA2A 4B3MK 2UUBK 2KTQA 1EO1A 3L3VA 2ITMA 3AAPA 3HSCA 3O1BA 1HNZK 1W97L 4U67L 1QQCA 4CGJA 3TANA 3PX6A 1SQKA 3TTCA 4WQ5A 2YHXA 3AA4A 5CZ2A 3CCLN 3TSQA 4M3UA 2YNGA 4Z4HA 4H4OA 2FF3B 3LAMA 1NMDA 2XY8A 2GV9A 1VSJA 3ZSZA 3SUNA 1GLEG 4H5NA 4BGBA 3MWPA 3K5NA 3MXJA 4E7JA 3FZMA 1BO5O 3IDHA 2NZTA 3LWMA 3ATVA 4YOVA 4FXDA 4CE9A 1A5XA 2P9SA 1WSHA 2P9PA 5KI6A 2XY7A 2O4IA 5M1PA 3AA5X 2B4JA 2O8DA 4C8OA 2E6LA 4FK0A 2KKZA 4O44A 3AO4A 4JKCA 4NYFA 4CGIA 3SUQA 3H46O 4KHNA 1RTJA 3K0SA 1X9JA 2V7ZA 1ZBUA 3KKSA 3J7YP 4DSJA 1RT3A 3ENHA 1WOQA 4CHYA 1Z26A 4BQLA 2I7PA 1VQNN 1RT6A 3K2PA 4F3TA 2HHQA 4JKGB 3V9UA 5GINA 4MLEA 1WSJA 4YNQA 4CF1A 1LWFA 3NDKA 2Q0UA 4FWQA 3SBTA 4W5TA 2P51A 3IMXA 2JLEA 4ISGA 1W2BM 5AQJA 1BI4B 5AQVA 5AQUA 3CCUN 1QQNA 2IGIA 3VF4A 3PX0A 2FBYA 1LWEA 3LDLA 1MDUB 2IS3A 3M1FA 3VQ8A 2YKNA 3NF7A 1WSEA 3N4QA 1LOTB 1YTUA 3CETA 3EN9A 3DLLL 4FK4A 3MEDA 4IBNA 5EX5A 3LWLA 3VQDA 4CJ4A 3LDNA 1JLFA 2D4WA 1Z25A 5LJWA 5LJVA 1TKZA 2E1ZA 3ZT0A 4JAXA 4BRNA 3QETA 2Y1IA 2UU9K 4BRQA 5BN8A 1RDWX 3AVLA 4TSXA 4PL7A 2QWNA 3G4SN 1BOTO 1SL2A 4CFAA 4LFCK 3RSEB 5C12A 2GBZA 4CIGA 4CF0A 3AAQA 1NOYA 2Z1GA 1X9MA 5C2DA 5C10A 3SJHA 1K9MO 4LF9K 4CEOA 1ITGA 5KRTA 3LP1A 1IKVA 1SAZA 1EETA 3L2WA 3LDPA 3LZIA 4FZYA 1HYSA 2HSTA 2JGUA 5AQMA 2KFZA 2Q31A 4E1MA 4O0JA 4F9OA 3O3HA 1HKBA 4I9LA 1QZ5A 4WF9L 4DR5K 1U6ZA 1ZC6A 4M3XA 1U2VB 4CJRA 5AQGA 4RW4A 1IG9A 5HP1A 4X65K 1Q8IA 2VYPA 3PSFA 5AR0A 4BR5A 3SQ4A 3BGRA 5AZIB 1RT2A 3HRGA 4YHHK 4Q0BA 2DTUA 3CI5A 3QEIA 1HLUA 4ID5A 3CQYA 1TVRA 4FOIA 4K0KK 5KPRA 2ZJPL 3UKUA 1CLQA 2XY6A 2XY5A 3ITHA 5GIPA 3THYA 3V9XA 1OVYA 4GV6A 4WQ5C 3KZBA 4H5TA 4JKHA 3C6HA 2H3GX 3TI0A 3NF9A 5AQTA 2KW4A 2HHVA 1QQMA 3IAYA 3OBYA 3O8MA 4DTUA 4PQUA 3O9QA 1NGJA 3K5LA 1T7PA 2OANA 3CJBA 1NK4A 2NRVA 4E89A 3CCJN 4JKFA 4MO5A 4A59A 3CF5L 3V9ZA 5B8HA 4B1XB 5M1NA 4OGEA 1DTTA 1Y64A 1TYQB 3OYHA 1S1UA 4H4MA 4YOYA 3QINA 4BC5A 3CCSN 3QERA 4I2QA 2V52B 4AHSA 1HX1A 1NK8A 5GAHP 4HCCA 4OPHA 2KHOA 2HHUA 5AZJB 3WQTA 2AP1A 1U04A 2YNHA 1SS6A 1A5WA 4BRHA 4AILC 1Q82O 3OY9A 4IFEA 5DM7L 3CIPA 4FJNA 1LW2A 4OX9K 5FPMA 2O8FB 3ZSXA 3P83D 4FLUA 1QTMA 3L3UA 4GY2B 1HNWK 3PSIA 3AVAA 4WFNL 1WSFA 3KD5E 5AQPA 3CXCM 4HUEA 2A5XA 2G8UA 3HXMA 3MN7A 4IO8A 4FLXA 3RRGA 4FYDA 3CM6A 4MFBA 4DFJA 4Z94A 4DQIA 3MEEA 1X9WA 3I8BA 5ADXH 3SPZA 4CBUA 4DFPA 2X74A 4I2PA 3TWHA 2ZJRL 3S9HA 5F1XA 4JD2A 4FOEA 2E2NA 3U3YA 4K43A 3HOTA 3HK2A 5BPLA 4WQ4A 2X6SA 1X9SA 1XHXA 1HKGA 3O9SA 3Q7CA 2QXLA 4JI2K 2WOMA 3VQBA 4FWRA 5C42A 4F3OA 3OW2M 4B1UB 4CJVA 3BEXA 4DF4A 3H45C 5ADXA 1T05A 3L0QA 1X3NA 4FPBA 3ID6A 3LZJA 4EFHA 3DXMA 2HW3A 3MCPA 1BIZA 3W3DA 4FVUA 1GLDG 4AHRA 5EVZA 1KXPA 1JCGA 3D2EA 3NMUA 4CJKA 3ZX0A 4DR3K 1KRPA 1BL3A 2YX6A 3ZETB 4B9QA 4ELVA 1ATNA 2QTDA 4JHDA 2G8VA 1RGIA 4W5NA 2IVPA 2P5OA 4O4GA 4YOXA 1X1PA 5CYMA 3HL8A 1K8KB 3QICA 1KC8O 4M7XA 2Q36A 4Z4EA 4CJFA 2HHXA 3OBWA 1YJ9N 2F7TA 3QO9A 3QESA 5GAEP 3HM9A 2OYQA 3RMBA 1NGEA 4BRAA 4FM1A 3M6GA 3M8SA 3ASMA 3GL1A 3J7ZO 1NU0A 2D0BA 3VERA 4BDZA 1BWFO 5FPNA 3WNFA 3AVMA 2BGGA 3MN6A 4BVOA 1EQYA 1IH7A 3A5NC 3EZ5A 3O80A 1NKCA 4RW8A 3OHRA 4C1NI 3EO3A 1C0MA 1YVNA 3QMLA 5CHIA 4ZHRA 3A2FA 5TKYA 3L4QA 3O3FA 4HWIA 3P38A 5HRRA 2ZQBA 1QQOA 2PAVA 4DTOA 5FROA 3DWLA 3KHYA 4O5FA 2HNDA 1OKJA 2NUBA 3H3NO 1VQKN 1NBWA 1MWKA 1DLOA 3WQUA 1QHTA 3QDKA 4V19S 1RBSA 3CCMN 1NGBA 5E41A 4KPYA 3VA0A 2QK9A 4WFBL 3LM9A 2HHSA 3KWIA 1TGOA 3NH1A 4IEIA 1CZ9A 4K41A 5HL7L 2PFUA 4BRLA 2E5LK 2P5GA 2P9NA 2G8FA 1L3SA 5JLHA 3F9KA 5AQWA 3A5LC 1YF5L 1BA1A 3CJ1A 3SYZA 4CZHA 3OYCA 1WNSA 4E1JA 4OJRA 1BCMA 3CFOA 4BR9A 3ZSWA 4KO0A 4L8RB 1XNRK 4F8RA 4CI6A 2FSNA 1CZAN 1TL1A 4FWKA 2E8AA 4O55A 4B1ZA 4KH5A 5KPZA 4KB1A 2ASOA 3DM2A 2O8CA 3LP3A 3O4WA 3QIOA 1J5EK 1D4XA 2P9LB 4WQ4C 1D9FA 4KKOA 2F8TA 5KQDA 3NVKA 3AVCA 2E2OA 3CQXA 4CGHA 1BDGA 3B8AX 3ZSQA 1XC9A 2O4GA 2UUCK 1X3MA 3VEZA 3DLRA 3VEXA 1BQMA 4DU1A 2P1JA 3QNOA 4G9ZA 4DCHA 2E1YA 3AVKA 3MMVA 5HLFA 1C6VA 1O13A 3ZX2A 1RT1A 2GEMA 2KQ2A 4O8KA 2NNWA 3WNHA 3PV8A 2O8BA 3HPOA 3P1GA 5SZTA 3KLFA 3C0BA 3HT3A 3K5MA 3ULDA 4BY9C 1JLQA 4DLEA 4DB3A 2VG6A 4NB4A 4QS8A 1R59O 4XH4A 3OYGA 3KWGA 2P9IA 1TV6A 5FPEA 1ZBFA 4IJAA 4DV4K 1TUUA 3S3MA 2GUIA 3KKRA 3C7NB 1TAQA 2WC9A 4G1QA 4B9TA 3AO2A 1GLBG 2XHBA 4JI5K 3I0SA 4FO0A 2BH1A 4BACA 3UE5A 2FLOA 3FZHA 2X6NA 4I9QA 1XQSC 3R1XA 4CEZA 2UYTA 4FW1A 4X64K 1RTHA 3U4LA 4MDBA 4DUYK 4B8CA 4B9MA 1NNEA 1U47A 3VQEA 3J7AP 4FLTA 1IKWA 4FJGA 4BWMA 2Q0RA 3WEEB 1VSEA 3ZYYX 4GVMA 5TKWA 5EU7A 3K57A 5C0YA 5AQKA 4GV3A 2CH6A 3HYFA 4GVEA 2KZZA 2VQFK 4XH1A 3DI6A 2F96A 1HPZA 1JCFA 3DRSA 4FWLA 1QHAA 2I5JA 5HRNA 2W42A 1IO2A 3VEWA 3OYJA 4BRFA 4KH6A 3VOVA 3K9KA 5J1EA 1IKYA 1NK6A 4OLAA 4DV7K 4KI4A 1SUQA 1S72N 4LF5K 2A41A 4C8NA 2D0AA 4BC3A 5J2QA 1VQ6N 1D9DA 2KFNA 5LMUK 5C24A 4BRMA 3E01A 3P31A 3DRRA 3LPTA 4OGCA 2CGJA 5BRDA 5KGXA 3OYMA 1WB9A 1EWRA 3OYIA 5FDLA 1G99A 4HVJA 1LAWA 5BREA 3DOLA 5J2PA 4A57A 4FJMA 3VQ4A 2O8EA 1N5YA 1WN7A 2OZSA 4LY7A 1ZBHA 5DM6L 4FCYA 3SI6A 4NCAA 4CEFA 4RTFD 3SUPA 2ASMA 3N4PA 1RT7A 2LSNA 3DXKA 1GLAG 1KQSM 1DTQA 3J8AA 1RTIA 4A61A 1QSSA 4FVMA 2B5JA 4O5BA 4QOZB 1EXQA 3WXMB 1W0HA 4DTRA 2NLXA 3R8EA 4LC9B 2Q3SA 4C8KA 4C1NK 4E7KA 1VQPN 4I6MA 5AQRA 4A5AA 3A5OC 1VQ8N 5I3UA 5LMNK 1IBKK 1J5OA 1BG3A 1SV5A 4FJJA 4Z0UA 4FM0A 4ZTFA 4K8ZA 2ZE2A 4E7HA 4K8XA 1L5UA 3ULEA 1NLVA 4CJQA 3R9PA 4DTNA 4BRDA 4CJ5A 3O6WA 1NM1A 1LWCA 4DR6K 4CBWA 2HMIA 3HVTA 4RG8A 1VRTA 3OYEA 1LW0A 2FSJA 1OH5A 4E1NA 3OYDA 1REVA 5BN9A 3WT0A 3SAGA 3QNNA 3CC2N 4BR0A 4UQGA 2VWBA 3CPWM 3R6MA 1JKHA 3PO4A 1JJ2M 2KZMA 4AH9A 1GOBA 5A2QO 4BE2A 1VK0A 4RWTA 3HBTA 3V1RA 4NLCA 3V6DA 1M90O 3G10A 3CPEA 3H3OB 4QS7A 3TSUA 1C1AA 4DFMA 2OPSA 2PY5A 3SUOA 4FLZA 1N36K 2OA8A 4JEPA 4CJPA 1LV5A 1FXXA 3QBWA 4H8KA 4B9VA 5AQOA 3M8PA 2OCEA 5HBMA 3WXIA 3F73A 3BUZB 3TAPA 4MO4A 1HQUA 4BG8A 2QWPA 3FLCO 1KFSA 1VQLN 4FJXA 3FZKA 4CGFA 4M7YA 4CZLA 5C15A 1HUXA 1KTQA 3ZSOA 1L3VA 5AJ3K 4FM2A 1YITN 4BC2A 3QEPA 4NCGA 3BZCA 5JICA 2RHKA 1WAJA 1NK9A 5GADP 2IIRA 3P39A 4LSLA 3G0ZA 5LL6Z 2Z1JA 3H1VX 1SKSA 3ATUA 3VQ6A 4OVLA 3CD6N 4CW7B 5EY4A 4IOAL 1JCEA 3T1HK 2QW9A 3QLHA 4CHOA 1KVCA 3OA9A 4FPAA 3Q7BA 3LL3A 4B1YB 4CBXA 1N34K 2QWRA 3PIPL 1YXQA 1GLCG 4XEIA 3VTHA 4JKGA 3CC7N 1YI2N 4O0IA 2R7YA 4OO1J 3AVGA 2UXCK 1BISA 4CCHA 4CK3A 4FLYA 3U9ZA 3TAFA 1XWLA 4DV1K 1BI4A 3DLGA 2OZMA 5M1OA 3QEXA 4PY5A 4PL8A 1FKOA 3SZ2A 4LD0A 1LCUA 4BRKA 3DAWA 2W6LA 3PO5A 3CCRN 2HHTA 4JD2B 4N56A 3NHGA 1I94K 1NJZA 3OS0A 3OVNA 4JI4K 3RR8A 4E0DA 2FC0A 3CM5A 3VN5A 1UA0A 2KLAA 4IG3A 4FZXC 3QFPA 2VGMA 3VPZA 2ZD1A 1ZXOA 1TL3A 3QBXA 4B08A 1YVUA 4N5SA 3DMJA 1FJGK 2HVIA 4F4KA 1M1KO 4HTUA 1S1VA 3MN5A 5AQIA 3G71N 3GBTA 4EHTA 2ITGA 3DJCA 3FZFA 2YHWA 2ZWHA 5JMVA 1KSPA 4Z4FA 3RSEA 5EXWA 3DLEA 3MXIA 4KHSA 4M41A 1HNIA 2DFHA 5JS1A 1RT4A 3E9OA 3RVCA 4BR7A 1RILA 4AHCA 1BQNA 2A6AA 4DQ8A 2AA4A 3OYKA 3ZEUB 3NGZA 3AO5A 4LH5A 4DR1K 3KK1A 1NK7A 1HNXK 3O1WA 1VRUA 1EP4A 3DOKA 3BZKA 4W5OA 3ENOA 1U2VA 2ASPA 4B9UA 4LFBK 3ZT2A 2FBVA 2Z1IA 4OKJA 4PKHA 4RW7A 1IV0A 4JS4A 4WFAL 4M63C 5AQNA 2HMPA 3UKRB 1Z05A 3D7EO 4DQPA 5D3GA 4DTJA 1BHLA 1QS4A 3CQ8A 5JVHL 4RCHA 1N33K 1FK9A 4EP5A 1OH8A 4LSNA 2D5RA 3TAMA 1Q9YA 1Q81O 1IBLK 3HPGA 3TR8A 5KPTA 4KHWA 3AV9A 4B3RK 1C0GA 2FF6A 2HHHK 5IWAK 1WUAA 2NRXA 3F9MA 5F0XA 4DF8A 1TUYA 4A2BA 2G8WA 4HCBA 1BA0A 4KREA 3JSMA 4FZZA 3PX4A 1RBRA 5CE3A 1VQ5N 1FW6A 2YNFA 2NRTA 2E88A 4E19A 1HJRA 2DPNA 5T7BA 1XHZA 3U9DA 4KHPK 4CECA 2OPQA 5IT9O 3HPHA 1NGIA 4FLVA 4JKDA 2FSKA 4ZTJA 1VSDA 5K14A 3AGRA 3F5TA 3HZ6A 2VGNA 5M1QA 3B6OA 2EX3A 2G8IA 1S6QA 4CF8A 3HP6A 4FWPA 1ZBLA 2QWMA 2IC3A 3H6EA 4YFUA 4H0VB 5AZJA 4KV8A 3SQ2A 5HROA 4A2AA 2F8SA 4OLBA 3AA3A 2YKMA 2WONA 1IJJA 1RBVA 3KLGA 5M1FA 3P5JA 4FJ7A 4FJ8A 1E3MA 3EKUA 4DU3A 2O8FA 2FBTA 4BRPA 4JI1K 2FXUA 3F2KA 3WXKA 3CCQN 3AVHA 4CEEA 5AQFA 4KTQA 1WBBA 3HSTB 1HR0K 3O9TA 1Q18A 4CJEA 2RKIA 3OJUA 2HF3A 4DU4A 4JKAA 4RW9A 1S5JA 2IVNA 3KVGA 1XUPO 1KLNA 2HVHA 4B1VA 3DLBA 4QCLA 2YNIA 3CJ7A 4ILJA 2DY4A 4IWVA 3VQ9A 4JKEA 1JL2A 1JXBA 4JN4A 2HB5A 1CXUA 1VSKA 1NG9A 4YOTA 3V81A 3IUCA 1CZBA 4JI0K 3CJ9A 1RDBA 4JNEA 1KD1O 2VWJA 4A62A 2RF2A 3C6UA 1MWMA 3THWA 4JI3K 4FL9A 5BRFA 4LF6K 1J6ZA 2A42A 2DFFA 1ASVA 1TK8A 4BRIA 1YTAA 1E4FT 3A5MC 3CCEN 1VSMA 1F21A 4M3RA 4CD1A 5GAGP 1L3UA 2YJFA 1QSLA 2WTUA 3ISNC 3AVBA 2WUSA 3IG1A 4B8AB 4H0OA 3TPQA 1RBTA 3E9LA 3SQ0A 1NGGA 3D2FB 3ZETA 3SV3A 4BDPA 4FSVA 4IZ9A 3VQ5A 4DS5A 3C65A 4Z4GA 4CJUA 1S9GA 3SAHA 3QEWA 1SL0A 3VEOA 2I7NA 3HJFA 5CY4A 5MLCQ 1D8YA 1K8KA 3SJJA 2EHGA 1NGFA 4GNIA 2ZM6K 5JLFA 2F4VK 4CJWA 1Q9XA 1MU2A 4BQZA 5FRMA 3M5RA 1JLBA 3OJSA 3AVJA 3QEVA 4IFYA 1HJOA 4W5RA 3SAFA 3THXA 4NXNK 1KVAA 4E7LA 3TAQA 3CMAN 3TSPA 3OYBA 3LDOA 3V1QA 3MK6A 3KJVA 1NMNA 1YHQN 1VQMN 1NGCA 5I42A 3MXMA 4CIEA 3IFRA 4LFAK 1NJWA 2HHWA 3MWTA 3C6TA 3BP8A 1WBDA 1HMVA 1S1TA 5AFUH 4BC4A 4YOUA 1L3TA 2JWKA 2P9UB 3V9WA 4EAHD 3S3OA 3FFKB 4CF9A 1ZBSA 5H1SQ 1JLGA 1G15A 4DV5K 2D1KA 1DGKN 4FJIA 3TU5A 1T3VA 4YOWA 3NBPA 4DV2K 1C0TA 3BY5A 2ZJQL 1KVBA 3OYFA 4JI7K 2OPPA 1NJXA 3NF8A 3SLCA 2OTJN 4MDAA 2QKBA 2E4LA 5CR4A 1HKCA 5AFUA 4Q5VA 4CZFA 4J2EA 2XO7A 3CJAA 4C23A 4EZ6A 2Z1HA 3LAKA 4JKBA 3JS6A 3OYLA 3KK2A 2QWQA 3EEQA 3JXUA 4M3TA 2NRHA 3U8XA 4ICLA 3EE9A 4JV5K 3D45A 3I0RA 4NLBA 3MAQA 5CZ1A 5JVGL 3T7ZA 3ZLJA 5AQSA 3CFRA 3K5OA 1BUPA 4BGAA 2P9SB 2P9PB 3QIPA 1WSGA 4K25A 2O8DB 1GOCA 2OPRA 1K6YA 4B3SK 4IOCL 4DSKA 1UA1A 2UUAK 4IDKA 1S22A 4YORA 4WCEL 2A1SA 4FWNA 2HBJA 4AQYK 1NOZA 2P9LA 4NYNA 4PA1A 3RTVA 4N76A 3T19A 4J2DA 1ILYA 1RBUA 3ZSRA 3RMCA 3V4IA 4FW2A 3WUHA 2IDOA 3QFUA 3AGKA 2X78A 4ELUA 2HNZA 4NO7A 5BPNA 4IXCA 5FPDA 3O4NA 3L8BA 3AO1A 3TTDA 1Z6RA 5BR9A 3TAGA 3GDQA 3CMEN 1NJYA 4BWJA 3NVMA 1KAXA 4H5RA 3VETA 3NH0A 1N6QA 2NRWA 1HNVA 1JLCA 4IO9L 3ZT4A 4OPKA 3QB0A 4JLHA 4A5BA 3U6FA 4X62K 2IOCA 1K73O 3VF2A 4LH4A 4FLWA 1V4SA 4BREA 1TKXA 1UAXA 3LP2A 1IG8A 1NKEA 1RT5A 1VSIA 5M1KA 4HUFA 4CERA 3C7NA 1RDDA 2OTLN 1EX4A 4DQSA 1V4TA 1JL1A 4W5QA 1O1WA 3O9UA 4DHYA 1KCFA 2G8HA 5JS2A 3L6QA 5DMRA 3T3FA 4AF1A 3VGMA 3NE6A 1KAYA 2PZSA 3EY1A 4CJ3A 3HO1A 3JYTA 2ZF5O 4MLHA 4BRCA 3VMFB 2VWKA 3I33A 2P9KA 3LANA 4GV9A 3E9PA 5I9EB 4OKEA 1TK0A 4DV6K 4J2AA 4CGGA 2JWLA 4DTXA 1B9DA 3WEEA 1P8ZA 3VEVA 3VGKA 4LF8K 2PYJA 2ATQA 3AO3A 3I55N 4FK2A 1U4BA 3VESA 3CCVN 3FZLA 2CH5A 3EZWA 3M3ZA 1B92A 3EE8A 2D0PA 3DRPA 1HYVA 4LF7K 1RDAA 3CHWA 4Y1DA 4R79A 3L2QA 1J53A 1U48A 4FJKA 3NGIA 4QS9A 4CZKA 3UKUB 2RE2A 2IVOA 4CFDA 1HYZA 5CYQA 1RTDA 1S3XA 2F9TA 1YUWA 3THYB 4DTMA 4JI6K 4CFCA 4CZGA 3S3NA 3ZT3A 1ESVA 1NGDA 3C94A 3O4QA 3S41A 3KLEA 4DTPA 3KK3A 2UXDK 2BANA 4KHYA 3FE1A 1C0FA 4CEAA 4B9NA 3OYAA 3C95A 4AHUA 4IKFA 4NCBA 4HUGA 1YJNN 3LALA 2QEXN 1C0UA 2BUPA 1S9EA 1BCOA 3MCAB 4U7BA 1TK5A 2QXFA 3SV4A 4XH5A 4DWIA 1NGHA 3WNGA 1YJWN 1VAZA 4CHPA 4EP4A 5KRSA 2YHBA 3B6PA 4AHVA 1K8AO 4FJLA 4R5PA 3VEYA 2VQEK 2BTFA 2E2QA 3HOSA 4DUZK 1XMOK 2A3ZA 2WBNA 3BF3A 3KTQA 4BRGA 2B6AA 1DT9A 4Z4IA 3LPUA 4JI8K 4OPJA 2G8KA 2CGKA 3ZX3A 3GOIA 4X66K 5LY3A 1RCHA 4DFKA 3A8YA 5HRSA 3ZSVA 1SKWA 3M8QA 1ATSA 4DR4K 1BU6O 2UXBK 1QVFM 1RFQA 3K59A 4DSFA 3I8DA 4M45A 3EKSA 4H0XB 2HBKA 4IOXA 1A5VA 3V1OA 2GUPA 1DKGD 4AM7A 3SCXA 1NKBA 1VSLA 4XIUA 3RMAA 1S1XA 3SMPA 4DR7K 5FRNA 4J2BA 5SWMA 4DSLA 4HTLA 3D0PA 4M42A 4Z4CA 4L3QA 3G25A 4JK9A 2RN2A 1NWKA 1NK0A 2Y1JA 3PIOL 2Q2RA 2QI2A 3IRXA 3DLKA 3RRHA 3D6RA 2VG5A 2QM1A 1KLMA 3J80O 4KH4A 1VHXA 2DFEA 4HHTA 4E7IA 4YDUA 3DXMB 4DLGA 1XC3A 3VQAA 3D2EB 4JK7A 3WXJA 1QSYA 4PUOA 3E1YA 4ID1A 4PWDA 1TAUA 1WSIA 3HTVA 3AY9A 4JHDB 2XRIA 3O08A 3MX5A 3OYNA 3TAEA 5J2MA 3MX2A 3P4IA 2QKKA 1XNQK 3NGYA 4KTWA 3VGLA 1J54A 3E66A 2E6MA 4BE0A 1N32K 3UIQA 5AQXA 5BRHA 3VQQA 4IJNA 4DG1A 1DEJA 1R0AA 5J2NA 4NXMK 5FLXO 3MDQA 5AZIA 3H08A 1VSFA 3FGUA 3DLHA 5EOYA 2ETJA 3LDSA 3IKMA 3AVIA 5AQZA 3SMSA 1MA9B 2VG7A 2W40A 2E20A 1ZBIA 3CYMA 3AVNA 1OH7A 2YCHA 1B9FA 1QE1A 2YHYA 3PUFA 4CGDA 4H0TB 4CJTA 1QVGM 2NRRA 1RNHA 4B1WB 3WNEA 4CEQA 4WYBA 1SL1A 3VF6A 3OTOK 3SPYA 4CF2A 4FWMA 4CIFA 4CZIA 1Y97A 5HOOA 3NAEA 4RW6A 3DYAA 4BDYA 1J9AA 5AQLA 1OH6A 4KHQA 2ZGZA 1C1BA 3NCIA 3THWB 3LP0A 2PBDA 4B3OA 1ZYQA 1YT3A 3G6EN 3ZT1A 4GKJK 4CHQA 1C1CA 3J81O 1TYQA 2Q97A 3VQ7A 2V7YA 3O9RA 2AJQA 4LF4K 3HI0A 1U49A 5F2RA 3K9JA 2HNYA 4EIAA 3CJCA 4KTZA 4IDHA 4E3SA 2GWKA 2P9NB 3MECA 2EWSA 4ILGB 4MQ3A 1H1VA 4PKIA 2YJEA 3GE1A 1SZ2A 2YV0X 1RDUA 1T8EA 4DQRA 1TKDA 3ZEUA 3VA3A 4JRQA 2HOEA 4OPAA 1NJIO 3MN9A 4F2RA 2F9WA 1XI1A 1WAFA 4KFBA 1U45A 1NK5A 2PYLA 4JYAK 4EHUA 3T1YK 3K58A 4B9SA 4CZMA 3RR7A 1VQ4N 4OKKA 3M8RA 3AVFA 3UKRA 3KK7A 4CEBA 4CEDA 3THXB 1P90A 2O8CB 3ZCMA 1EWQA 4FWOA 5KGWA 4DS4A 1KAZA 4CVNE 2HF4A 4DTSA 1JLAA 1RDCA 3NFAA 4DMNA 1T6DA 3KLIA 3O5BA 4H0PA 2Q1NA 4ISEA 4DR2K 3WXLA 4JK8A 3ENBA 2W41A 3KD1E 3KLHA 3RMDA 2BDPA 4CJ7A 1ASWA 3AARA 1E4GT 3ALYA 4H03B 4M3YA 2YI1A 4YDUC 1KFDA 1D5AA 4ILHA 4M3WA 1FKPA 2O8BB 4CHNA 4AHTA 3EL2A 4CD3A 3V9SA 2GTDA
chains in the Genus database with same CATH topology
5HBMA 4HUEA 2G8UA 2A1SA 3F73A 3HXMA 4FLXA 3RRGA 1NOZA 3CM6A 4NYNA 4MFBA 4PA1A 3RTVA 4CFBA 4DFJA 3T19A 3TAPA 4N76A 4J2DA 4CJLA 3MEEA 1X9WA 4DQIA 1HQUA 3SPZA 3FFIA 1KFSA 4FJXA 4CGFA 3NH2A 4ELTA 1RBUA 3ZSRA 3OS1A 4DFPA 3RMCA 3V4IA 1WLJA 4N47A 5HRPA 4FW2A 3SQ1A 2X74A 2IDOA 1SKRA 4I2PA 1KTQA 3ZSOA 3TWHA 1L3VA 1S6PA 2X78A 3U3GA 3S9HA 4FM2A 4ELUA 2HNZA 3THVA 4WE1A 3O4NA 3QEPA 4NCGA 3U3YA 3L8BA 1VSHA 1WAJA 3AO1A 3TAGA 3HK2A 2X6SA 1X9SA 1XHXA 1NJYA 1NK9A 3KIOA 4LSLA 4BWJA 4N41A 3G0ZA 2Z1JA 3NH0A 1N6QA 3TARA 4GMJB 1SKSA 1HNVA 4OVLA 1JLCA 3VQ6A 1JLEA 2WOMA 3ZT4A 4OPKA 3HVRA 1IKXA 3VQBA 4JLHA 1GOAA 5C42A 4F3OA 3MEGA 2IAJA 3QLHA 4CHOA 3U6FA 3ZSYA 4CJVA 2IOCA 4DF4A 2BE2A 1KVCA 4BE1A 4LH4A 5DK5A 1CXQA 4FLWA 2A1RA 1T05A 3T1AA 1TKXA 1UAXA 3LP2A 4CK2A 3LZJA 1NKEA 2HW3A 1RT5A 1VSIA 4HUFA 4CERA 4Y1CA 1RDDA 1BIZA 1EX4A 3CFPA 4AHRA 4DQSA 3EYZA 4O0IA 2R7YA 1JL1A 3AVGA 5KTQA 1O1WA 4CJKA 4W5QA 1BISA 2G8HA 1KCFA 3CG7A 5JS2A 4CK3A 1KRPA 4CCHA 1BL3A 5DMRA 4FLYA 3T3FA 4KB0A 3NE6A 4ELVA 3TAFA 1XWLA 2PZSA 3EY1A 4CJ3A 1BI4A 3DLGA 3JYTA 2G8VA 1W9HA 2OZMA 3QEXA 3HO1A 4PY5A 4DSEA 1FKOA 4FJ5A 2VWKA 3SZ2A 4CHZA 4W5NA 4LD0A 2P5OA 3LANA 4O4GA 1X1PA 5CYMA 3HL8A 4OKEA 1TK0A 4J2AA 4Z4EA 4CGGA 4I7FA 3PO5A 4CJFA 2HHTA 2HHXA 4DTXA 3NHGA 4N56A 1NJZA 1B9DA 3OS0A 3QO9A 3QESA 4CJSA 3OVNA 1HRHA 3RR8A 4E0DA 3HM9A 2OYQA 2FC0A 3CM5A 3RMBA 3RWUA 4FYDA 3VN5A 4FM1A 1UA0A 2PYJA 2ATQA 3AO3A 4FZXC 4IG3A 3M8SA 4FK2A 3ASMA 2ZD1A 1U4BA 1TL3A 2RPIA 4B08A 3PY8A 1YVUA 2D0BA 4N5SA 4EZ9A 3DMJA 1HQEA 4BDZA 4CESA 1B92A 2HVIA 1ASUA 1BGXT 4F4KA 4DSIA 4QAGA 3AVMA 3DRPA 3VQPA 3WNFA 4HTUA 2BGGA 1HYVA 4IG0A 1S1VA 1RDAA 4Y1DA 3L2VA 2ITGA 1UWBA 3L2QA 1IH7A 1J53A 3EZ5A 3TABA 1U48A 1KSPA 4Z4FA 4JRPA 4C8MA 1NKCA 3MXIA 3DLEA 4RW8A 4KHSA 3OS2A 1C0MA 4M41A 1S1WA 4ZHRA 3A2FA 3O3FA 1HNIA 2DFHA 5HRRA 2YHAA 2ZQBA 4FJKA 3NGIA 5JS1A 4DTOA 1RT4A 5FROA 4KHUA 1I3AA 1RILA 4AHCA 4CFDA 4FJ9A 1BQNA 1HYZA 1TKTA 5CYQA 1RTDA 4C8LA 3OYKA 2HNDA 2D0CA 4B9LA 2NUBA 4GW6A 3NGZA 4DTMA 1UOCA 3AO5A 4LH5A 3VQCA 3KK1A 1NK7A 4CFCA 4F2SA 1DLOA 1LAVA 1QHTA 1VRUA 1EP4A 3S3NA 3DOKA 3ZT3A 3HP9A 1RBSA 5E41A 1T03A 3C94A 4W5OA 3O4QA 3VA0A 4KPYA 3KLEA 2QK9A 4B9UA 4DTPA 3KK3A 2BANA 4FJHA 3ZT2A 4KHYA 2FBVA 2Z1IA 4JS5A 2FBXA 4OKJA 4RW7A 4CEAA 3OYAA 4JS4A 4B9NA 1TGOA 3NH1A 4DQQA 2HHSA 3C95A 1JXEA 4AHUA 4IKFA 4NCBA 3L2UA 4HUGA 1CZ9A 1I39A 3LALA 1C0UA 4DQPA 1S9EA 5D3GA 4DTJA 1BCOA 1BHLA 4IFVA 1TK5A 1QS4A 2QXFA 3CQ8A 2P5GA 2G8FA 1FK9A 4EP5A 1L3SA 4LSNA 2D5RA 3TAMA 3F9KA 3SV4A 1Q9YA 4KRFA 3HPGA 3TR8A 4DWIA 4KHWA 3AV9A 3WNGA 3O3GA 3SYZA 4CHPA 5C25A 4EP4A 5KRSA 2YHBA 3OYCA 3B6PA 4AHVA 4KAZA 4KI6A 1WNSA 4FJLA 4R5PA 4M3ZA 3BDPA 4OJRA 4CK1A 4DF8A 1BCMA 1BIUA 3IS9A 3KTQA 3CFOA 2G8WA 4HCBA 3NF6A 2B6AA 3ZSWA 4KO0A 3JSMA 1EKEA 4L8RB 4FZZA 4Z4IA 3LPUA 3PX4A 1RBRA 4F8RA 4OPJA 3L2RA 2G8KA 3SNNA 2YNFA 4DFKA 1RCHA 3AA2A 4E19A 5HRSA 1TL1A 1HJRA 5T7BA 2KTQA 3L3VA 1XHZA 3ZSVA 4O55A 1SKWA 1QQCA 2OPQA 4CECA 3M8QA 4CGJA 4KB1A 3DM2A 3HPHA 3LP3A 3PX6A 3TANA 4FLVA 3AA4A 3QIOA 5CZ2A 4ZTJA 1VSDA 5K14A 3K59A 4DSFA 3I8DA 4KKOA 1D9FA 2F8TA 4M45A 3B6OA 3AVCA 4M3UA 2EX3A 2YNGA 4Z4HA 4H4OA 2G8IA 1A5VA 1S6QA 2XY8A 3LAMA 4CF8A 2GV9A 1VSJA 3V1OA 4CGHA 3HP6A 3ZSZA 3SUNA 3SCXA 1ZBLA 3ZSQA 1XC9A 2O4GA 1NKBA 1VSLA 3K5NA 4YFUA 2IC3A 3DLRA 3MXJA 1BQMA 4DU1A 2P1JA 4XIUA 3QNOA 4E7JA 3RMAA 1S1XA 4KV8A 3SQ2A 5HROA 2F8SA 4OLBA 3AA3A 3LWMA 2YKMA 2WONA 5FRNA 3AVKA 5HLFA 1RBVA 1C6VA 3KLGA 4FXDA 4J2BA 4CE9A 1A5XA 5SWMA 3P5JA 1RT1A 4DSLA 4FJ7A 2KQ2A 4FJ8A 1WSHA 5KI6A 3D0PA 2XY7A 2O4IA 4M42A 4Z4CA 4DU3A 2FBTA 3WNHA 2RN2A 3AA5X 3HPOA 3P1GA 5SZTA 3KLFA 3PV8A 1NK0A 2B4JA 4C8OA 3AVHA 2E6LA 4CEEA 2Y1JA 4FK0A 3HT3A 3K5MA 4O44A 3AO4A 3ULDA 4KTQA 4NYFA 4CGIA 1JLQA 3HSTB 4DLEA 2VG6A 3SUQA 3IRXA 3DLKA 4CJEA 3RRHA 2RKIA 3OJUA 4KHNA 3OYGA 1RTJA 1TV6A 4DU4A 1ZBFA 2VG5A 4RW9A 1S5JA 1ZBUA 3KKSA 1KLMA 1RT3A 4DSJA 2DFEA 4CHYA 1KLNA 4HHTA 4E7IA 3S3MA 3DLBA 1Z26A 4QCLA 2GUIA 2HVHA 4DLGA 3KKRA 2YNIA 1RT6A 1TAQA 3K2PA 4G1QA 4B9TA 3VQ9A 4F3TA 2DY4A 2HHQA 1JL2A 1JXBA 3VQAA 3V9UA 3AO2A 2HB5A 1CXUA 1VSKA 1WSJA 4YNQA 2XHBA 4CF1A 1QSYA 3I0SA 1LWFA 4ID1A 3NDKA 4PUOA 4PWDA 1TAUA 1WSIA 3V81A 4BACA 4W5TA 2P51A 2JLEA 1CZBA 1RDBA 1BI4B 2X6NA 2XRIA 4I9QA 2VWJA 2RF2A 4CEZA 3OYNA 3C6UA 3TAEA 5J2MA 2QKKA 3NGYA 4FW1A 1RTHA 2IGIA 4KTWA 3PX0A 2FBYA 1J54A 1LWEA 2E6MA 4BE0A 4B8CA 4B9MA 2IS3A 3VQ8A 1U47A 3UIQA 3VQEA 3VQQA 2YKNA 3NF7A 1WSEA 4FLTA 1IKWA 4FJGA 1YTUA 4DG1A 4BWMA 1R0AA 2DFFA 1VSEA 5J2NA 4GVMA 3K57A 5EU7A 1ASVA 1TK8A 1YTAA 3HYFA 1VSMA 1F21A 3H08A 4M3RA 1VSFA 1L3UA 2KZZA 1QSLA 4FK4A 3DLHA 3MEDA 4IBNA 3DI6A 3LWLA 2F96A 3VQDA 1HPZA 2ETJA 4CJ4A 1JLFA 3DRSA 3ISNC 1Z25A 3AVBA 2I5JA 5HRNA 3LDSA 2W42A 3AVIA 1IO2A 1TKZA 3IG1A 3OYJA 4B8AB 2VG7A 1RBTA 3ZT0A 3SQ0A 3CYMA 3QETA 2Y1IA 5J1EA 1IKYA 1NK6A 1ZBIA 3AVNA 4OLAA 3SV3A 4BDPA 3AVLA 4TSXA 4DS5A 1SL2A 1B9FA 1QE1A 1SUQA 3PUFA 3VQ5A 4CFAA 4CGDA 4KI4A 4C8NA 4Z4GA 4CJTA 1S9GA 2D0AA 4CJUA 1RNHA 4CEQA 3WNEA 3QEWA 1SL0A 3HJFA 2GBZA 4CIGA 5J2QA 4CF0A 1NOYA 2Z1GA 1X9MA 1D9DA 5CY4A 1SL1A 2KFNA 1D8YA 4CEOA 3SJJA 5C24A 2EHGA 1ITGA 5KRTA 3LP1A 1IKVA 3E01A 1EETA 3L2WA 4CF2A 3SPYA 4CJWA 4CIFA 3LZIA 1Q9XA 4FZYA 1MU2A 1HYSA 1Y97A 2JGUA 5FRMA 3NAEA 4RW6A 3DYAA 1JLBA 3OJSA 3AVJA 3DRRA 3LPTA 4BDYA 3QEVA 4E1MA 1J9AA 4IFYA 2KFZA 4KHQA 4OGCA 1C1BA 4O0JA 3NCIA 3LP0A 5KGXA 3OYMA 4W5RA 4B3OA 3OYIA 1ZYQA 3O3HA 1YT3A 4I9LA 3ZT1A 5FDLA 4CHQA 1KVAA 4E7LA 1C1CA 4HVJA 3TAQA 4M3XA 1LAWA 4CJRA 3OYBA 4RW4A 3DOLA 3V1QA 5J2PA 1IG9A 5HP1A 4FJMA 3VQ7A 3VQ4A 1Q8IA 1N5YA 1WN7A 2OZSA 3KJVA 2AJQA 3SQ4A 3BGRA 1RT2A 4LY7A 4FCYA 1ZBHA 1U49A 3SI6A 4NCAA 5I42A 2HNYA 4CEFA 3MXMA 4Q0BA 4KTZA 4CIEA 3SUPA 2DTUA 1NJWA 2HHWA 3C6TA 4E3SA 3QEIA 1HMVA 1S1TA 1RT7A 2LSNA 3MECA 4ID5A 1L3TA 1DTQA 1TVRA 1QSSA 1RTIA 1CLQA 4MQ3A 4FVMA 2B5JA 4O5BA 3V9WA 2XY6A 4QOZB 1EXQA 3S3OA 1W0HA 3ITHA 4CF9A 4DTRA 2XY5A 2YV0X 1T8EA 4DQRA 1JLGA 1G15A 1TKDA 3VA3A 4JRQA 2Q3SA 3V9XA 4FJIA 4C8KA 4E7KA 4F2RA 1XI1A 1WAFA 4KFBA 1U45A 1NK5A 2PYLA 5I3UA 3TI0A 1J5OA 1SV5A 3NBPA 3NF9A 2KW4A 4Z0UA 4FM0A 4ZTFA 4FJJA 4K8ZA 1C0TA 3K58A 2ZE2A 4B9SA 3IAYA 4E7HA 2HHVA 4K8XA 1KVBA 3OYFA 1L5UA 4DTUA 2OPPA 4CJQA 4DTNA 3RR7A 1NJXA 4PQUA 3NF8A 4OKKA 3M8RA 3AVFA 3K5LA 1T7PA 4CJ5A 1NK4A 4CEBA 2QKBA 2E4LA 4E89A 1LWCA 4CEDA 4Q5VA 3V9ZA 2HMIA 3HVTA 4RG8A 4J2EA 4OGEA 3ZCMA 5KGWA 1VRTA 1DTTA 3OYEA 2XO7A 4DS4A 3OYHA 1LW0A 4E1NA 3OYDA 1REVA 1S1UA 2Z1HA 4EZ6A 4DTSA 1JLAA 4H4MA 3LAKA 3QINA 1RDCA 3NFAA 3QNNA 4DMNA 4I2QA 3QERA 3KLIA 3OYLA 3KK2A 4UQGA 4AHSA 1NK8A 4M3TA 4HCCA 2HHUA 4ICLA 1JKHA 3D45A 3I0RA 3MAQA 3PO4A 5CZ1A 2KZMA 3KD1E 1U04A 2YNHA 4AH9A 3KLHA 3RMDA 1A5WA 1GOBA 2BDPA 1ASWA 4BE2A 3ALYA 4AILC 1VK0A 3CFRA 3V1RA 3OY9A 3V6DA 4M3YA 3G10A 3K5OA 1C1AA 4FJNA 1LW2A 1KFDA 1D5AA 4DFMA 2OPSA 3QIPA 1FKPA 2PY5A 3SUOA 3ZSXA 4M3WA 4CHNA 3P83D 1WSGA 4AHTA 4FLZA 4FLUA 1QTMA 1GOCA 2OPRA 4KREA 3L3UA 1K6YA 3V9SA 2OA8A 4CJPA 1LV5A 3AVAA 1FXXA 4H8KA 1UA1A 4DSKA 1WSFA 4IDKA 3KD5E 4B9VA 3M8PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HBM A;  4HUE A;  2G8U A;  2A1S A;  3F73 A;  3HXM A;  4FLX A;  3RRG A;  1NOZ A;  3CM6 A;  4NYN A;  4MFB A;  4PA1 A;  3RTV A;  4CFB A;  4DFJ A;  3T19 A;  3TAP A;  4N76 A;  4J2D A;  4CJL A;  3MEE A;  1X9W A;  4DQI A;  1HQU A;  3SPZ A;  3FFI A;  1KFS A;  4FJX A;  4CGF A;  3NH2 A;  4ELT A;  1RBU A;  3ZSR A;  3OS1 A;  4DFP A;  3RMC A;  3V4I A;  1WLJ A;  4N47 A;  5HRP A;  4FW2 A;  3SQ1 A;  2X74 A;  2IDO A;  1SKR A;  4I2P A;  1KTQ A;  3ZSO A;  3TWH A;  1L3V A;  1S6P A;  2X78 A;  3U3G A;  3S9H A;  4FM2 A;  4ELU A;  2HNZ A;  3THV A;  4WE1 A;  3O4N A;  3QEP A;  4NCG A;  3U3Y A;  3L8B A;  1VSH A;  1WAJ A;  3AO1 A;  3TAG A;  3HK2 A;  2X6S A;  1X9S A;  1XHX A;  1NJY A;  1NK9 A;  3KIO A;  4LSL A;  4BWJ A;  4N41 A;  3G0Z A;  2Z1J A;  3NH0 A;  1N6Q A;  3TAR A;  4GMJ B;  1SKS A;  1HNV A;  4OVL A;  1JLC A;  3VQ6 A;  1JLE A;  2WOM A;  3ZT4 A;  4OPK A;  3HVR A;  1IKX A;  3VQB A;  4JLH A;  1GOA A;  5C42 A;  4F3O A;  3MEG A;  2IAJ A;  3QLH A;  4CHO A;  3U6F A;  3ZSY A;  4CJV A;  2IOC A;  4DF4 A;  2BE2 A;  1KVC A;  4BE1 A;  4LH4 A;  5DK5 A;  1CXQ A;  4FLW A;  2A1R A;  1T05 A;  3T1A A;  1TKX A;  1UAX A;  3LP2 A;  4CK2 A;  3LZJ A;  1NKE A;  2HW3 A;  1RT5 A;  1VSI A;  4HUF A;  4CER A;  4Y1C A;  1RDD A;  1BIZ A;  1EX4 A;  3CFP A;  4AHR A;  4DQS A;  3EYZ A;  4O0I A;  2R7Y A;  1JL1 A;  3AVG A;  5KTQ A;  1O1W A;  4CJK A;  4W5Q A;  1BIS A;  2G8H A;  1KCF A;  3CG7 A;  5JS2 A;  4CK3 A;  1KRP A;  4CCH A;  1BL3 A;  5DMR A;  4FLY A;  3T3F A;  4KB0 A;  3NE6 A;  4ELV A;  3TAF A;  1XWL A;  2PZS A;  3EY1 A;  4CJ3 A;  1BI4 A;  3DLG A;  3JYT A;  2G8V A;  1W9H A;  2OZM A;  3QEX A;  3HO1 A;  4PY5 A;  4DSE A;  1FKO A;  4FJ5 A;  2VWK A;  3SZ2 A;  4CHZ A;  4W5N A;  4LD0 A;  2P5O A;  3LAN A;  4O4G A;  1X1P A;  5CYM A;  3HL8 A;  4OKE A;  1TK0 A;  4J2A A;  4Z4E A;  4CGG A;  4I7F A;  3PO5 A;  4CJF A;  2HHT A;  2HHX A;  4DTX A;  3NHG A;  4N56 A;  1NJZ A;  1B9D A;  3OS0 A;  3QO9 A;  3QES A;  4CJS A;  3OVN A;  1HRH A;  3RR8 A;  4E0D A;  3HM9 A;  2OYQ A;  2FC0 A;  3CM5 A;  3RMB A;  3RWU A;  4FYD A;  3VN5 A;  4FM1 A;  1UA0 A;  2PYJ A;  2ATQ A;  3AO3 A;  4FZX C;  4IG3 A;  3M8S A;  4FK2 A;  3ASM A;  2ZD1 A;  1U4B A;  1TL3 A;  2RPI A;  4B08 A;  3PY8 A;  1YVU A;  2D0B A;  4N5S A;  4EZ9 A;  3DMJ A;  1HQE A;  4BDZ A;  4CES A;  1B92 A;  2HVI A;  1ASU A;  1BGX T;  4F4K A;  4DSI A;  4QAG A;  3AVM A;  3DRP A;  3VQP A;  3WNF A;  4HTU A;  2BGG A;  1HYV A;  4IG0 A;  1S1V A;  1RDA A;  4Y1D A;  3L2V A;  2ITG A;  1UWB A;  3L2Q A;  1IH7 A;  1J53 A;  3EZ5 A;  3TAB A;  1U48 A;  1KSP A;  4Z4F A;  4JRP A;  4C8M A;  1NKC A;  3MXI A;  3DLE A;  4RW8 A;  4KHS A;  3OS2 A;  1C0M A;  4M41 A;  1S1W A;  4ZHR A;  3A2F A;  3O3F A;  1HNI A;  2DFH A;  5HRR A;  2YHA A;  2ZQB A;  4FJK A;  3NGI A;  5JS1 A;  4DTO A;  1RT4 A;  5FRO A;  4KHU A;  1I3A A;  1RIL A;  4AHC A;  4CFD A;  4FJ9 A;  1BQN A;  1HYZ A;  1TKT A;  5CYQ A;  1RTD A;  4C8L A;  3OYK A;  2HND A;  2D0C A;  4B9L A;  2NUB A;  4GW6 A;  3NGZ A;  4DTM A;  1UOC A;  3AO5 A;  4LH5 A;  3VQC A;  3KK1 A;  1NK7 A;  4CFC A;  4F2S A;  1DLO A;  1LAV A;  1QHT A;  1VRU A;  1EP4 A;  3S3N A;  3DOK A;  3ZT3 A;  3HP9 A;  1RBS A;  5E41 A;  1T03 A;  3C94 A;  4W5O A;  3O4Q A;  3VA0 A;  4KPY A;  3KLE A;  2QK9 A;  4B9U A;  4DTP A;  3KK3 A;  2BAN A;  4FJH A;  3ZT2 A;  4KHY A;  2FBV A;  2Z1I A;  4JS5 A;  2FBX A;  4OKJ A;  4RW7 A;  4CEA A;  3OYA A;  4JS4 A;  4B9N A;  1TGO A;  3NH1 A;  4DQQ A;  2HHS A;  3C95 A;  1JXE A;  4AHU A;  4IKF A;  4NCB A;  3L2U A;  4HUG A;  1CZ9 A;  1I39 A;  3LAL A;  1C0U A;  4DQP A;  1S9E A;  5D3G A;  4DTJ A;  1BCO A;  1BHL A;  4IFV A;  1TK5 A;  1QS4 A;  2QXF A;  3CQ8 A;  2P5G A;  2G8F A;  1FK9 A;  4EP5 A;  1L3S A;  4LSN A;  2D5R A;  3TAM A;  3F9K A;  3SV4 A;  1Q9Y A;  4KRF A;  3HPG A;  3TR8 A;  4DWI A;  4KHW A;  3AV9 A;  3WNG A;  3O3G A;  3SYZ A;  4CHP A;  5C25 A;  4EP4 A;  5KRS A;  2YHB A;  3OYC A;  3B6P A;  4AHV A;  4KAZ A;  4KI6 A;  1WNS A;  4FJL A;  4R5P A;  4M3Z A;  3BDP A;  4OJR A;  4CK1 A;  4DF8 A;  1BCM A;  1BIU A;  3IS9 A;  3KTQ A;  3CFO A;  2G8W A;  4HCB A;  3NF6 A;  2B6A A;  3ZSW A;  4KO0 A;  3JSM A;  1EKE A;  4L8R B;  4FZZ A;  4Z4I A;  3LPU A;  3PX4 A;  1RBR A;  4F8R A;  4OPJ A;  3L2R A;  2G8K A;  3SNN A;  2YNF A;  4DFK A;  1RCH A;  3AA2 A;  4E19 A;  5HRS A;  1TL1 A;  1HJR A;  5T7B A;  2KTQ A;  3L3V A;  1XHZ A;  3ZSV A;  4O55 A;  1SKW A;  1QQC A;  2OPQ A;  4CEC A;  3M8Q A;  4CGJ A;  4KB1 A;  3DM2 A;  3HPH A;  3LP3 A;  3PX6 A;  3TAN A;  4FLV A;  3AA4 A;  3QIO A;  5CZ2 A;  4ZTJ A;  1VSD A;  5K14 A;  3K59 A;  4DSF A;  3I8D A;  4KKO A;  1D9F A;  2F8T A;  4M45 A;  3B6O A;  3AVC A;  4M3U A;  2EX3 A;  2YNG A;  4Z4H A;  4H4O A;  2G8I A;  1A5V A;  1S6Q A;  2XY8 A;  3LAM A;  4CF8 A;  2GV9 A;  1VSJ A;  3V1O A;  4CGH A;  3HP6 A;  3ZSZ A;  3SUN A;  3SCX A;  1ZBL A;  3ZSQ A;  1XC9 A;  2O4G A;  1NKB A;  1VSL A;  3K5N A;  4YFU A;  2IC3 A;  3DLR A;  3MXJ A;  1BQM A;  4DU1 A;  2P1J A;  4XIU A;  3QNO A;  4E7J A;  3RMA A;  1S1X A;  4KV8 A;  3SQ2 A;  5HRO A;  2F8S A;  4OLB A;  3AA3 A;  3LWM A;  2YKM A;  2WON A;  5FRN A;  3AVK A;  5HLF A;  1RBV A;  1C6V A;  3KLG A;  4FXD A;  4J2B A;  4CE9 A;  1A5X A;  5SWM A;  3P5J A;  1RT1 A;  4DSL A;  4FJ7 A;  2KQ2 A;  4FJ8 A;  1WSH A;  5KI6 A;  3D0P A;  2XY7 A;  2O4I A;  4M42 A;  4Z4C A;  4DU3 A;  2FBT A;  3WNH A;  2RN2 A;  3AA5 X;  3HPO A;  3P1G A;  5SZT A;  3KLF A;  3PV8 A;  1NK0 A;  2B4J A;  4C8O A;  3AVH A;  2E6L A;  4CEE A;  2Y1J A;  4FK0 A;  3HT3 A;  3K5M A;  4O44 A;  3AO4 A;  3ULD A;  4KTQ A;  4NYF A;  4CGI A;  1JLQ A;  3HST B;  4DLE A;  2VG6 A;  3SUQ A;  3IRX A;  3DLK A;  4CJE A;  3RRH A;  2RKI A;  3OJU A;  4KHN A;  3OYG A;  1RTJ A;  1TV6 A;  4DU4 A;  1ZBF A;  2VG5 A;  4RW9 A;  1S5J A;  1ZBU A;  3KKS A;  1KLM A;  1RT3 A;  4DSJ A;  2DFE A;  4CHY A;  1KLN A;  4HHT A;  4E7I A;  3S3M A;  3DLB A;  1Z26 A;  4QCL A;  2GUI A;  2HVH A;  4DLG A;  3KKR A;  2YNI A;  1RT6 A;  1TAQ A;  3K2P A;  4G1Q A;  4B9T A;  3VQ9 A;  4F3T A;  2DY4 A;  2HHQ A;  1JL2 A;  1JXB A;  3VQA A;  3V9U A;  3AO2 A;  2HB5 A;  1CXU A;  1VSK A;  1WSJ A;  4YNQ A;  2XHB A;  4CF1 A;  1QSY A;  3I0S A;  1LWF A;  4ID1 A;  3NDK A;  4PUO A;  4PWD A;  1TAU A;  1WSI A;  3V81 A;  4BAC A;  4W5T A;  2P51 A;  2JLE A;  1CZB A;  1RDB A;  1BI4 B;  2X6N A;  2XRI A;  4I9Q A;  2VWJ A;  2RF2 A;  4CEZ A;  3OYN A;  3C6U A;  3TAE A;  5J2M A;  2QKK A;  3NGY A;  4FW1 A;  1RTH A;  2IGI A;  4KTW A;  3PX0 A;  2FBY A;  1J54 A;  1LWE A;  2E6M A;  4BE0 A;  4B8C A;  4B9M A;  2IS3 A;  3VQ8 A;  1U47 A;  3UIQ A;  3VQE A;  3VQQ A;  2YKN A;  3NF7 A;  1WSE A;  4FLT A;  1IKW A;  4FJG A;  1YTU A;  4DG1 A;  4BWM A;  1R0A A;  2DFF A;  1VSE A;  5J2N A;  4GVM A;  3K57 A;  5EU7 A;  1ASV A;  1TK8 A;  1YTA A;  3HYF A;  1VSM A;  1F21 A;  3H08 A;  4M3R A;  1VSF A;  1L3U A;  2KZZ A;  1QSL A;  4FK4 A;  3DLH A;  3MED A;  4IBN A;  3DI6 A;  3LWL A;  2F96 A;  3VQD A;  1HPZ A;  2ETJ A;  4CJ4 A;  1JLF A;  3DRS A;  3ISN C;  1Z25 A;  3AVB A;  2I5J A;  5HRN A;  3LDS A;  2W42 A;  3AVI A;  1IO2 A;  1TKZ A;  3IG1 A;  3OYJ A;  4B8A B;  2VG7 A;  1RBT A;  3ZT0 A;  3SQ0 A;  3CYM A;  3QET A;  2Y1I A;  5J1E A;  1IKY A;  1NK6 A;  1ZBI A;  3AVN A;  4OLA A;  3SV3 A;  4BDP A;  3AVL A;  4TSX A;  4DS5 A;  1SL2 A;  1B9F A;  1QE1 A;  1SUQ A;  3PUF A;  3VQ5 A;  4CFA A;  4CGD A;  4KI4 A;  4C8N A;  4Z4G A;  4CJT A;  1S9G A;  2D0A A;  4CJU A;  1RNH A;  4CEQ A;  3WNE A;  3QEW A;  1SL0 A;  3HJF A;  2GBZ A;  4CIG A;  5J2Q A;  4CF0 A;  1NOY A;  2Z1G A;  1X9M A;  1D9D A;  5CY4 A;  1SL1 A;  2KFN A;  1D8Y A;  4CEO A;  3SJJ A;  5C24 A;  2EHG A;  1ITG A;  5KRT A;  3LP1 A;  1IKV A;  3E01 A;  1EET A;  3L2W A;  4CF2 A;  3SPY A;  4CJW A;  4CIF A;  3LZI A;  1Q9X A;  4FZY A;  1MU2 A;  1HYS A;  1Y97 A;  2JGU A;  5FRM A;  3NAE A;  4RW6 A;  3DYA A;  1JLB A;  3OJS A;  3AVJ A;  3DRR A;  3LPT A;  4BDY A;  3QEV A;  4E1M A;  1J9A A;  4IFY A;  2KFZ A;  4KHQ A;  4OGC A;  1C1B A;  4O0J A;  3NCI A;  3LP0 A;  5KGX A;  3OYM A;  4W5R A;  4B3O A;  3OYI A;  1ZYQ A;  3O3H A;  1YT3 A;  4I9L A;  3ZT1 A;  5FDL A;  4CHQ A;  1KVA A;  4E7L A;  1C1C A;  4HVJ A;  3TAQ A;  4M3X A;  1LAW A;  4CJR A;  3OYB A;  4RW4 A;  3DOL A;  3V1Q A;  5J2P A;  1IG9 A;  5HP1 A;  4FJM A;  3VQ7 A;  3VQ4 A;  1Q8I A;  1N5Y A;  1WN7 A;  2OZS A;  3KJV A;  2AJQ A;  3SQ4 A;  3BGR A;  1RT2 A;  4LY7 A;  4FCY A;  1ZBH A;  1U49 A;  3SI6 A;  4NCA A;  5I42 A;  2HNY A;  4CEF A;  3MXM A;  4Q0B A;  4KTZ A;  4CIE A;  3SUP A;  2DTU A;  1NJW A;  2HHW A;  3C6T A;  4E3S A;  3QEI A;  1HMV A;  1S1T A;  1RT7 A;  2LSN A;  3MEC A;  4ID5 A;  1L3T A;  1DTQ A;  1TVR A;  1QSS A;  1RTI A;  1CLQ A;  4MQ3 A;  4FVM A;  2B5J A;  4O5B A;  3V9W A;  2XY6 A;  4QOZ B;  1EXQ A;  3S3O A;  1W0H A;  3ITH A;  4CF9 A;  4DTR A;  2XY5 A;  2YV0 X;  1T8E A;  4DQR A;  1JLG A;  1G15 A;  1TKD A;  3VA3 A;  4JRQ A;  2Q3S A;  3V9X A;  4FJI A;  4C8K A;  4E7K A;  4F2R A;  1XI1 A;  1WAF A;  4KFB A;  1U45 A;  1NK5 A;  2PYL A;  5I3U A;  3TI0 A;  1J5O A;  1SV5 A;  3NBP A;  3NF9 A;  2KW4 A;  4Z0U A;  4FM0 A;  4ZTF A;  4FJJ A;  4K8Z A;  1C0T A;  3K58 A;  2ZE2 A;  4B9S A;  3IAY A;  4E7H A;  2HHV A;  4K8X A;  1KVB A;  3OYF A;  1L5U A;  4DTU A;  2OPP A;  4CJQ A;  4DTN A;  3RR7 A;  1NJX A;  4PQU A;  3NF8 A;  4OKK A;  3M8R A;  3AVF A;  3K5L A;  1T7P A;  4CJ5 A;  1NK4 A;  4CEB A;  2QKB A;  2E4L A;  4E89 A;  1LWC A;  4CED A;  4Q5V A;  3V9Z A;  2HMI A;  3HVT A;  4RG8 A;  4J2E A;  4OGE A;  3ZCM A;  5KGW A;  1VRT A;  1DTT A;  3OYE A;  2XO7 A;  4DS4 A;  3OYH A;  1LW0 A;  4E1N A;  3OYD A;  1REV A;  1S1U A;  2Z1H A;  4EZ6 A;  4DTS A;  1JLA A;  4H4M A;  3LAK A;  3QIN A;  1RDC A;  3NFA A;  3QNN A;  4DMN A;  4I2Q A;  3QER A;  3KLI A;  3OYL A;  3KK2 A;  4UQG A;  4AHS A;  1NK8 A;  4M3T A;  4HCC A;  2HHU A;  4ICL A;  1JKH A;  3D45 A;  3I0R A;  3MAQ A;  3PO4 A;  5CZ1 A;  2KZM A;  3KD1 E;  1U04 A;  2YNH A;  4AH9 A;  3KLH A;  3RMD A;  1A5W A;  1GOB A;  2BDP A;  1ASW A;  4BE2 A;  3ALY A;  4AIL C;  1VK0 A;  3CFR A;  3V1R A;  3OY9 A;  3V6D A;  4M3Y A;  3G10 A;  3K5O A;  1C1A A;  4FJN A;  1LW2 A;  1KFD A;  1D5A A;  4DFM A;  2OPS A;  3QIP A;  1FKP A;  2PY5 A;  3SUO A;  3ZSX A;  4M3W A;  4CHN A;  3P83 D;  1WSG A;  4AHT A;  4FLZ A;  4FLU A;  1QTM A;  1GOC A;  2OPR A;  4KRE A;  3L3U A;  1K6Y A;  3V9S A;  2OA8 A;  4CJP A;  1LV5 A;  3AVA A;  1FXX A;  4H8K A;  1UA1 A;  4DSK A;  1WSF A;  4IDK A;  3KD5 E;  4B9V A;  3M8P A; 
#chains in the Genus database with same CATH topology
 5E26 A;  2P9I B;  4CFB A;  5E84 A;  4CJL A;  5AQH A;  3FFI A;  3UB5 A;  3NH2 A;  4ELT A;  2A40 A;  3OS1 A;  1WLJ A;  4N47 A;  3BF1 A;  5HRP A;  4YY3 K;  3SQ1 A;  4O8U A;  1SKR A;  2HBM A;  1S6P A;  3U3G A;  3THV A;  3LM2 A;  4WE1 A;  4CZE A;  4DKW A;  4PKG A;  1N8R O;  1VSH A;  3CER A;  3R3L A;  3FR0 A;  3TTF A;  5AQQ A;  3PLA A;  3KIO A;  4N41 A;  2E2P A;  2GWJ A;  4K42 A;  2GX9 A;  4Y0W A;  3TAR A;  4GMJ B;  5AQY A;  1JLE A;  3HVR A;  1IKX A;  1GOA A;  3MEG A;  2IAJ A;  1ATR A;  3ZSY A;  2BE2 A;  2J4R A;  4BE1 A;  5DK5 A;  5C2F A;  1CXQ A;  2A1R A;  3T1A A;  4CK2 A;  4Y1C A;  5BPM A;  3CFP A;  3EYZ A;  1YAG A;  5KTQ A;  3JAM O;  2VCP A;  3L4I A;  4DV0 K;  3CG7 A;  1QZ6 A;  4KB0 A;  5BR8 K;  1W9H A;  2QA4 N;  1W7A A;  4DSE A;  4H5W A;  4FJ5 A;  4AM6 A;  4CHZ A;  2HBL A;  1NGA A;  3I56 N;  2D0O A;  2QWL A;  4J8F A;  4I7F A;  1HPM A;  1GLJ O;  3VEN A;  1GLL O;  4CJS A;  1HRH A;  4FWS A;  3RWU A;  2NRZ A;  1T44 A;  4DV3 K;  2RPI A;  3ID8 A;  3PY8 A;  4EZ9 A;  1HQE A;  4CES A;  1ASU A;  1BGX T;  4DSI A;  4CZJ A;  4QAG A;  3VQP A;  2O8E B;  1YIJ N;  4IG0 A;  1OVQ A;  3D2F A;  3SK3 A;  3W0L A;  3L2V A;  3LDQ A;  1UWB A;  4B3T K;  3TAB A;  4JRP A;  4C8M A;  3OS2 A;  1S1W A;  3DXK B;  2YHA A;  4KHU A;  3HM8 A;  4BVP A;  1I3A A;  1T6C A;  4FJ9 A;  3H1Q A;  1VQ7 N;  1TKT A;  4C8L A;  2D0C A;  2GEL A;  4H0Y B;  4B9L A;  4GW6 A;  1UOC A;  3VQC A;  1Q86 O;  2P9K B;  4I6M B;  4F2S A;  3T69 A;  1IBM K;  1LAV A;  4BR2 A;  4GKK K;  3SBG A;  3HP9 A;  3C6A A;  3VTI A;  1T03 A;  4FJH A;  3A0I X;  4JS5 A;  2FBX A;  3ULE B;  4DQQ A;  1JXE A;  1Q7Y O;  4KBO A;  3L2U A;  1I39 A;  2V51 B;  4BR4 A;  1VQO N;  2CGL A;  5KQ8 A;  4IFV A;  1GLF O;  3GG4 A;  4KRF A;  4BRO A;  3O3G A;  2P9U A;  4PHT X;  5C25 A;  4UY8 O;  4BG9 A;  4ISF A;  4KAZ A;  4KI6 A;  2QWO A;  4M3Z A;  2W6K A;  3BDP A;  4CK1 A;  1BIU A;  1VQ9 N;  3IS9 A;  3CC4 N;  5GIO A;  1XMQ K;  3NF6 A;  2ZGY A;  2WFB A;  1EKE A;  5ELZ A;  3L2R A;  3SNN A;  4H5V A;  4IEE A;  3AA2 A;  4B3M K;  2UUB K;  2KTQ A;  1EO1 A;  3L3V A;  2ITM A;  3AAP A;  3HSC A;  3O1B A;  1HNZ K;  1W97 L;  4U67 L;  1QQC A;  4CGJ A;  3TAN A;  3PX6 A;  1SQK A;  3TTC A;  4WQ5 A;  2YHX A;  3AA4 A;  5CZ2 A;  3CCL N;  3TSQ A;  4M3U A;  2YNG A;  4Z4H A;  4H4O A;  2FF3 B;  3LAM A;  1NMD A;  2XY8 A;  2GV9 A;  1VSJ A;  3ZSZ A;  3SUN A;  1GLE G;  4H5N A;  4BGB A;  3MWP A;  3K5N A;  3MXJ A;  4E7J A;  3FZM A;  1BO5 O;  3IDH A;  2NZT A;  3LWM A;  3ATV A;  4YOV A;  4FXD A;  4CE9 A;  1A5X A;  2P9S A;  1WSH A;  2P9P A;  5KI6 A;  2XY7 A;  2O4I A;  5M1P A;  3AA5 X;  2B4J A;  2O8D A;  4C8O A;  2E6L A;  4FK0 A;  2KKZ A;  4O44 A;  3AO4 A;  4JKC A;  4NYF A;  4CGI A;  3SUQ A;  3H46 O;  4KHN A;  1RTJ A;  3K0S A;  1X9J A;  2V7Z A;  1ZBU A;  3KKS A;  3J7Y P;  4DSJ A;  1RT3 A;  3ENH A;  1WOQ A;  4CHY A;  1Z26 A;  4BQL A;  2I7P A;  1VQN N;  1RT6 A;  3K2P A;  4F3T A;  2HHQ A;  4JKG B;  3V9U A;  5GIN A;  4MLE A;  1WSJ A;  4YNQ A;  4CF1 A;  1LWF A;  3NDK A;  2Q0U A;  4FWQ A;  3SBT A;  4W5T A;  2P51 A;  3IMX A;  2JLE A;  4ISG A;  1W2B M;  5AQJ A;  1BI4 B;  5AQV A;  5AQU A;  3CCU N;  1QQN A;  2IGI A;  3VF4 A;  3PX0 A;  2FBY A;  1LWE A;  3LDL A;  1MDU B;  2IS3 A;  3M1F A;  3VQ8 A;  2YKN A;  3NF7 A;  1WSE A;  3N4Q A;  1LOT B;  1YTU A;  3CET A;  3EN9 A;  3DLL L;  4FK4 A;  3MED A;  4IBN A;  5EX5 A;  3LWL A;  3VQD A;  4CJ4 A;  3LDN A;  1JLF A;  2D4W A;  1Z25 A;  5LJW A;  5LJV A;  1TKZ A;  2E1Z A;  3ZT0 A;  4JAX A;  4BRN A;  3QET A;  2Y1I A;  2UU9 K;  4BRQ A;  5BN8 A;  1RDW X;  3AVL A;  4TSX A;  4PL7 A;  2QWN A;  3G4S N;  1BOT O;  1SL2 A;  4CFA A;  4LFC K;  3RSE B;  5C12 A;  2GBZ A;  4CIG A;  4CF0 A;  3AAQ A;  1NOY A;  2Z1G A;  1X9M A;  5C2D A;  5C10 A;  3SJH A;  1K9M O;  4LF9 K;  4CEO A;  1ITG A;  5KRT A;  3LP1 A;  1IKV A;  1SAZ A;  1EET A;  3L2W A;  3LDP A;  3LZI A;  4FZY A;  1HYS A;  2HST A;  2JGU A;  5AQM A;  2KFZ A;  2Q31 A;  4E1M A;  4O0J A;  4F9O A;  3O3H A;  1HKB A;  4I9L A;  1QZ5 A;  4WF9 L;  4DR5 K;  1U6Z A;  1ZC6 A;  4M3X A;  1U2V B;  4CJR A;  5AQG A;  4RW4 A;  1IG9 A;  5HP1 A;  4X65 K;  1Q8I A;  2VYP A;  3PSF A;  5AR0 A;  4BR5 A;  3SQ4 A;  3BGR A;  5AZI B;  1RT2 A;  3HRG A;  4YHH K;  4Q0B A;  2DTU A;  3CI5 A;  3QEI A;  1HLU A;  4ID5 A;  3CQY A;  1TVR A;  4FOI A;  4K0K K;  5KPR A;  2ZJP L;  3UKU A;  1CLQ A;  2XY6 A;  2XY5 A;  3ITH A;  5GIP A;  3THY A;  3V9X A;  1OVY A;  4GV6 A;  4WQ5 C;  3KZB A;  4H5T A;  4JKH A;  3C6H A;  2H3G X;  3TI0 A;  3NF9 A;  5AQT A;  2KW4 A;  2HHV A;  1QQM A;  3IAY A;  3OBY A;  3O8M A;  4DTU A;  4PQU A;  3O9Q A;  1NGJ A;  3K5L A;  1T7P A;  2OAN A;  3CJB A;  1NK4 A;  2NRV A;  4E89 A;  3CCJ N;  4JKF A;  4MO5 A;  4A59 A;  3CF5 L;  3V9Z A;  5B8H A;  4B1X B;  5M1N A;  4OGE A;  1DTT A;  1Y64 A;  1TYQ B;  3OYH A;  1S1U A;  4H4M A;  4YOY A;  3QIN A;  4BC5 A;  3CCS N;  3QER A;  4I2Q A;  2V52 B;  4AHS A;  1HX1 A;  1NK8 A;  5GAH P;  4HCC A;  4OPH A;  2KHO A;  2HHU A;  5AZJ B;  3WQT A;  2AP1 A;  1U04 A;  2YNH A;  1SS6 A;  1A5W A;  4BRH A;  4AIL C;  1Q82 O;  3OY9 A;  4IFE A;  5DM7 L;  3CIP A;  4FJN A;  1LW2 A;  4OX9 K;  5FPM A;  2O8F B;  3ZSX A;  3P83 D;  4FLU A;  1QTM A;  3L3U A;  4GY2 B;  1HNW K;  3PSI A;  3AVA A;  4WFN L;  1WSF A;  3KD5 E;  5AQP A;  3CXC M;  4HUE A;  2A5X A;  2G8U A;  3HXM A;  3MN7 A;  4IO8 A;  4FLX A;  3RRG A;  4FYD A;  3CM6 A;  4MFB A;  4DFJ A;  4Z94 A;  4DQI A;  3MEE A;  1X9W A;  3I8B A;  5ADX H;  3SPZ A;  4CBU A;  4DFP A;  2X74 A;  4I2P A;  3TWH A;  2ZJR L;  3S9H A;  5F1X A;  4JD2 A;  4FOE A;  2E2N A;  3U3Y A;  4K43 A;  3HOT A;  3HK2 A;  5BPL A;  4WQ4 A;  2X6S A;  1X9S A;  1XHX A;  1HKG A;  3O9S A;  3Q7C A;  2QXL A;  4JI2 K;  2WOM A;  3VQB A;  4FWR A;  5C42 A;  4F3O A;  3OW2 M;  4B1U B;  4CJV A;  3BEX A;  4DF4 A;  3H45 C;  5ADX A;  1T05 A;  3L0Q A;  1X3N A;  4FPB A;  3ID6 A;  3LZJ A;  4EFH A;  3DXM A;  2HW3 A;  3MCP A;  1BIZ A;  3W3D A;  4FVU A;  1GLD G;  4AHR A;  5EVZ A;  1KXP A;  1JCG A;  3D2E A;  3NMU A;  4CJK A;  3ZX0 A;  4DR3 K;  1KRP A;  1BL3 A;  2YX6 A;  3ZET B;  4B9Q A;  4ELV A;  1ATN A;  2QTD A;  4JHD A;  2G8V A;  1RGI A;  4W5N A;  2IVP A;  2P5O A;  4O4G A;  4YOX A;  1X1P A;  5CYM A;  3HL8 A;  1K8K B;  3QIC A;  1KC8 O;  4M7X A;  2Q36 A;  4Z4E A;  4CJF A;  2HHX A;  3OBW A;  1YJ9 N;  2F7T A;  3QO9 A;  3QES A;  5GAE P;  3HM9 A;  2OYQ A;  3RMB A;  1NGE A;  4BRA A;  4FM1 A;  3M6G A;  3M8S A;  3ASM A;  3GL1 A;  3J7Z O;  1NU0 A;  2D0B A;  3VER A;  4BDZ A;  1BWF O;  5FPN A;  3WNF A;  3AVM A;  2BGG A;  3MN6 A;  4BVO A;  1EQY A;  1IH7 A;  3A5N C;  3EZ5 A;  3O80 A;  1NKC A;  4RW8 A;  3OHR A;  4C1N I;  3EO3 A;  1C0M A;  1YVN A;  3QML A;  5CHI A;  4ZHR A;  3A2F A;  5TKY A;  3L4Q A;  3O3F A;  4HWI A;  3P38 A;  5HRR A;  2ZQB A;  1QQO A;  2PAV A;  4DTO A;  5FRO A;  3DWL A;  3KHY A;  4O5F A;  2HND A;  1OKJ A;  2NUB A;  3H3N O;  1VQK N;  1NBW A;  1MWK A;  1DLO A;  3WQU A;  1QHT A;  3QDK A;  4V19 S;  1RBS A;  3CCM N;  1NGB A;  5E41 A;  4KPY A;  3VA0 A;  2QK9 A;  4WFB L;  3LM9 A;  2HHS A;  3KWI A;  1TGO A;  3NH1 A;  4IEI A;  1CZ9 A;  4K41 A;  5HL7 L;  2PFU A;  4BRL A;  2E5L K;  2P5G A;  2P9N A;  2G8F A;  1L3S A;  5JLH A;  3F9K A;  5AQW A;  3A5L C;  1YF5 L;  1BA1 A;  3CJ1 A;  3SYZ A;  4CZH A;  3OYC A;  1WNS A;  4E1J A;  4OJR A;  1BCM A;  3CFO A;  4BR9 A;  3ZSW A;  4KO0 A;  4L8R B;  1XNR K;  4F8R A;  4CI6 A;  2FSN A;  1CZA N;  1TL1 A;  4FWK A;  2E8A A;  4O55 A;  4B1Z A;  4KH5 A;  5KPZ A;  4KB1 A;  2ASO A;  3DM2 A;  2O8C A;  3LP3 A;  3O4W A;  3QIO A;  1J5E K;  1D4X A;  2P9L B;  4WQ4 C;  1D9F A;  4KKO A;  2F8T A;  5KQD A;  3NVK A;  3AVC A;  2E2O A;  3CQX A;  4CGH A;  1BDG A;  3B8A X;  3ZSQ A;  1XC9 A;  2O4G A;  2UUC K;  1X3M A;  3VEZ A;  3DLR A;  3VEX A;  1BQM A;  4DU1 A;  2P1J A;  3QNO A;  4G9Z A;  4DCH A;  2E1Y A;  3AVK A;  3MMV A;  5HLF A;  1C6V A;  1O13 A;  3ZX2 A;  1RT1 A;  2GEM A;  2KQ2 A;  4O8K A;  2NNW A;  3WNH A;  3PV8 A;  2O8B A;  3HPO A;  3P1G A;  5SZT A;  3KLF A;  3C0B A;  3HT3 A;  3K5M A;  3ULD A;  4BY9 C;  1JLQ A;  4DLE A;  4DB3 A;  2VG6 A;  4NB4 A;  4QS8 A;  1R59 O;  4XH4 A;  3OYG A;  3KWG A;  2P9I A;  1TV6 A;  5FPE A;  1ZBF A;  4IJA A;  4DV4 K;  1TUU A;  3S3M A;  2GUI A;  3KKR A;  3C7N B;  1TAQ A;  2WC9 A;  4G1Q A;  4B9T A;  3AO2 A;  1GLB G;  2XHB A;  4JI5 K;  3I0S A;  4FO0 A;  2BH1 A;  4BAC A;  3UE5 A;  2FLO A;  3FZH A;  2X6N A;  4I9Q A;  1XQS C;  3R1X A;  4CEZ A;  2UYT A;  4FW1 A;  4X64 K;  1RTH A;  3U4L A;  4MDB A;  4DUY K;  4B8C A;  4B9M A;  1NNE A;  1U47 A;  3VQE A;  3J7A P;  4FLT A;  1IKW A;  4FJG A;  4BWM A;  2Q0R A;  3WEE B;  1VSE A;  3ZYY X;  4GVM A;  5TKW A;  5EU7 A;  3K57 A;  5C0Y A;  5AQK A;  4GV3 A;  2CH6 A;  3HYF A;  4GVE A;  2KZZ A;  2VQF K;  4XH1 A;  3DI6 A;  2F96 A;  1HPZ A;  1JCF A;  3DRS A;  4FWL A;  1QHA A;  2I5J A;  5HRN A;  2W42 A;  1IO2 A;  3VEW A;  3OYJ A;  4BRF A;  4KH6 A;  3VOV A;  3K9K A;  5J1E A;  1IKY A;  1NK6 A;  4OLA A;  4DV7 K;  4KI4 A;  1SUQ A;  1S72 N;  4LF5 K;  2A41 A;  4C8N A;  2D0A A;  4BC3 A;  5J2Q A;  1VQ6 N;  1D9D A;  2KFN A;  5LMU K;  5C24 A;  4BRM A;  3E01 A;  3P31 A;  3DRR A;  3LPT A;  4OGC A;  2CGJ A;  5BRD A;  5KGX A;  3OYM A;  1WB9 A;  1EWR A;  3OYI A;  5FDL A;  1G99 A;  4HVJ A;  1LAW A;  5BRE A;  3DOL A;  5J2P A;  4A57 A;  4FJM A;  3VQ4 A;  2O8E A;  1N5Y A;  1WN7 A;  2OZS A;  4LY7 A;  1ZBH A;  5DM6 L;  4FCY A;  3SI6 A;  4NCA A;  4CEF A;  4RTF D;  3SUP A;  2ASM A;  3N4P A;  1RT7 A;  2LSN A;  3DXK A;  1GLA G;  1KQS M;  1DTQ A;  3J8A A;  1RTI A;  4A61 A;  1QSS A;  4FVM A;  2B5J A;  4O5B A;  4QOZ B;  1EXQ A;  3WXM B;  1W0H A;  4DTR A;  2NLX A;  3R8E A;  4LC9 B;  2Q3S A;  4C8K A;  4C1N K;  4E7K A;  1VQP N;  4I6M A;  5AQR A;  4A5A A;  3A5O C;  1VQ8 N;  5I3U A;  5LMN K;  1IBK K;  1J5O A;  1BG3 A;  1SV5 A;  4FJJ A;  4Z0U A;  4FM0 A;  4ZTF A;  4K8Z A;  2ZE2 A;  4E7H A;  4K8X A;  1L5U A;  3ULE A;  1NLV A;  4CJQ A;  3R9P A;  4DTN A;  4BRD A;  4CJ5 A;  3O6W A;  1NM1 A;  1LWC A;  4DR6 K;  4CBW A;  2HMI A;  3HVT A;  4RG8 A;  1VRT A;  3OYE A;  1LW0 A;  2FSJ A;  1OH5 A;  4E1N A;  3OYD A;  1REV A;  5BN9 A;  3WT0 A;  3SAG A;  3QNN A;  3CC2 N;  4BR0 A;  4UQG A;  2VWB A;  3CPW M;  3R6M A;  1JKH A;  3PO4 A;  1JJ2 M;  2KZM A;  4AH9 A;  1GOB A;  5A2Q O;  4BE2 A;  1VK0 A;  4RWT A;  3HBT A;  3V1R A;  4NLC A;  3V6D A;  1M90 O;  3G10 A;  3CPE A;  3H3O B;  4QS7 A;  3TSU A;  1C1A A;  4DFM A;  2OPS A;  2PY5 A;  3SUO A;  4FLZ A;  1N36 K;  2OA8 A;  4JEP A;  4CJP A;  1LV5 A;  1FXX A;  3QBW A;  4H8K A;  4B9V A;  5AQO A;  3M8P A;  2OCE A;  5HBM A;  3WXI A;  3F73 A;  3BUZ B;  3TAP A;  4MO4 A;  1HQU A;  4BG8 A;  2QWP A;  3FLC O;  1KFS A;  1VQL N;  4FJX A;  3FZK A;  4CGF A;  4M7Y A;  4CZL A;  5C15 A;  1HUX A;  1KTQ A;  3ZSO A;  1L3V A;  5AJ3 K;  4FM2 A;  1YIT N;  4BC2 A;  3QEP A;  4NCG A;  3BZC A;  5JIC A;  2RHK A;  1WAJ A;  1NK9 A;  5GAD P;  2IIR A;  3P39 A;  4LSL A;  3G0Z A;  5LL6 Z;  2Z1J A;  3H1V X;  1SKS A;  3ATU A;  3VQ6 A;  4OVL A;  3CD6 N;  4CW7 B;  5EY4 A;  4IOA L;  1JCE A;  3T1H K;  2QW9 A;  3QLH A;  4CHO A;  1KVC A;  3OA9 A;  4FPA A;  3Q7B A;  3LL3 A;  4B1Y B;  4CBX A;  1N34 K;  2QWR A;  3PIP L;  1YXQ A;  1GLC G;  4XEI A;  3VTH A;  4JKG A;  3CC7 N;  1YI2 N;  4O0I A;  2R7Y A;  4OO1 J;  3AVG A;  2UXC K;  1BIS A;  4CCH A;  4CK3 A;  4FLY A;  3U9Z A;  3TAF A;  1XWL A;  4DV1 K;  1BI4 A;  3DLG A;  2OZM A;  5M1O A;  3QEX A;  4PY5 A;  4PL8 A;  1FKO A;  3SZ2 A;  4LD0 A;  1LCU A;  4BRK A;  3DAW A;  2W6L A;  3PO5 A;  3CCR N;  2HHT A;  4JD2 B;  4N56 A;  3NHG A;  1I94 K;  1NJZ A;  3OS0 A;  3OVN A;  4JI4 K;  3RR8 A;  4E0D A;  2FC0 A;  3CM5 A;  3VN5 A;  1UA0 A;  2KLA A;  4IG3 A;  4FZX C;  3QFP A;  2VGM A;  3VPZ A;  2ZD1 A;  1ZXO A;  1TL3 A;  3QBX A;  4B08 A;  1YVU A;  4N5S A;  3DMJ A;  1FJG K;  2HVI A;  4F4K A;  1M1K O;  4HTU A;  1S1V A;  3MN5 A;  5AQI A;  3G71 N;  3GBT A;  4EHT A;  2ITG A;  3DJC A;  3FZF A;  2YHW A;  2ZWH A;  5JMV A;  1KSP A;  4Z4F A;  3RSE A;  5EXW A;  3DLE A;  3MXI A;  4KHS A;  4M41 A;  1HNI A;  2DFH A;  5JS1 A;  1RT4 A;  3E9O A;  3RVC A;  4BR7 A;  1RIL A;  4AHC A;  1BQN A;  2A6A A;  4DQ8 A;  2AA4 A;  3OYK A;  3ZEU B;  3NGZ A;  3AO5 A;  4LH5 A;  4DR1 K;  3KK1 A;  1NK7 A;  1HNX K;  3O1W A;  1VRU A;  1EP4 A;  3DOK A;  3BZK A;  4W5O A;  3ENO A;  1U2V A;  2ASP A;  4B9U A;  4LFB K;  3ZT2 A;  2FBV A;  2Z1I A;  4OKJ A;  4PKH A;  4RW7 A;  1IV0 A;  4JS4 A;  4WFA L;  4M63 C;  5AQN A;  2HMP A;  3UKR B;  1Z05 A;  3D7E O;  4DQP A;  5D3G A;  4DTJ A;  1BHL A;  1QS4 A;  3CQ8 A;  5JVH L;  4RCH A;  1N33 K;  1FK9 A;  4EP5 A;  1OH8 A;  4LSN A;  2D5R A;  3TAM A;  1Q9Y A;  1Q81 O;  1IBL K;  3HPG A;  3TR8 A;  5KPT A;  4KHW A;  3AV9 A;  4B3R K;  1C0G A;  2FF6 A;  2HHH K;  5IWA K;  1WUA A;  2NRX A;  3F9M A;  5F0X A;  4DF8 A;  1TUY A;  4A2B A;  2G8W A;  4HCB A;  1BA0 A;  4KRE A;  3JSM A;  4FZZ A;  3PX4 A;  1RBR A;  5CE3 A;  1VQ5 N;  1FW6 A;  2YNF A;  2NRT A;  2E88 A;  4E19 A;  1HJR A;  2DPN A;  5T7B A;  1XHZ A;  3U9D A;  4KHP K;  4CEC A;  2OPQ A;  5IT9 O;  3HPH A;  1NGI A;  4FLV A;  4JKD A;  2FSK A;  4ZTJ A;  1VSD A;  5K14 A;  3AGR A;  3F5T A;  3HZ6 A;  2VGN A;  5M1Q A;  3B6O A;  2EX3 A;  2G8I A;  1S6Q A;  4CF8 A;  3HP6 A;  4FWP A;  1ZBL A;  2QWM A;  2IC3 A;  3H6E A;  4YFU A;  4H0V B;  5AZJ A;  4KV8 A;  3SQ2 A;  5HRO A;  4A2A A;  2F8S A;  4OLB A;  3AA3 A;  2YKM A;  2WON A;  1IJJ A;  1RBV A;  3KLG A;  5M1F A;  3P5J A;  4FJ7 A;  4FJ8 A;  1E3M A;  3EKU A;  4DU3 A;  2O8F A;  2FBT A;  4BRP A;  4JI1 K;  2FXU A;  3F2K A;  3WXK A;  3CCQ N;  3AVH A;  4CEE A;  5AQF A;  4KTQ A;  1WBB A;  3HST B;  1HR0 K;  3O9T A;  1Q18 A;  4CJE A;  2RKI A;  3OJU A;  2HF3 A;  4DU4 A;  4JKA A;  4RW9 A;  1S5J A;  2IVN A;  3KVG A;  1XUP O;  1KLN A;  2HVH A;  4B1V A;  3DLB A;  4QCL A;  2YNI A;  3CJ7 A;  4ILJ A;  2DY4 A;  4IWV A;  3VQ9 A;  4JKE A;  1JL2 A;  1JXB A;  4JN4 A;  2HB5 A;  1CXU A;  1VSK A;  1NG9 A;  4YOT A;  3V81 A;  3IUC A;  1CZB A;  4JI0 K;  3CJ9 A;  1RDB A;  4JNE A;  1KD1 O;  2VWJ A;  4A62 A;  2RF2 A;  3C6U A;  1MWM A;  3THW A;  4JI3 K;  4FL9 A;  5BRF A;  4LF6 K;  1J6Z A;  2A42 A;  2DFF A;  1ASV A;  1TK8 A;  4BRI A;  1YTA A;  1E4F T;  3A5M C;  3CCE N;  1VSM A;  1F21 A;  4M3R A;  4CD1 A;  5GAG P;  1L3U A;  2YJF A;  1QSL A;  2WTU A;  3ISN C;  3AVB A;  2WUS A;  3IG1 A;  4B8A B;  4H0O A;  3TPQ A;  1RBT A;  3E9L A;  3SQ0 A;  1NGG A;  3D2F B;  3ZET A;  3SV3 A;  4BDP A;  4FSV A;  4IZ9 A;  3VQ5 A;  4DS5 A;  3C65 A;  4Z4G A;  4CJU A;  1S9G A;  3SAH A;  3QEW A;  1SL0 A;  3VEO A;  2I7N A;  3HJF A;  5CY4 A;  5MLC Q;  1D8Y A;  1K8K A;  3SJJ A;  2EHG A;  1NGF A;  4GNI A;  2ZM6 K;  5JLF A;  2F4V K;  4CJW A;  1Q9X A;  1MU2 A;  4BQZ A;  5FRM A;  3M5R A;  1JLB A;  3OJS A;  3AVJ A;  3QEV A;  4IFY A;  1HJO A;  4W5R A;  3SAF A;  3THX A;  4NXN K;  1KVA A;  4E7L A;  3TAQ A;  3CMA N;  3TSP A;  3OYB A;  3LDO A;  3V1Q A;  3MK6 A;  3KJV A;  1NMN A;  1YHQ N;  1VQM N;  1NGC A;  5I42 A;  3MXM A;  4CIE A;  3IFR A;  4LFA K;  1NJW A;  2HHW A;  3MWT A;  3C6T A;  3BP8 A;  1WBD A;  1HMV A;  1S1T A;  5AFU H;  4BC4 A;  4YOU A;  1L3T A;  2JWK A;  2P9U B;  3V9W A;  4EAH D;  3S3O A;  3FFK B;  4CF9 A;  1ZBS A;  5H1S Q;  1JLG A;  1G15 A;  4DV5 K;  2D1K A;  1DGK N;  4FJI A;  3TU5 A;  1T3V A;  4YOW A;  3NBP A;  4DV2 K;  1C0T A;  3BY5 A;  2ZJQ L;  1KVB A;  3OYF A;  4JI7 K;  2OPP A;  1NJX A;  3NF8 A;  3SLC A;  2OTJ N;  4MDA A;  2QKB A;  2E4L A;  5CR4 A;  1HKC A;  5AFU A;  4Q5V A;  4CZF A;  4J2E A;  2XO7 A;  3CJA A;  4C23 A;  4EZ6 A;  2Z1H A;  3LAK A;  4JKB A;  3JS6 A;  3OYL A;  3KK2 A;  2QWQ A;  3EEQ A;  3JXU A;  4M3T A;  2NRH A;  3U8X A;  4ICL A;  3EE9 A;  4JV5 K;  3D45 A;  3I0R A;  4NLB A;  3MAQ A;  5CZ1 A;  5JVG L;  3T7Z A;  3ZLJ A;  5AQS A;  3CFR A;  3K5O A;  1BUP A;  4BGA A;  2P9S B;  2P9P B;  3QIP A;  1WSG A;  4K25 A;  2O8D B;  1GOC A;  2OPR A;  1K6Y A;  4B3S K;  4IOC L;  4DSK A;  1UA1 A;  2UUA K;  4IDK A;  1S22 A;  4YOR A;  4WCE L;  2A1S A;  4FWN A;  2HBJ A;  4AQY K;  1NOZ A;  2P9L A;  4NYN A;  4PA1 A;  3RTV A;  4N76 A;  3T19 A;  4J2D A;  1ILY A;  1RBU A;  3ZSR A;  3RMC A;  3V4I A;  4FW2 A;  3WUH A;  2IDO A;  3QFU A;  3AGK A;  2X78 A;  4ELU A;  2HNZ A;  4NO7 A;  5BPN A;  4IXC A;  5FPD A;  3O4N A;  3L8B A;  3AO1 A;  3TTD A;  1Z6R A;  5BR9 A;  3TAG A;  3GDQ A;  3CME N;  1NJY A;  4BWJ A;  3NVM A;  1KAX A;  4H5R A;  3VET A;  3NH0 A;  1N6Q A;  2NRW A;  1HNV A;  1JLC A;  4IO9 L;  3ZT4 A;  4OPK A;  3QB0 A;  4JLH A;  4A5B A;  3U6F A;  4X62 K;  2IOC A;  1K73 O;  3VF2 A;  4LH4 A;  4FLW A;  1V4S A;  4BRE A;  1TKX A;  1UAX A;  3LP2 A;  1IG8 A;  1NKE A;  1RT5 A;  1VSI A;  5M1K A;  4HUF A;  4CER A;  3C7N A;  1RDD A;  2OTL N;  1EX4 A;  4DQS A;  1V4T A;  1JL1 A;  4W5Q A;  1O1W A;  3O9U A;  4DHY A;  1KCF A;  2G8H A;  5JS2 A;  3L6Q A;  5DMR A;  3T3F A;  4AF1 A;  3VGM A;  3NE6 A;  1KAY A;  2PZS A;  3EY1 A;  4CJ3 A;  3HO1 A;  3JYT A;  2ZF5 O;  4MLH A;  4BRC A;  3VMF B;  2VWK A;  3I33 A;  2P9K A;  3LAN A;  4GV9 A;  3E9P A;  5I9E B;  4OKE A;  1TK0 A;  4DV6 K;  4J2A A;  4CGG A;  2JWL A;  4DTX A;  1B9D A;  3WEE A;  1P8Z A;  3VEV A;  3VGK A;  4LF8 K;  2PYJ A;  2ATQ A;  3AO3 A;  3I55 N;  4FK2 A;  1U4B A;  3VES A;  3CCV N;  3FZL A;  2CH5 A;  3EZW A;  3M3Z A;  1B92 A;  3EE8 A;  2D0P A;  3DRP A;  1HYV A;  4LF7 K;  1RDA A;  3CHW A;  4Y1D A;  4R79 A;  3L2Q A;  1J53 A;  1U48 A;  4FJK A;  3NGI A;  4QS9 A;  4CZK A;  3UKU B;  2RE2 A;  2IVO A;  4CFD A;  1HYZ A;  5CYQ A;  1RTD A;  1S3X A;  2F9T A;  1YUW A;  3THY B;  4DTM A;  4JI6 K;  4CFC A;  4CZG A;  3S3N A;  3ZT3 A;  1ESV A;  1NGD A;  3C94 A;  3O4Q A;  3S41 A;  3KLE A;  4DTP A;  3KK3 A;  2UXD K;  2BAN A;  4KHY A;  3FE1 A;  1C0F A;  4CEA A;  4B9N A;  3OYA A;  3C95 A;  4AHU A;  4IKF A;  4NCB A;  4HUG A;  1YJN N;  3LAL A;  2QEX N;  1C0U A;  2BUP A;  1S9E A;  1BCO A;  3MCA B;  4U7B A;  1TK5 A;  2QXF A;  3SV4 A;  4XH5 A;  4DWI A;  1NGH A;  3WNG A;  1YJW N;  1VAZ A;  4CHP A;  4EP4 A;  5KRS A;  2YHB A;  3B6P A;  4AHV A;  1K8A O;  4FJL A;  4R5P A;  3VEY A;  2VQE K;  2BTF A;  2E2Q A;  3HOS A;  4DUZ K;  1XMO K;  2A3Z A;  2WBN A;  3BF3 A;  3KTQ A;  4BRG A;  2B6A A;  1DT9 A;  4Z4I A;  3LPU A;  4JI8 K;  4OPJ A;  2G8K A;  2CGK A;  3ZX3 A;  3GOI A;  4X66 K;  5LY3 A;  1RCH A;  4DFK A;  3A8Y A;  5HRS A;  3ZSV A;  1SKW A;  3M8Q A;  1ATS A;  4DR4 K;  1BU6 O;  2UXB K;  1QVF M;  1RFQ A;  3K59 A;  4DSF A;  3I8D A;  4M45 A;  3EKS A;  4H0X B;  2HBK A;  4IOX A;  1A5V A;  3V1O A;  2GUP A;  1DKG D;  4AM7 A;  3SCX A;  1NKB A;  1VSL A;  4XIU A;  3RMA A;  1S1X A;  3SMP A;  4DR7 K;  5FRN A;  4J2B A;  5SWM A;  4DSL A;  4HTL A;  3D0P A;  4M42 A;  4Z4C A;  4L3Q A;  3G25 A;  4JK9 A;  2RN2 A;  1NWK A;  1NK0 A;  2Y1J A;  3PIO L;  2Q2R A;  2QI2 A;  3IRX A;  3DLK A;  3RRH A;  3D6R A;  2VG5 A;  2QM1 A;  1KLM A;  3J80 O;  4KH4 A;  1VHX A;  2DFE A;  4HHT A;  4E7I A;  4YDU A;  3DXM B;  4DLG A;  1XC3 A;  3VQA A;  3D2E B;  4JK7 A;  3WXJ A;  1QSY A;  4PUO A;  3E1Y A;  4ID1 A;  4PWD A;  1TAU A;  1WSI A;  3HTV A;  3AY9 A;  4JHD B;  2XRI A;  3O08 A;  3MX5 A;  3OYN A;  3TAE A;  5J2M A;  3MX2 A;  3P4I A;  2QKK A;  1XNQ K;  3NGY A;  4KTW A;  3VGL A;  1J54 A;  3E66 A;  2E6M A;  4BE0 A;  1N32 K;  3UIQ A;  5AQX A;  5BRH A;  3VQQ A;  4IJN A;  4DG1 A;  1DEJ A;  1R0A A;  5J2N A;  4NXM K;  5FLX O;  3MDQ A;  5AZI A;  3H08 A;  1VSF A;  3FGU A;  3DLH A;  5EOY A;  2ETJ A;  3LDS A;  3IKM A;  3AVI A;  5AQZ A;  3SMS A;  1MA9 B;  2VG7 A;  2W40 A;  2E20 A;  1ZBI A;  3CYM A;  3AVN A;  1OH7 A;  2YCH A;  1B9F A;  1QE1 A;  2YHY A;  3PUF A;  4CGD A;  4H0T B;  4CJT A;  1QVG M;  2NRR A;  1RNH A;  4B1W B;  3WNE A;  4CEQ A;  4WYB A;  1SL1 A;  3VF6 A;  3OTO K;  3SPY A;  4CF2 A;  4FWM A;  4CIF A;  4CZI A;  1Y97 A;  5HOO A;  3NAE A;  4RW6 A;  3DYA A;  4BDY A;  1J9A A;  5AQL A;  1OH6 A;  4KHQ A;  2ZGZ A;  1C1B A;  3NCI A;  3THW B;  3LP0 A;  2PBD A;  4B3O A;  1ZYQ A;  1YT3 A;  3G6E N;  3ZT1 A;  4GKJ K;  4CHQ A;  1C1C A;  3J81 O;  1TYQ A;  2Q97 A;  3VQ7 A;  2V7Y A;  3O9R A;  2AJQ A;  4LF4 K;  3HI0 A;  1U49 A;  5F2R A;  3K9J A;  2HNY A;  4EIA A;  3CJC A;  4KTZ A;  4IDH A;  4E3S A;  2GWK A;  2P9N B;  3MEC A;  2EWS A;  4ILG B;  4MQ3 A;  1H1V A;  4PKI A;  2YJE A;  3GE1 A;  1SZ2 A;  2YV0 X;  1RDU A;  1T8E A;  4DQR A;  1TKD A;  3ZEU A;  3VA3 A;  4JRQ A;  2HOE A;  4OPA A;  1NJI O;  3MN9 A;  4F2R A;  2F9W A;  1XI1 A;  1WAF A;  4KFB A;  1U45 A;  1NK5 A;  2PYL A;  4JYA K;  4EHU A;  3T1Y K;  3K58 A;  4B9S A;  4CZM A;  3RR7 A;  1VQ4 N;  4OKK A;  3M8R A;  3AVF A;  3UKR A;  3KK7 A;  4CEB A;  4CED A;  3THX B;  1P90 A;  2O8C B;  3ZCM A;  1EWQ A;  4FWO A;  5KGW A;  4DS4 A;  1KAZ A;  4CVN E;  2HF4 A;  4DTS A;  1JLA A;  1RDC A;  3NFA A;  4DMN A;  1T6D A;  3KLI A;  3O5B A;  4H0P A;  2Q1N A;  4ISE A;  4DR2 K;  3WXL A;  4JK8 A;  3ENB A;  2W41 A;  3KD1 E;  3KLH A;  3RMD A;  2BDP A;  4CJ7 A;  1ASW A;  3AAR A;  1E4G T;  3ALY A;  4H03 B;  4M3Y A;  2YI1 A;  4YDU C;  1KFD A;  1D5A A;  4ILH A;  4M3W A;  1FKP A;  2O8B B;  4CHN A;  4AHT A;  3EL2 A;  4CD3 A;  3V9S A;  2GTD A; 
#chains in the Genus database with same CATH homology
 5HBM A;  4HUE A;  2G8U A;  2A1S A;  3F73 A;  3HXM A;  4FLX A;  3RRG A;  1NOZ A;  3CM6 A;  4NYN A;  4MFB A;  4PA1 A;  3RTV A;  4CFB A;  4DFJ A;  3T19 A;  3TAP A;  4N76 A;  4J2D A;  4CJL A;  3MEE A;  1X9W A;  4DQI A;  1HQU A;  3SPZ A;  3FFI A;  1KFS A;  4FJX A;  4CGF A;  3NH2 A;  4ELT A;  1RBU A;  3ZSR A;  3OS1 A;  4DFP A;  3RMC A;  3V4I A;  1WLJ A;  4N47 A;  5HRP A;  4FW2 A;  3SQ1 A;  2X74 A;  2IDO A;  1SKR A;  4I2P A;  1KTQ A;  3ZSO A;  3TWH A;  1L3V A;  1S6P A;  2X78 A;  3U3G A;  3S9H A;  4FM2 A;  4ELU A;  2HNZ A;  3THV A;  4WE1 A;  3O4N A;  3QEP A;  4NCG A;  3U3Y A;  3L8B A;  1VSH A;  1WAJ A;  3AO1 A;  3TAG A;  3HK2 A;  2X6S A;  1X9S A;  1XHX A;  1NJY A;  1NK9 A;  3KIO A;  4LSL A;  4BWJ A;  4N41 A;  3G0Z A;  2Z1J A;  3NH0 A;  1N6Q A;  3TAR A;  4GMJ B;  1SKS A;  1HNV A;  4OVL A;  1JLC A;  3VQ6 A;  1JLE A;  2WOM A;  3ZT4 A;  4OPK A;  3HVR A;  1IKX A;  3VQB A;  4JLH A;  1GOA A;  5C42 A;  4F3O A;  3MEG A;  2IAJ A;  3QLH A;  4CHO A;  3U6F A;  3ZSY A;  4CJV A;  2IOC A;  4DF4 A;  2BE2 A;  1KVC A;  4BE1 A;  4LH4 A;  5DK5 A;  1CXQ A;  4FLW A;  2A1R A;  1T05 A;  3T1A A;  1TKX A;  1UAX A;  3LP2 A;  4CK2 A;  3LZJ A;  1NKE A;  2HW3 A;  1RT5 A;  1VSI A;  4HUF A;  4CER A;  4Y1C A;  1RDD A;  1BIZ A;  1EX4 A;  3CFP A;  4AHR A;  4DQS A;  3EYZ A;  4O0I A;  2R7Y A;  1JL1 A;  3AVG A;  5KTQ A;  1O1W A;  4CJK A;  4W5Q A;  1BIS A;  2G8H A;  1KCF A;  3CG7 A;  5JS2 A;  4CK3 A;  1KRP A;  4CCH A;  1BL3 A;  5DMR A;  4FLY A;  3T3F A;  4KB0 A;  3NE6 A;  4ELV A;  3TAF A;  1XWL A;  2PZS A;  3EY1 A;  4CJ3 A;  1BI4 A;  3DLG A;  3JYT A;  2G8V A;  1W9H A;  2OZM A;  3QEX A;  3HO1 A;  4PY5 A;  4DSE A;  1FKO A;  4FJ5 A;  2VWK A;  3SZ2 A;  4CHZ A;  4W5N A;  4LD0 A;  2P5O A;  3LAN A;  4O4G A;  1X1P A;  5CYM A;  3HL8 A;  4OKE A;  1TK0 A;  4J2A A;  4Z4E A;  4CGG A;  4I7F A;  3PO5 A;  4CJF A;  2HHT A;  2HHX A;  4DTX A;  3NHG A;  4N56 A;  1NJZ A;  1B9D A;  3OS0 A;  3QO9 A;  3QES A;  4CJS A;  3OVN A;  1HRH A;  3RR8 A;  4E0D A;  3HM9 A;  2OYQ A;  2FC0 A;  3CM5 A;  3RMB A;  3RWU A;  4FYD A;  3VN5 A;  4FM1 A;  1UA0 A;  2PYJ A;  2ATQ A;  3AO3 A;  4FZX C;  4IG3 A;  3M8S A;  4FK2 A;  3ASM A;  2ZD1 A;  1U4B A;  1TL3 A;  2RPI A;  4B08 A;  3PY8 A;  1YVU A;  2D0B A;  4N5S A;  4EZ9 A;  3DMJ A;  1HQE A;  4BDZ A;  4CES A;  1B92 A;  2HVI A;  1ASU A;  1BGX T;  4F4K A;  4DSI A;  4QAG A;  3AVM A;  3DRP A;  3VQP A;  3WNF A;  4HTU A;  2BGG A;  1HYV A;  4IG0 A;  1S1V A;  1RDA A;  4Y1D A;  3L2V A;  2ITG A;  1UWB A;  3L2Q A;  1IH7 A;  1J53 A;  3EZ5 A;  3TAB A;  1U48 A;  1KSP A;  4Z4F A;  4JRP A;  4C8M A;  1NKC A;  3MXI A;  3DLE A;  4RW8 A;  4KHS A;  3OS2 A;  1C0M A;  4M41 A;  1S1W A;  4ZHR A;  3A2F A;  3O3F A;  1HNI A;  2DFH A;  5HRR A;  2YHA A;  2ZQB A;  4FJK A;  3NGI A;  5JS1 A;  4DTO A;  1RT4 A;  5FRO A;  4KHU A;  1I3A A;  1RIL A;  4AHC A;  4CFD A;  4FJ9 A;  1BQN A;  1HYZ A;  1TKT A;  5CYQ A;  1RTD A;  4C8L A;  3OYK A;  2HND A;  2D0C A;  4B9L A;  2NUB A;  4GW6 A;  3NGZ A;  4DTM A;  1UOC A;  3AO5 A;  4LH5 A;  3VQC A;  3KK1 A;  1NK7 A;  4CFC A;  4F2S A;  1DLO A;  1LAV A;  1QHT A;  1VRU A;  1EP4 A;  3S3N A;  3DOK A;  3ZT3 A;  3HP9 A;  1RBS A;  5E41 A;  1T03 A;  3C94 A;  4W5O A;  3O4Q A;  3VA0 A;  4KPY A;  3KLE A;  2QK9 A;  4B9U A;  4DTP A;  3KK3 A;  2BAN A;  4FJH A;  3ZT2 A;  4KHY A;  2FBV A;  2Z1I A;  4JS5 A;  2FBX A;  4OKJ A;  4RW7 A;  4CEA A;  3OYA A;  4JS4 A;  4B9N A;  1TGO A;  3NH1 A;  4DQQ A;  2HHS A;  3C95 A;  1JXE A;  4AHU A;  4IKF A;  4NCB A;  3L2U A;  4HUG A;  1CZ9 A;  1I39 A;  3LAL A;  1C0U A;  4DQP A;  1S9E A;  5D3G A;  4DTJ A;  1BCO A;  1BHL A;  4IFV A;  1TK5 A;  1QS4 A;  2QXF A;  3CQ8 A;  2P5G A;  2G8F A;  1FK9 A;  4EP5 A;  1L3S A;  4LSN A;  2D5R A;  3TAM A;  3F9K A;  3SV4 A;  1Q9Y A;  4KRF A;  3HPG A;  3TR8 A;  4DWI A;  4KHW A;  3AV9 A;  3WNG A;  3O3G A;  3SYZ A;  4CHP A;  5C25 A;  4EP4 A;  5KRS A;  2YHB A;  3OYC A;  3B6P A;  4AHV A;  4KAZ A;  4KI6 A;  1WNS A;  4FJL A;  4R5P A;  4M3Z A;  3BDP A;  4OJR A;  4CK1 A;  4DF8 A;  1BCM A;  1BIU A;  3IS9 A;  3KTQ A;  3CFO A;  2G8W A;  4HCB A;  3NF6 A;  2B6A A;  3ZSW A;  4KO0 A;  3JSM A;  1EKE A;  4L8R B;  4FZZ A;  4Z4I A;  3LPU A;  3PX4 A;  1RBR A;  4F8R A;  4OPJ A;  3L2R A;  2G8K A;  3SNN A;  2YNF A;  4DFK A;  1RCH A;  3AA2 A;  4E19 A;  5HRS A;  1TL1 A;  1HJR A;  5T7B A;  2KTQ A;  3L3V A;  1XHZ A;  3ZSV A;  4O55 A;  1SKW A;  1QQC A;  2OPQ A;  4CEC A;  3M8Q A;  4CGJ A;  4KB1 A;  3DM2 A;  3HPH A;  3LP3 A;  3PX6 A;  3TAN A;  4FLV A;  3AA4 A;  3QIO A;  5CZ2 A;  4ZTJ A;  1VSD A;  5K14 A;  3K59 A;  4DSF A;  3I8D A;  4KKO A;  1D9F A;  2F8T A;  4M45 A;  3B6O A;  3AVC A;  4M3U A;  2EX3 A;  2YNG A;  4Z4H A;  4H4O A;  2G8I A;  1A5V A;  1S6Q A;  2XY8 A;  3LAM A;  4CF8 A;  2GV9 A;  1VSJ A;  3V1O A;  4CGH A;  3HP6 A;  3ZSZ A;  3SUN A;  3SCX A;  1ZBL A;  3ZSQ A;  1XC9 A;  2O4G A;  1NKB A;  1VSL A;  3K5N A;  4YFU A;  2IC3 A;  3DLR A;  3MXJ A;  1BQM A;  4DU1 A;  2P1J A;  4XIU A;  3QNO A;  4E7J A;  3RMA A;  1S1X A;  4KV8 A;  3SQ2 A;  5HRO A;  2F8S A;  4OLB A;  3AA3 A;  3LWM A;  2YKM A;  2WON A;  5FRN A;  3AVK A;  5HLF A;  1RBV A;  1C6V A;  3KLG A;  4FXD A;  4J2B A;  4CE9 A;  1A5X A;  5SWM A;  3P5J A;  1RT1 A;  4DSL A;  4FJ7 A;  2KQ2 A;  4FJ8 A;  1WSH A;  5KI6 A;  3D0P A;  2XY7 A;  2O4I A;  4M42 A;  4Z4C A;  4DU3 A;  2FBT A;  3WNH A;  2RN2 A;  3AA5 X;  3HPO A;  3P1G A;  5SZT A;  3KLF A;  3PV8 A;  1NK0 A;  2B4J A;  4C8O A;  3AVH A;  2E6L A;  4CEE A;  2Y1J A;  4FK0 A;  3HT3 A;  3K5M A;  4O44 A;  3AO4 A;  3ULD A;  4KTQ A;  4NYF A;  4CGI A;  1JLQ A;  3HST B;  4DLE A;  2VG6 A;  3SUQ A;  3IRX A;  3DLK A;  4CJE A;  3RRH A;  2RKI A;  3OJU A;  4KHN A;  3OYG A;  1RTJ A;  1TV6 A;  4DU4 A;  1ZBF A;  2VG5 A;  4RW9 A;  1S5J A;  1ZBU A;  3KKS A;  1KLM A;  1RT3 A;  4DSJ A;  2DFE A;  4CHY A;  1KLN A;  4HHT A;  4E7I A;  3S3M A;  3DLB A;  1Z26 A;  4QCL A;  2GUI A;  2HVH A;  4DLG A;  3KKR A;  2YNI A;  1RT6 A;  1TAQ A;  3K2P A;  4G1Q A;  4B9T A;  3VQ9 A;  4F3T A;  2DY4 A;  2HHQ A;  1JL2 A;  1JXB A;  3VQA A;  3V9U A;  3AO2 A;  2HB5 A;  1CXU A;  1VSK A;  1WSJ A;  4YNQ A;  2XHB A;  4CF1 A;  1QSY A;  3I0S A;  1LWF A;  4ID1 A;  3NDK A;  4PUO A;  4PWD A;  1TAU A;  1WSI A;  3V81 A;  4BAC A;  4W5T A;  2P51 A;  2JLE A;  1CZB A;  1RDB A;  1BI4 B;  2X6N A;  2XRI A;  4I9Q A;  2VWJ A;  2RF2 A;  4CEZ A;  3OYN A;  3C6U A;  3TAE A;  5J2M A;  2QKK A;  3NGY A;  4FW1 A;  1RTH A;  2IGI A;  4KTW A;  3PX0 A;  2FBY A;  1J54 A;  1LWE A;  2E6M A;  4BE0 A;  4B8C A;  4B9M A;  2IS3 A;  3VQ8 A;  1U47 A;  3UIQ A;  3VQE A;  3VQQ A;  2YKN A;  3NF7 A;  1WSE A;  4FLT A;  1IKW A;  4FJG A;  1YTU A;  4DG1 A;  4BWM A;  1R0A A;  2DFF A;  1VSE A;  5J2N A;  4GVM A;  3K57 A;  5EU7 A;  1ASV A;  1TK8 A;  1YTA A;  3HYF A;  1VSM A;  1F21 A;  3H08 A;  4M3R A;  1VSF A;  1L3U A;  2KZZ A;  1QSL A;  4FK4 A;  3DLH A;  3MED A;  4IBN A;  3DI6 A;  3LWL A;  2F96 A;  3VQD A;  1HPZ A;  2ETJ A;  4CJ4 A;  1JLF A;  3DRS A;  3ISN C;  1Z25 A;  3AVB A;  2I5J A;  5HRN A;  3LDS A;  2W42 A;  3AVI A;  1IO2 A;  1TKZ A;  3IG1 A;  3OYJ A;  4B8A B;  2VG7 A;  1RBT A;  3ZT0 A;  3SQ0 A;  3CYM A;  3QET A;  2Y1I A;  5J1E A;  1IKY A;  1NK6 A;  1ZBI A;  3AVN A;  4OLA A;  3SV3 A;  4BDP A;  3AVL A;  4TSX A;  4DS5 A;  1SL2 A;  1B9F A;  1QE1 A;  1SUQ A;  3PUF A;  3VQ5 A;  4CFA A;  4CGD A;  4KI4 A;  4C8N A;  4Z4G A;  4CJT A;  1S9G A;  2D0A A;  4CJU A;  1RNH A;  4CEQ A;  3WNE A;  3QEW A;  1SL0 A;  3HJF A;  2GBZ A;  4CIG A;  5J2Q A;  4CF0 A;  1NOY A;  2Z1G A;  1X9M A;  1D9D A;  5CY4 A;  1SL1 A;  2KFN A;  1D8Y A;  4CEO A;  3SJJ A;  5C24 A;  2EHG A;  1ITG A;  5KRT A;  3LP1 A;  1IKV A;  3E01 A;  1EET A;  3L2W A;  4CF2 A;  3SPY A;  4CJW A;  4CIF A;  3LZI A;  1Q9X A;  4FZY A;  1MU2 A;  1HYS A;  1Y97 A;  2JGU A;  5FRM A;  3NAE A;  4RW6 A;  3DYA A;  1JLB A;  3OJS A;  3AVJ A;  3DRR A;  3LPT A;  4BDY A;  3QEV A;  4E1M A;  1J9A A;  4IFY A;  2KFZ A;  4KHQ A;  4OGC A;  1C1B A;  4O0J A;  3NCI A;  3LP0 A;  5KGX A;  3OYM A;  4W5R A;  4B3O A;  3OYI A;  1ZYQ A;  3O3H A;  1YT3 A;  4I9L A;  3ZT1 A;  5FDL A;  4CHQ A;  1KVA A;  4E7L A;  1C1C A;  4HVJ A;  3TAQ A;  4M3X A;  1LAW A;  4CJR A;  3OYB A;  4RW4 A;  3DOL A;  3V1Q A;  5J2P A;  1IG9 A;  5HP1 A;  4FJM A;  3VQ7 A;  3VQ4 A;  1Q8I A;  1N5Y A;  1WN7 A;  2OZS A;  3KJV A;  2AJQ A;  3SQ4 A;  3BGR A;  1RT2 A;  4LY7 A;  4FCY A;  1ZBH A;  1U49 A;  3SI6 A;  4NCA A;  5I42 A;  2HNY A;  4CEF A;  3MXM A;  4Q0B A;  4KTZ A;  4CIE A;  3SUP A;  2DTU A;  1NJW A;  2HHW A;  3C6T A;  4E3S A;  3QEI A;  1HMV A;  1S1T A;  1RT7 A;  2LSN A;  3MEC A;  4ID5 A;  1L3T A;  1DTQ A;  1TVR A;  1QSS A;  1RTI A;  1CLQ A;  4MQ3 A;  4FVM A;  2B5J A;  4O5B A;  3V9W A;  2XY6 A;  4QOZ B;  1EXQ A;  3S3O A;  1W0H A;  3ITH A;  4CF9 A;  4DTR A;  2XY5 A;  2YV0 X;  1T8E A;  4DQR A;  1JLG A;  1G15 A;  1TKD A;  3VA3 A;  4JRQ A;  2Q3S A;  3V9X A;  4FJI A;  4C8K A;  4E7K A;  4F2R A;  1XI1 A;  1WAF A;  4KFB A;  1U45 A;  1NK5 A;  2PYL A;  5I3U A;  3TI0 A;  1J5O A;  1SV5 A;  3NBP A;  3NF9 A;  2KW4 A;  4Z0U A;  4FM0 A;  4ZTF A;  4FJJ A;  4K8Z A;  1C0T A;  3K58 A;  2ZE2 A;  4B9S A;  3IAY A;  4E7H A;  2HHV A;  4K8X A;  1KVB A;  3OYF A;  1L5U A;  4DTU A;  2OPP A;  4CJQ A;  4DTN A;  3RR7 A;  1NJX A;  4PQU A;  3NF8 A;  4OKK A;  3M8R A;  3AVF A;  3K5L A;  1T7P A;  4CJ5 A;  1NK4 A;  4CEB A;  2QKB A;  2E4L A;  4E89 A;  1LWC A;  4CED A;  4Q5V A;  3V9Z A;  2HMI A;  3HVT A;  4RG8 A;  4J2E A;  4OGE A;  3ZCM A;  5KGW A;  1VRT A;  1DTT A;  3OYE A;  2XO7 A;  4DS4 A;  3OYH A;  1LW0 A;  4E1N A;  3OYD A;  1REV A;  1S1U A;  2Z1H A;  4EZ6 A;  4DTS A;  1JLA A;  4H4M A;  3LAK A;  3QIN A;  1RDC A;  3NFA A;  3QNN A;  4DMN A;  4I2Q A;  3QER A;  3KLI A;  3OYL A;  3KK2 A;  4UQG A;  4AHS A;  1NK8 A;  4M3T A;  4HCC A;  2HHU A;  4ICL A;  1JKH A;  3D45 A;  3I0R A;  3MAQ A;  3PO4 A;  5CZ1 A;  2KZM A;  3KD1 E;  1U04 A;  2YNH A;  4AH9 A;  3KLH A;  3RMD A;  1A5W A;  1GOB A;  2BDP A;  1ASW A;  4BE2 A;  3ALY A;  4AIL C;  1VK0 A;  3CFR A;  3V1R A;  3OY9 A;  3V6D A;  4M3Y A;  3G10 A;  3K5O A;  1C1A A;  4FJN A;  1LW2 A;  1KFD A;  1D5A A;  4DFM A;  2OPS A;  3QIP A;  1FKP A;  2PY5 A;  3SUO A;  3ZSX A;  4M3W A;  4CHN A;  3P83 D;  1WSG A;  4AHT A;  4FLZ A;  4FLU A;  1QTM A;  1GOC A;  2OPR A;  4KRE A;  3L3U A;  1K6Y A;  3V9S A;  2OA8 A;  4CJP A;  1LV5 A;  3AVA A;  1FXX A;  4H8K A;  1UA1 A;  4DSK A;  1WSF A;  4IDK A;  3KD5 E;  4B9V A;  3M8P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...