1HZCA

Bacillus caldolyticus cold-shock protein mutants to study determinants of protein stability
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
66
structure length
66
Chain Sequence
MQEGKVKWFNNEKGYGFIEVEGGSDVFVHFTAIQGEGFKTLEEGQAVSFEIVQGNRGPQAANVVKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of mutant forms of the Bacillus caldolyticus cold shock protein differing in thermal stability.
pubmed doi rcsb
source organism Bacillus caldolyticus
molecule tags Transcription
molecule keywords COLD SHOCK PROTEIN CSPB
total genus 11
structure length 66
sequence length 66
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00313 CSD 'Cold-shock' DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1hzcA00
4A76A 4L5RC 2XTIA 1PVOA 1YJ9A 3CC2A 4YCVA 1PH1A 3TQYA 1NBWA 1A0IA 3BU2A 1K0RA 3L2PA 1IXRA 1YIJA 4B3RQ 1R9TH 1I6HH 1JT8A 4HIOA 1C9OA 2N8NA 4JI7Q 2OQKA 1YJWA 2UUBL 1VQ6A 1VQPA 4JI1L 3KOJA 3HKZE 2AWOA 3TREA 1N34Q 5C0XJ 2VQEQ 3ULLA 3PUYA 1MJCA 1PV4A 3JAMc 3U4VA 1HH2P 4YY3Q 4QIWE 4DV0Q 1LYLA 2JA6G 5GROA 2IHEA 2IY5B 1G291 1PH2A 3HOXG 3JC66 3K7UC 2C35B 4LF9Q 1HZBA 4JI8Q 1VQLA 3M3YH 1XMOL 1DGSA 2VS1A 5C3EH 4IFDG 4X6AH 1SROA 3I4MG 4R4QA 2E5LQ 2JEAI 5JJIA 2EQSA 3F1ZA 5JEAG 1V1QA 1AE2A 1PH7A 1JMCA 4LUVA 4EX5A 4DV5L 5ELNA 4JI7L 4QL5A 3KYHC 4GKJL 4PZ7A 1K9MC 1G51A 3BZCA 3FP9A 4DV3Q 3A0JA 3CCUA 3RZOH 3HFZB 3UE1A 4DR1L 1TWHH 4OWTB 5GQOA 1IYJB 2V1CC 4YY3L 3HOXH 3G4SA 3U4ZA 3AFPA 3UDFA 3OTOL 3F8TA 4HIDA 4LF4L 4A3LG 4BBRH 1EIFA 3TS0A 1QVGA 4PG3A 4GN3B 1K8GA 1U5KA 4YWMA 3PUXA 1CUKA 2RF4A 3GD7A 4R4CA 4LUOA 1SMXA 4DR2L 4GN4B 1VQ8A 2CQOA 4DV6Q 4JBMA 2JA7G 4OO1G 1XTDA 3GTPH 1NTGA 1OXXK 4O2DA 5IY0A 2CCZA 4A3DG 1KRTA 4UP9A 5IYCH 5IWAL 2VY3A 1XPRA 1IZ6A 3JAMi 4KLKA 1UE5A 3J81c 3H3VI 4DV4L 4GOPB 1M90C 4IFDI 4AH6A 1WCMH 2GVBA 3PO2H 4K0KL 2KBNA 3KF6A 2AKWB 4GN5A 4R1JA 4DK6C 5M3MG 3CCJA 3T1HQ 3S14H 3S2DH 5JJLA 1JJGA 3B6YA 2BH2A 2HIVA 3CCMA 4BY7G 3H15A 3ULPA 2JE6I 4B3SQ 4YHHL 5M5XH 1JJ2A 4BBSG 5H1SE 1BKBA 1YZ6A 2A1AA 1VS0A 3D31A 5C4JH 4QJFA 4X64Q 1Y1WG 1PH5A 2UUAL 5C44G 5M3FH 4GLXA 4DV7Q 3I7FA 1N8RC 2R93G 3RR5A 1L1OC 2UXCL 3EIVA 3GDEA 2L15A 5IYBH 1A63A 2BA0A 3ICEA 1CKOA 3CCQA 2JA7H 2UXBQ 3K0XA 3HOWG 3NELA 4XTCS 2YYZA 1WYDA 5FLMG 4OO1I 2PQAA 5DLQE 1B8AA 1YNXA 3MXNB 4TQUS 3RLNA 1UEBA 4OONA 1YITA 4B3RL 3NENA 1I3QH 4DUYL 1X55A 2JA8H 1WFQA 3PUZA 2IX0A 2JA9A 3ZJYC 3OW2A 4A3MH 1N36Q 3K81C 2PMZE 5M5WH 4LF5Q 1Q81C 2VUMH 1HNWL 1MKHA 4DAMA 1KC8C 3PUVA 2ZTDA 4A75A 2AMCB 2YU9H 4A3CG 4JI4Q 2F3IA 5IP9G 2VW9A 2KENA 4QQBX 1QVCA 1HZAA 4LF9L 1MJEA 2CWPA 3HKSA 3H3VH 5IYDG 1D7QA 3GTJH 3M9BA 4LFBQ 3CPFA 1NJIC 3AFQA 2WB1E 3RNUA 2DGYA 3UDIA 3GTKH 1NMFA 2HT1A 1XNQL 1XNRL 4JBJA 1BBWA 3RN5A 2ATWA 1RIPA 2VQFL 4FDBA 5JJKA 3I56A 1TWGH 1Z9FA 4DUYQ 3W5OA 3AYHB 2KHJA 1X3FA 4KHZA 4X62L 3T1YL 2I0QA 3TS2A 4A93H 2JK8A 1X56A 1YHBA 3CCLA 1JE5A 4DPGA 1N33L 4JI6L 3PV0A 4AQYQ 3I55A 2YTYA 1KL9A 1GVPA 2N49A 4JCVE 4MNOA 1HR0W 3M7NA 4A3IG 4JI1Q 1EYGA 1IBMQ 4YWKA 4PMWA 3UDXA 3BJUA 3PO3G 3J81i 5HY6A 4JI2Q 4NXMQ 1X9NA 4IPCA 4LW1A 4H02A 4UP7A 5GAEC 2B29A 4PZ6A 1KIXA 1GM5A 4NXNQ 1C0AA 3S1QH 2WAQE 2UU9Q 4WJ3M 2GVAA 1CKNB 1J6QA 3G6EA 5IYBG 4LF8L 3F2BA 3M4PA 3S2HH 1IBKL 1YI2A 1PH6A 3ERSX 4HIMA 5E7NA 1X3EA 4UPAA 4DUZL 4DK3C 3DM3A 3T1YQ 2NVYH 5LMUL 2FXQA 1E1TA 2WFWA 2CFMA 1YEZA 5ELOA 3WWVA 4A3KH 1YJNA 1QUQA 4QY7A 4EQ5A 4LF6L 2F4VL 1CSQA 3HKZG 5J3BA 4GOPA 2E5LL 1UE7A 1G6PA 4JBKA 1GO3E 3KDFA 4LFAQ 3D0FA 5IYCG 1Q1BA 5AJ3Q 1OXSC 3W1GA 3I2ZA 3HOVH 2HHHQ 3PF5A 2DUDA 3GTOH 1K8AC 2IHFA 4LNQA 1EOVA 4KHPQ 4GLVB 4DV3L 4B3SL 1PYSB 3PUWA 1E24A 5JEAJ 4X65Q 4A3KG 1XPOA 3CCVA 4POGA 1WCMG 3CD6A 3PO2G 3STBC 3J81j 4IFDJ 1AE3A 2E2HH 1VQMA 2OTLA 4YCWA 5HGQA 1XMQQ 1HNXL 4DR2Q 4A3JG 2K5VA 2EXDA 1X54A 4X66L 3G71A 5LMUQ 1EQRA 1VQDA 2WP8J 2KCMA 3PCOB 2H5XA 4DNIA 4JYAL 3OYYA 3AEVA 4JI5L 2NN6I 4IO9A 3NBHB 1Q12A 5C0XG 1WOCA 1VCIA 3S1RH 4BY1H 4P73A 1EWIA 2F52A 1PH8A 4C3IH 3RLFA 1EFWA 4HIKA 1HR0L 3CW2C 4A3MG 1Y14B 2K50A 3I4MH 1OXVA 3G48A 1S3OA 2K5HA 2I5LX 1PA6A 1SFOH 1PHJA 2UUCL 4Y7NH 1LTLA 1I94L 3TRZA 2LXKA 1FGUA 1C7YA 4LF5L 2K75A 2K52A 1NE3A 3CAMA 1X3GA 4YHHQ 2JA6H 4DR7L 4K0KQ 2UXDL 2ID0A 1KAWA 4X66Q 2IX1A 1Y1VH 5M5YH 1V9PA 3IRBA 4RG1A 1IBLL 4JI4L 3K7AH 1PFSA 2NVXH 1NMGA 5C4XH 4NXML 4A3DH 2YV5A 2VUMG 3HOYH 1SN8A 5LMNQ 4P71A 1BBUA 2E8GA 2Z6KC 4R4TA 4YCUA 3F2DA 4YWLA 3CMAA 1HNZQ 3W1BA 1Q46A 3I4OA 2VL6A 1PH3A 4B3ML 4IOAA 3HOYG 2VQFQ 1YHAA 2D62A 2ES2A 1PYBA 5C3EG 1IL2A 1VQCA 4UY8C 4P72A 1OXTA 2ALYB 3A74A 4AQYL 4A3FG 5BR8Q 3CC4A 4LFAL 2KCTA 2UXBL 3KF6B 3EBEA 5C0XI 4DV2L 2D0PA 5IP7H 2AWNA 4A3EH 1N32Q 4JC0A 1VQBA 5FJ8H 4NB3A 4KHPL 1Z47A 3J80i 3BZKA 1Y1WH 2NVQH 1I5FA 1V43A 4DR4L 3I4NH 4BA2I 1VQ7A 2MO1A 5FLXc 1N36L 2Z0SA 1MIUA 1SR3A 1K83H 1VQHA 4XIGS 1TXYA 3KLWA 2B63H 4GKKL 4POFA 1FJGL 1HNWQ 3LGJA 1E7ZA 3NEMA 4R4IA 4BBSH 4IPHA 4IPDA 3CQZH 1GD7A 4JYAQ 4BA1I 2OWOA 5LMNW 4LF7L 1L1OA 2UUAQ 2RHQB 1X6OA 1I50H 1ASYA 2PNHA 2ZM6Q 4ME3A 3H0GG 3HOUH 2PQAB 1VQAA 2EIFA 4L5QA 2R6GA 1N33Q 1W2BA 4DV1L 1VQ5A 4OX9Q 2QEXA 2A19A 1RL2A 5AJ3L 4X62Q 1XNRQ 4P74A 1Q82C 3S15H 1LUZA 2CKZB 2OCEA 1I94Q 1BVSA 1TWFH 3GTQH 3PO3H 2XGTA 4Y52H 4B3TL 2N3SA 3J7ZC 1S72A 1X65A 4X65L 2A8VA 3HOZG 1AH9A 2HQLA 2JEBI 1VQFA 2Y0SE 3S1NH 2OQ0A 4JI2L 2JJQA 1L0WA 4C2MH 2PI2A 2VNUD 1E22A 4JI0Q 1XPUA 3E9IA 3STBD 2KHIA 4DR5L 2Q2IA 4IJLA 4BBRG 1KD1C 1SRUA 4GLAC 1KQSA 2E2IH 2AHOB 2UU9L 4A3IH 1HZCA 2NZHA 4DV5Q 1J5EL 5IT9c 5GAHC 4DR3L 3CC7A 1UE1A 4QGUA 4JV5L 2F4VQ 2I5HA 1E3PA 5BR8L 5IE8A 5GADC 1EIYB 5C4XG 4DV2Q 4LF6Q 4A93G 1KXLA 3L0OA 1A8VA 3A5UA 4DR1Q 1JJCB 1P8LA 4RMFA 3E0EA 1GKHA 2NZOA 2B3GA 4JI6Q 2K5NA 2MQHA 3S17H 4DR4Q 1UE6A 1VQKA 4DR7Q 1L2FA 1YBYA 2MO0A 5FLMH 1QZHA 4PZ8A 1TWCH 3HOWH 1VQOA 3GTGH 4JBWA 4MTNA 4GNXB 4IOCA 1YHQA 2Q2HA 1S40A 2R7DA 1NY4A 4DV6L 4AYBE 1CKNA 4A3CH 5LMNL 4A3GH 4JI5Q 2E2JH 3HOZH 2IT1A 3M4OH 1N9WA 2I5MX 1XMQL 1HNXQ 3CXCA 2ZJRA 1HNZL 4LF8Q 4R4OA 2Y0SG 4JI3L 1IBKQ 4OWWB 5K36G 1O7IA 2D0OA 1OTCA 2JA8G 4BXXG 1QUQB 3CCSA 2BA1A 1XMOQ 2Z6KA 3SGIA 3U50C 3F2CA 1H95A 4BY7H 2VZAA 3E9HA 3KDFB 3M4QA 4GKJQ 4A3BH 3KJOA 1HR0Q 2NN6G 3CP0A 1VQGA 1U0LA 3KF8B 4LWCA 3FKIH 2WB1G 4P75A 3PSIA 3OTOQ 1JB7A 4A3GG 4B3TQ 4APVA 4DR6L 3H0GH 3HOUG 2YTXA 1WI5A 3A5ZB 4MZ9A 4UP8A 4HJAA 1N34L 3CF5A 3HOVG 1TWAH 3ER0A 2UUBQ 1B70B 1W3SA 4JOIA 2N78A 5M3MH 4IJHA 4LFCL 1IBLQ 1FVIA 4BXXH 4GKKQ 1EQQA 5GAGC 2ASBA 4A3BG 1CSPA 4LUZA 4HJ8A 1PH9A 3ULJA 4DR5Q 1QVFA 3AQQA 4LF7Q 2MNAA 1WJJA 3K8AA 1D8LA 2R7FA 1A62A 4L5SA 4DV1Q 4JI8L 1VQ9A 4OX9L 4AYBG 3S24A 3J7A5 4A3FH 1CKMA 1SE8A 3EN2A 3MEFA 1HZ9A 2ZTEA 4NPSA 5IWAQ 3Q8DA 2QA4A 4GNXC 1QZGA 4A4IA 2MFIA 1Y1VG 2R92G 4O0AA 5FJ8G 1VQNA 1FL0A 1LM0A 3PIPA 4OXPA 5IP7G 2BH8A 3DLLA 4L5TA 4GOPC 4A3EG 2R7ZG 4A3LH 3RN2A 2UUCQ 3U58A 2PI2E 4WJ4A 2Q2UA 4LFCQ 4DKAC 3S1MH 1PH4A 5IYDH 2UXDQ 4HJ9A 3KFUA 3CMEA 4LF4Q 2ZJPA 2OTJA 4JI0L 1VQJA 4X64L 1Q7YC 1Q8KA 2GN5A 4JG2A 3VDYA 2R7ZH 2K14A 3CCRA 2RCNA 1VQIA 2R92H 1XJVA 4DV7L 1FJGQ 3L7ZC 4B3MQ 3S16H 1EUJA 2JQOA 3RLOA 4C3HH 4JV5Q 3M85A 1J5EQ 5IP9H 3CPWA 1P16A 3GO5A 4JOIC 4TVAB 4DR3Q 1SLJA 1Q86C 1Q1EA 3PIOA 4DV4Q 1VQEA 3FKIG 4AIMA 1IBML 2LSSA 2CWAA 3CCEA 1HJPA 1N32L 3T1HL 1VQ4A 3RZDH 4GS3A 4KI0A 3TEHB 4DR6Q 3FHWA 5C44H 5M3FG 4ALPA 2R93H 4NXNL 3GTLH 2QGQA 1M1KC 4A3JH 3K80C 4LFBL 4BY1G 1K73C 4GNXA 2Q2TA 1K3RA 1UWVA 4IPGA 3I4NG 1XNQQ 4DUZQ 3GTMH 2VQEL 1YVCA 4OWXB 4HJ5A 3PF4A 2K4KA 1L1OB 4J15A 4C3JH 1ASZA 2LXJA 2JA5G 3UE0A 1KRSA 4DV0L 1B7YB 1E1OA 1T9HA 2RHSB 2ZTCA 3PGZA 4DAYB 2JA5H 1KHIA 4JI3Q 2B63G 1OXUA 2YTVA 2NVTH 3KJPA 2ZJQA 2UXCQ 3J80c 2HIXA 5EAYA 2WAQG 2ZM6L 4HJ7A 2HHHL 3UDGA
chains in the Genus database with same CATH superfamily
1GUTA 1YJ9A 5IOCA 1PH1A 4BBSB 3BDCA 1TWGB 2OQKA 2UUBL 4A93B 4JI1L 3KOJA 3ND9A 5C0XJ 3Q23A 3ULLA 2F0DA 5HGTA 3U4VA 3DUZA 5KNCA 4QIWE 5GROA 2IHEA 1FGBD 1G291 5G3LD 4J1MA 5C3XA 2C35B 4LF9Q 3M3YH 3TZDA 1DGSA 5C3EH 1ICFB 5EPLA 4G7OC 1SROA 1ESFA 1U4LA 5M5WB 4CKBA 1AE2A 5IGFA 1W6JA 1G51A 3FP9A 3HS0C 2NVYB 3MVVA 4WRDA 3DXJC 3E5SA 1SNQA 3HFZB 1IYJB 4YY3L 4LF4L 5CV9A 3AFPA 4HIDA 3F8TA 3TS0A 4PG3A 1B9MA 4GN3B 4H44C 5FO9B 4YWMA 1CUKA 5NUCA 2CH4A 2JA7G 4V0BA 4DR2L 4GN4B 1ENAA 4DV6Q 4JBMA 3HOVB 4QUFA 1XTDA 1RTOA 1NTGA 4ZK9B 2CCZA 1KRTA 5IWAL 1OO9B 1XPRA 4RAUC 3EVQA 1O80A 1SDFA 2YU9B 3I91A 1M90C 4MIUA 3SK8A 4AH6A 3PO2H 1YNJD 5M3MG 1SNMA 2AKWB 4DK6C 3S14H 1JJGA 2PZTA 2D5DA 1KDCA 4BY7G 5A2QE 1K0SA 2N55A 1LTAD 5FK9C 1GHKA 1HXYD 1TKWB 1BKBA 1ONLA 1PH5A 2CH4W 2UUAL 5C44G 2FMMA 5M5YB 2IJ0A 1A63A 5IYBH 3SK4A 1IYVA 1F9QA 4C2MB 5E1FA 4C1NK 4OONA 2KEEA 2EOTA 3HOYG 3CRKC 1Q81C 1CHPD 1KC8C 2F0HA 2XWJB 4PMCA 1I50B 1HRJA 4A3CG 1SEBD 2Q8IB 2VW9A 4QQBX 1PXUA 3GTJH 4PV1C 2EDGA 4ULLA 1NJIC 1KDAA 4FF1A 2Z4HA 1NMFA 3I4NB 1XNQL 1XNRL 4JBJA 2ATWA 1A2TA 5CV8A 1HUMA 2KHJA 3AYHB 2KOLA 4X62L 3J80E 1N33L 3PV0A 1R4PB 1X3PA 2PO4A 1GVPA 2N49A 1RF2D 5CGKA 4YWKA 2B2UA 3BJUA 3PO3G 2AUKA 4JPBW 2ZXOA 2A73B 1GM5A 4NXNQ 2KHSA 2WAQE 1CKNB 4G57A 4Y7NB 3G6EA 1CFMA 3F2BA 4IUVA 1TT2A 4KY6A 2EJGC 3WWVA 1WTOA 2WFWA 2CFMA 4LF6L 1QUQA 3HKZG 5J3BA 1UE7A 4OHJA 4JBKA 1G6PA 1GO3E 4LFAQ 1EWCA 3D0FA 5IYCG 1Q1BA 2EYOA 3I2ZA 2HHHQ 2DUDA 2XIWA 3GTOH 5CORA 1EOVA 5EBCA 4DV3L 4B3SL 4A3KG 3PUWA 2F03A 1EEID 1WTVA 3STBC 3OPOA 4K6LA 1AFPA 4K5WA 4YCWA 1HNXL 4A3JG 1STAA 3G71A 4C3IB 1VQDA 1VDZA 2KJXA 2WP8J 2KCMA 3H0GB 3PCOB 4FVMA 4JYAL 4JI5L 1F9PA 4IO9A 3TP7A 1JOOA 4KJOA 1WOCA 1VCIA 5EGTA 4ZYSA 1PH8A 3BVZA 1EFWA 3I4MH 3M4OB 2K50A 1AW7A 4RCOA 2K5HA 1NR4A 4F88A 1SFOH 4K8JA 4X3KA 4LF5L 3CRLC 3CAMA 1X3GA 4EQNA 4K0KQ 1ET6A 3LX0A 4X66Q 1Y1VH 1IBLL 4NXML 3K7AH 1NMGA 1GUNA 4XYQA 3NQIA 4IUUA 4HR7B 1LT6D 2ICEC 4YCUA 3TP5A 5ELEA 1B9NA 4RGOS 4HTHA 1TR5A 2VQFQ 5JJZA 5C4XB 2LY7A 3EQLC 1PYBA 1JR0D 1VQCA 3RD4A 4A3FG 1WTQA 3EROA 2QCPX 3M7GA 4A3EH 1STNA 1WD0A 1TQOA 2B2YC 1N32Q 4ZUJA 1Z47A 1Y1WH 1I5FA 1DD2A 1VQ7A 3I3CA 2MGSA 3HEJA 4CDEC 1NUCA 2DN8A 2M00A 2G5DA 1RD9D 3GTOB 3PO2B 1E7ZA 2K5QA 4BBSH 4IPHA 4JYAQ 4C1NI 1GD7A 5LMNW 2FJ2A 2UUAQ 1X6OA 4LJZC 4ME3A 1W2BA 4ZQ3A 1JWSD 2EPBA 1Y8PB 1I94Q 2NWGA 4BY1B 1TWFH 3KUPA 4Y52H 4B3TL 2N3SA 1GXDC 3DEPA 3HOZG 1FNVA 1MSHA 4A3IB 2K33A 3GTQB 3PO3B 1XPUA 1HFGA 4IJLA 2A5HA 1SRUA 2B2TC 4GLAC 3NBHA 2E2IH 2AHOB 1HZCA 3OMGA 1I6HB 1DOLA 5IT9c 5CC4A 3EA6A 2G9HD 4QGUA 1H9MA 1E3PA 3E0JA 4RHSA 4LF6Q 4JW0A 1A8VA 3A5UA 1JJCB 2H4OA 3HKZB 2NZOA 2B3GA 1O7ZA 2A74C 4RHRA 3Q24A 2K5NA 4DNRB 1L2FA 1YBYA 1PZID 1QZHA 2A69D 3D4DA 4PZ8A 1TWCH 3P75A 4JBWA 4MTNA 4MHEA 1YHQA 4A3KB 1NY4A 4DV6L 1Q3LA 1TS3A 3BVMA 5T1IA 4N9TA 4DK0A 3I72A 1DM0B 1N9WA 2I5MX 5KNBA 1PFMA 2Y0SG 2DY8A 5FLXL 5K36G 3J7AV 1K83B 1CI3M 1FR3A 3SGIA 2XRQD 3F2CA 5EPKA 2VZAA 1ZEQX 1TWAB 1Z7TA 2BE5D 1SYFA 2NN6G 4P75A 1KDBA 1YNNC 4B3TQ 4APVA 3U9OA 2NTSA 3V2TA 3MXUA 1ET9A 1GUOA 4IJHA 4LFCL 1D5XC 1I6VC 5AFWA 1G8ZD 1GOZA 4GKKQ 3DWPA 2ASBA 2A69C 4HJ8A 1PH9A 2EVBA 3IFTA 4QMGA 4JI8L 3S24A 1PTOF 4OO1I 1KLUD 1HZ9A 2ZTEA 5M9OA 2RDGA 5ELFA 1Q90A 5FJ8G 3BVGA 1FNUA 1VQNA 1FL0A 4OXPA 5IP7G 4GOPC 2LS01 3U58A 4A3FB 5J39A 4DKAC 3S1MH 2I46A 1QNKA 2K03A 1LTSD 3KFUA 3BYTB 3QOJA 3VDYA 2K14A 2RCNA 1RDPD 3SEBA 2V4DA 1BCPC 3R3OA 3SXHA 4ZKCB 1B3QA 3S1QB 1RJTA 1SLJA 4CDCC 1K8OA 1IKMA 4DV4Q 2PNRC 2A68D 2CWAA 4FXGC 1TS4A 1HJPA 2L4NA 1CK1A 3RZDH 4DR6Q 2HDMA 5M3FG 2JA7B 3GTLH 2HDLA 1HTLD 4A3JH 3K80C 4HCEA 4BY1G 3S15B 3T13A 1E2ZA 4C3JG 2CW0D 1NCVA 1XNQQ 5CR3A 2VQEL 4OWXB 2D2CC 4C3JH 2LXJA 3A7LA 1KRSA 1DXMA 2ZTCA 1T9HA 3PGZA 1I4GA 1OXUA 2UXCQ 3KBXA 1H9RA 4X3SA 2ZM6L 4M1UB 4L5RC 4IQZA 2XTIA 3QR8A 1PVOA 2Z9HA 3CC2A 1HA6A 5T1GA 4Q5VA 3L2PA 1IYUA 4I65A 4B3RQ 1R9TH 5I9OA 2R92B 2EY6A 5JAVA 1SXTA 5J1ZA 1BO0A 1TVXA 3S2DB 4YY3Q 1S5CD 1LYLA 2JA6G 1EY7A 1BOSA 2NBFA 3HOXG 3K7UC 4MN3A 4JI8Q 1VQLA 1G2SA 2P5ZX 2VS1A 4CHTB 1HHVA 3C1EA 2E5LQ 2JEAI 3F1ZA 5D14A 1V1QA 4EX5A 5FKAC 2JSOA 1K9MC 3M3YB 3BZCA 3A0JA 4DR1L 1TWHH 2PQEA 4OWTB 5GQOA 3BDOA 1LV9A 4BBRH 1EIFA 3NPPA 2WB1B 4DXFA 2EYJA 3PUXA 1T5EA 4R4CA 1DCZA 5IT9E 4J6HA 3X3NA 5EPJA 2B39A 3OWEB 3P1HA 5F2DA 3JAMi 3T16A 1G6ZA 4IFDI 1H9JA 3KF6A 4R1JA 3CCJA 2F0TA 2XN9C 1HUNA 3CCMA 3QO2A 3ULPA 4FYDA 3K5LA 2JE6I 2WINB 4A3EB 4BBSG 5H1SE 1VS0A 1F77A 4QJFA 1Y1WG 5M3FH 4GLXA 2K05A 4KKTA 1ZYRC 4B9WA 3GDEA 3CCQA 4ILWA 3HOWG 1S5ED 1Z6HA 2QDLA 2PW5A 3S1MB 3I70A 1UEBA 1YITA 3NENA 1IW7D 5J22A 1X55A 1WTWA 3BDLA 3QB3A 3ZJYC 2JA9A 3OW2A 1HNWL 3K81C 5M5WH 4C3IG 3NUCA 1GHJA 4DAMA 3PUVA 1EIHA 4A75A 3TN2A 1CA6A 1I3QB 1BXTA 2F3IA 2KENA 1MJEA 2CWPA 1D5MC 3HKSA 3H3VH 1D7QA 1XWEA 1EEFD 3M9BA 4LFBQ 2O5IC 2DGYA 1RIPA 3EJIA 2VQFL 4FDBA 4ID6A 1TWGH 1HPCA 1X3FA 4KHZA 2I0QA 1YHBA 3I8ZA 3CCLA 1JE5A 2E74C 1ZKOA 4JI6L 3I55A 4QIWB 2X69A 4JCVE 4RCNA 4JI1Q 5HY6A 4JI2Q 2K6AA 3SVMA 4NXMQ 4IPCA 1BDOA 5GAEC 1S5BD 3S1QH 1BCPD 2DNCA 1J6QA 5IYBG 1J9OA 3A8KE 3M4PA 5IGGA 1XXGA 1U4PA 4KD3A 1YI2A 4HIMA 1X3EA 5C4HA 4CKEA 2NVYH 2VXWA 3TZUA 4A3KH 1TY2A 2EJMA 3A55A 2MP1A 5C44B 2F4VL 1CSQA 4F87A 5AJ3Q 1X32A 4JVZA 4NW2A 3HOVH 3QG1A 4XQNA 2KQ3A 1K8AC 2IHFA 4LNQA 4CDDC 1C8CA 4CBVA 4QUCA 4POGA 3CCVA 1WCMG 2KCNA 5CBAE 4G7HC 5I4DA 2B2WC 2E2HH 1VQMA 1JQYD 5HGQA 2EZVA 4DR2Q 2K5VA 3DM1A 1KNAA 1MI2A 4DA2A 4DAPA 3K5NA 2NVQB 2H5XA 5CYUA 3NP8A 2JN4A 3NTIA 1UAPA 3RZOB 1TWHB 1VF7A 3RLFA 3V05A 3NSWA 3G48A 1PHJA 1RODA 1I94L 2LXKA 1FGUA 1EWHA 1NE3A 1ILPA 4DR7L 5M5YH 3IRBA 3BYYB 3K57A 1PFSA 1K3BC 4ZAIA 2VUMG 2F0JA 5LMNQ 1BBUA 5DAUA 4AYBB 4IUNA 3F2DA 1KABA 4YWLA 3I4OA 1NAPA 1PH3A 1YHAA 2RA4A 2L55A 3GTLB 3S17B 1DOMA 3FPUB 4P72A 3CC4A 2ALYB 2F0QA 3A74A 3H09A 1EY8A 2KCTA 2VB3X 5C0XI 1BCPB 4JC0A 4NB3A 4KHPL 3BZKA 1ML0D 2N88A 2MO1A 5FLXc 3J81L 2Z0SA 1MSGA 1S5FD 1TXYA 1EY4A 3KLWA 1HNWQ 1BUVT 1F2MA 3LGJA 3MWYW 3CQZH 2X6LA 1L1OA 2RHQB 3FRPB 5D65A 4A3JB 2F0FA 1U4RA 4KY5A 1V1PA 1SNOA 4L5QA 2EIFA 1H9SB 4B08A 4OX9Q 1EY6A 1Q82C 3S15H 3SDZA 5L37A 3H3VC 4F7XA 3K5MA 4C3HB 1JWUD 3NTKA 3J7ZC 1ILQA 1LLRD 2HQLA 4OELB 1LTTD 2IWHA 1JOQA 1PRTC 2JJQA 1F2YA 4CKCA 5FLXE 2VNUD 4JI0Q 1PTOH 3QIAA 2KHIA 3BS1A 2Q2IA 1KD1C 2WAQB 1SE3A 1KQSA 3NTHA 2UU9L 2TMPA 1JWMD 4ZCKA 3CC7A 4JV5L 1A15A 1B1ZA 5C4XG 3F2UA 4A93G 3L0OA 3GTGB 4KTAA 4RMFA 4K8IA 2CHBD 1E2WA 2B2YA 2WACA 4KV6A 3S17H 4DR4Q 1UE6A 2K5DA 3ND8A 3DEOA 5E3FA 1EU4A 3WDNA 1VQOA 4H7BA 1S40A 2R7DA 3A54A 4AYBE 5LMNL 3BZDB 4JI5Q 3LWEA 2E2JH 1ZXTA 2NN6H 3CXCA 2B2VA 1IBKQ 2D0OA 3MAQA 2QEJC 3D6CA 3FKIB 3SK6A 1H95A 2MHVA 3KDFB 1GJXA 4A3BH 2OF1A 2J4XA 3K7AB 1EYAA 3R2IA 4ODGA 1VQGA 1U0LA 3FKIH 3S2HB 2AQ1B 3O13A 1YNND 1CTMA 2OT2A 4DU9A 4A3GG 1CA5A 1AEXA 2YTXA 1WI5A 4HJAA 3HOVG 3CF5A 3ER0A 5D3IB 2UUBQ 1W3SA 4JOIA 1IBLQ 4KKUA 4BXXH 1PRTD 2L1BA 2WKCA 1EQQA 1LT3D 3NQTA 4LUZA 5KGUA 4QB4A 3AQQA 2PCFB 2VUMB 2A6ED 3K8AA 3Q6SA 5M3MB 2R7FA 1A62A 4L5SA 4OX9L 1VMCA 1CKMA 1F9SA 1SE8A 5ELCA 1QZGA 3MFGA 4XT3B 4IUTA 2G9DA 4KY7A 3OIPA 1Y1VG 2NUCA 5LHY1 3DLLA 2BH8A 4L5TA 1CZWA 1O7LA 2RSNA 4L6TB 3OWFA 3URYA 3TDQA 5IYDH 3IAYA 3D4WA 1Q8IA 4HJ9A 5IIFA 2ZJPA 3J7AF 2A6HD 1VQJA 3H94A 3OHXC 2IPKD 2F0VA 2QILA 1FD7D 5FO8B 2FFKB 1V8QA 3CCRA 2L0CA 2R61A 2R92H 3IKJA 1XJVA 4DV7L 5LL6X 3S16H 4C3HH 3D8GA 3RLOA 1CZGA 1J5EQ 1QNUA 4RGMA 4JOIC 1TU2B 3CQZB 2ZXPA 1K28A 1XYIA 2A6EC 3HOYB 3S1NB 2NZ1D 2F0KA 3MXGA 2WIIB 4AIMA 1IBML 2EYFA 3CCEA 2EYLA 1CQFA 1N32L 4KI0A 2AQ3B 4ALPA 2R93H 4KHVA 2DY7A 4NXNL 3VR2A 4LFBL 2XNAC 2EY1A 1V1OA 1UWVA 4IPGA 3HOUB 3NWTA 4LMQD 4DUZQ 3GTMH 1A2UA 4L8JA 1YVCA 3PF4A 3LNNA 4HJ5A 3DWQA 2JA5G 5CV6A 4DV0L 1B7YB 4DAYB 2RHSB 2JA5H 4X3TA 2YTVA 3KJPA 4DAVA 1PMRA 2RQXA 3J80c 2HIXA 1B4OA 2KVMA 3J81E 3WOFA 4R9WA 4YCVA 4F8MA 1NBWA 1A0IA 1C9OA 3L9AX 1YJWA 2F0MA 3HKZE 4JK1C 1KTKA 1N34Q 1MJCA 2L5TA 3VYTA 1PV4A 2FHTA 2X6GA 3DMUA 5I6YA 3S14B 2JXMB 1JORA 4R8NA 4CJ0B 4X6AH 4IFDG 1SYEA 3I4MG 4R4QA 5BN3A 2EQSA 5EKKA 4K6DA 2K1BA 2IX3A 4QL5A 3K58A 3KYHC 4PZ7A 4DV3Q 1I4HA 3CU7A 3RZOH 3C2PA 1ENCA 3QWNA 5G3LF 3RMHA 3G4SA 1HA5A 4A3LG 3VR5A 1A3UA 1UUPA 1NNXA 2RF4A 5JPMC 3GD7A 4Q0FA 5JVG3 1PFBA 2I07B 1VQ8A 2MJ8A 2CQOA 2PZWA 2PMZB 4OO1G 3GTPH 1JOKA 5IY0A 1XTCD 4K5XA 4UP9A 5IYCH 3NHHA 2VY3A 4TSSA 1IZ6A 1PTOC 3J81c 3H3VI 4GOPB 1WCMH 2GVBA 2KBNA 1BNZA 4GN5A 2E76C 3T1HQ 5JJLA 1O7YA 4RGTA 1QILA 4HSVA 2BOSA 1TS5A 4YHHL 3WOEA 1QWYA 4KN7C 1YZ6A 2A1AA 2C5CA 3D31A 3LWUA 2JYOA 4PNYA 4X64Q 2R93G 4DV7Q 3RR5A 1TS2A 1ZYRD 3EIVA 3K0YA 2O4XA 1PDQA 1JC7A 4DAYA 3ICEA 1M8AA 2UXBQ 2JA7H 2JA6B 1DONA 1V1PB 4XTCS 4IN3A 5DM63 3SE0A 3HOXB 2PQAA 5DLQE 1B8AA 3E3XA 2F3VA 1BQQT 4TQUS 2K5WA 3V96A 4PQXA 1SAPA 4B3RL 1A3VA 4YIJA 1I3QH 3FEWX 4DUYL 3QOLA 1AZPA 2JA8H 3PUZA 2IX0A 2VUMH 1WTRA 2ZTDA 2YU9H 2F0PA 3OSOA 1QVCA 1HZAA 3L3OC 5IYDG 1CQVA 1F9RA 3GV3A 1F2LA 3CPFA 2WB1E 3K59A 1LO5D 4BWGB 4C56C 1BBWA 3RN5A 1G2TA 2EYPA 3T1YL 3MXPA 3W5OA 4DUYQ 4A3DB 2JK8A 3HOZB 2B63B 3FVQA 2KA7A 5C4JB 1KL9A 4MNOA 1HR0W 3M7NA 4A3IG 1EYGA 3E6ZX 4WFN3 2AUJD 1EL0A 5IGCA 5C5LA 4UP7A 2B29A 1KIXA 1C0AA 2PW7A 4WJ3M 2GVAA 3EFXD 4LF8L 1IBKL 2EE1A 4FO2A 3C1FA 3ERSX 1RCVD 3T1YQ 4UPAA 3DM3A 5LMUL 1E1TA 5ELOA 1YEZA 1YJNA 2BE5C 4QY7A 4XYOA 2E5LL 5I2YA 2KEDA 3HP3A 1OXSC 3W1GA 3AMUA 3HOWB 3AU7A 2RBMA 2F4IA 4GLVB 1E24A 5JEAJ 1XPOA 1SSOA 4NDXA 5E4XA 2BDNA 4IFDJ 2FINB 2EXDA 5LMUQ 5ELBA 4DNIA 1LABA 2F0SA 3OYYA 5LL6S 2SDFA 2NN6I 1JB3A 4Z9CB 1TWCB 3NBHB 1Q12A 4H13C 5C0XG 4BY1H 4O42A 1ESRA 4P73A 4G4KA 1MGSA 3TBIB 3J7YW 5EKLA 1HR0L 3CW2C 1Y14B 3OMCA 5A35A 1T5XD 1LTGD 1CHQD 4H0LC 4R8IA 2I5LX 1PA6A 1F2ZA 2UUCL 1LTLA 3TRZA 1C7YA 3A56A 3GV6A 2GA4B 2RVLA 4YHHQ 3S16B 2UXDL 2ID0A 1D5ZC 1KAWA 1V9PA 2A68C 1PTOD 1RKNA 1D2BA 1SE2A 4BY7B 1U9RA 3UI2A 1FYCA 4R4TA 4N8FA 3CMAA 1HNZQ 1M4VA 4IOAA 4B3ML 2VL6A 5JEAH 3N6RA 1STGA 1SE4A 4OEMB 2R7ZB 3VA7A 5BR8Q 2HQEA 1AZQA 4LFAL 3KF6B 3EBEA 2VB2X 5IP7H 5M5XB 3NK9A 5FJ8H 3RUZA 2E2JB 3J80i 3T53B 2NVQH 4DR4L 4K2KA 3I4NH 2XSCA 1N36L 5C5MA 1K83H 2F1MA 1VQHA 2Q8RE 4POFA 1FJGL 1WCMB 3MHBA 2IW3A 4BA1I 2OWOA 4NP5A 4WJWA 2PYKA 1I50H 5EKIA 2PNHA 3HOUH 2ICIA 2PQAB 5JVH3 4OIKA 2R6GA 1L0XB 1PFNA 1E2VA 3T56B 1VQ5A 1N33Q 2QEXA 4A3GB 4IUQA 1RL2A 5AJ3L 4X62Q 2KECA 3UDGA 1STBA 2K28A 3J80L 1BVSA 3M4YA 2F0IA 4RA8A 1X65A 1S72A 2A8VA 1AH9A 2F0LA 2JEBI 2Y0SE 5HURA 3S1NH 2OQ0A 4JI2L 2RDHA 3ITPA 1L0WA 2PI2A 1E22A 1EY5A 2SNMA 3E9IA 4TRDA 1I4PA 5I9PA 2K32A 4K5VA 4DR5L 4BBRG 5FO7B 4QCLA 1MHWC 1Y1VB 4A3IH 1KNEA 4DK1A 1RHPA 1NR2A 1TY0A 5TSSA 1J5EL 1R9TB 4E6IA 4DR3L 2WV6D 2I5HA 5BR8L 5IE8A 5C3EB 2PPBC 3E0EA 3K5OA 3GTMB 3BG3A 1EZ8A 2SOBA 5CV5A 4HMJA 1VQKA 4DR7Q 1C48A 5FLMH 3GTKB 3HOWH 4GNXB 4ZUIA 4A3CH 1B53A 4A3GH 1KLGD 4KN4C 1TIID 3HOZH 4ZLTF 3FPPA 1HNXQ 2DNEA 1HNZL 4TKOB 3I73A 1O7IA 1OTCA 2JA8G 4O1NA 1XMOQ 3NXWA 5DEHA 4DN4M 3E9HA 1LTID 2FMCA 3U9SA 3KJOA 1HR0Q 4FF4A 2NVXB 4RKBA 2XWBB 3CP0A 4WORA 4LWCA 2WB1G 1EY0A 3W2DA 4HAEA 3OTOQ 3GQBA 3HOUG 5ISRA 4UP8A 3A5ZB 4MZ9A 2CVRA 1IW7C 1D1IA 2RKSA 3KBGA 4XXEA 1G91A 3VR4A 2NVTB 4C3HG 1B70B 1FVIA 5GAGC 1NSNS 2EYMA 2L11A 4DGZA 1CSPA 1QVFA 3ULJA 3SHLA 5DNFA 4LF7Q 4L63B 1JE4A 2QW7A 1VQ9A 4A3FH 1H9SA 4NPSA 3MEFA 5IWAQ 2QA4A 3Q8DA 4GNXC 4A4IA 1BCPF 2MFIA 1LM0A 3PIPA 4A3EG 2R7ZG 4ME5A 2UUCQ 2PI2E 4WJ4A 4KK7A 4EQPA 1PH4A 4X3UA 3CMEA 4LF4Q 4IZ8A 3R8BA 1STEA 1AN8A 4FF2A 2GN5A 4JG2A 1E0BA 2B2WA 2R7ZH 2JP1A 1UNSA 2D9UA 4K14A 4RKLA 1PLFA 3PIO3 3L7ZC 4B3MQ 1EUJA 2JQOA 4JV5Q 1J8IA 2EYHA 3GO5A 4DR3Q 1S5DD 1H9KA 1Q1EA 2LKVA 3VYUA 1VQEA 3FKIG 2LSSA 2F0WA 2E2IB 5KYLA 3FDTA 4GS3A 4OGQC 3TEHB 5CBEE 3JAME 4XQJA 2Q8TA 4ZKBB 3H6MA 1M1KC 3KLSA 4GNXA 2Q2TA 3OW7A 5C6AA 5JOBA 3RZDB 1L1OB 4J15A 1ASZA 1Y69U 3UE0A 5K5PA 3FMCA 1KHIA 2ZJQA 1ENFA 1DZ1A 2M9VA 5EAYA 5D3DA 4HJ7A 3TP6A 4A76A 2KUMA 5CV4A 4FNFA 3GTPB 5DM73 3TQYA 2LMCB 1HCZA 3BU2A 1K0RA 1IXRA 1YIJA 1JT8A 1I6HH 4HIOA 4JI7Q 2N8NA 1FNWA 4LAAA 1VQ6A 1VQPA 3A7AB 2AWOA 3TREA 2VQEQ 5I6WA 3PUYA 1VMPA 3JAMc 3ZYYX 4XQQA 1HH2P 4DV0Q 2IY5B 1PH2A 3SK5A 5EBDA 5IGEA 3JC66 1I4XA 1HZBA 4HMIA 4FP5D 1XMOL 3IL8A 1MBYA 3TP8A 2CW0C 5JJIA 5JEAG 2NYZD 1JMCA 3A8JE 4LUVA 4DV5L 5ELNA 4JI7L 4KMUC 4GKJL 2HCIA 2OXPA 3CCUA 4V190 1Y8NB 1HTPA 1CT1D 1UEAB 3UE1A 1PYWD 2V1CC 3HOXH 3U4ZA 3UDFA 2MUYA 3OTOL 3ERQA 1QVGA 4DNTB 1K8GA 1U5KA 2K01A 3NWSA 1QB5D 4LUOA 1SMXA 5IT9L 1HFNA 1OXXK 2HCCA 3KLRA 4O2DA 3Q0AA 4A3MB 4A3DG 4M8AA 2ZT9C 1K8MA 5C0XH 5C3WA 4KLKA 1HQMC 1UE5A 4DV4L 2NB0A 1BBXC 4HCSA 4K0KL 3S2DH 1WTPA 2Z8LA 2ZXRA 2J0TD 1O78A 3B6YA 2BH2A 2HIVA 1GUWA 3VR3A 3H15A 4B3SQ 5M5XH 4DF7A 1JJ2A 4OL7A 2C9OA 3SR1A 5K36H 3G6JB 4FXKC 5C4JH 4CDFC 2F0GA 3C3LA 2EY5A 2F0NA 2DJFC 1W6KA 3I7FA 1SNPA 5KRUA 1N8RC 1L1OC 2UXCL 2L15A 4HN7A 2BA0A 1CKOA 2K7VA 3K0XA 1QJOA 3NELA 2YYZA 1WYDA 2QDBA 3HGBA 2M2LA 5FLMG 2BDOA 4IALA 1YNXA 3MXNB 3PMFA 1EYDA 2RCFA 3RLNA 2QF7A 4UHVA 1SMYD 2TSSA 3R2TA 4U68A 1AP0A 1WFQA 1DYQA 1N36Q 4A3MH 2PMZE 4LF5Q 1MD2D 1MKHA 2HUGA 2F0OA 3VA5A 2AMCB 4JI4Q 2IL8A 5IP9G 1BF4A 4LF9L 2QKIC 3AFQA 3MTSA 3CHBD 3RNUA 4CJ1B 3UDIA 3GTKH 2HT1A 4ABNA 1IL8A 1IHZA 2Z1CA 1D1KA 5JJKA 3I56A 1Z9FA 1QOHA 1EQVA 2L9HA 1IKLA 4HSPA 4A93H 3TS2A 2H1EA 1X56A 4RWSC 4DPGA 4AQYQ 2YTYA 1IBMQ 3HRZC 4XDXA 4PMWA 3UDXA 3J81i 1R4QB 1PRTF 5E4WC 3T4AC 1EIGA 1X9NA 4LW1A 4H02A 4OIJA 4PZ6A 4XT1B 2UU9Q 2ENBA 4QF4A 1SYGA 2OEOA 4BS9A 3MA2B 3S2HH 1SNDA 1PH6A 5E7NA 5ELDA 4DUZL 4DK3C 2FXQA 1PH7A 4EQ5A 1U4MA 2K04A 2R93B 3DWAA 3H91A 3C46A 1LTRD 1LT5D 4GOPA 4KJNA 3KDFA 3PF5A 2MPMA 4KHPQ 3KF8A 1PYSB 4X65Q 3PO2G 3CD6A 3J81j 1II3A 4UDUC 1AE3A 2OTLA 1X3QA 2A6HC 3S1RB 1XMQQ 3N52A 1GUGA 1X54A 1SJED 4X66L 5BN4A 3Q22A 1EQRA 2SEBD 2Z6BA 3AEVA 1C4QA 5CMDA 1PZJD 3S1RH 1STYA 1EWIA 2F52A 4C3IH 4HIKA 1EY9A 1EZ6A 4A3MG 3MXNA 5IODA 3KLSX 1OXVA 1S3OA 4RH6A 4Y7NH 2K75A 2K52A 3CKIB 5COYA 1Y8OB 5FOBB 2JA6H 1QE6A 2IX1A 2CQAA 4JI4L 4RG1A 1WD1A 4A3BB 2NVXH 4A3DH 5C4XH 2YV5A 3HOYH 1SNCA 3MFYA 1LACA 5KIXA 1SN8A 4IFDH 4P71A 2E8GA 2Z6KC 3QJYA 3W1BA 1Q46A 2F0EA 2O2LD 2D62A 3D3RA 1BR9A 2ES2A 1Y1WB 5C3EG 2EY2A 3MEHA 5JPNC 2SNSA 1IL2A 4UY8C 2BCOA 1OXTA 4AQYL 3OOCA 5A2QL 2UXBL 4EVOA 4DV2L 2D0PA 2AWNA 4P2CB 4N8X1 4UAIA 3S9WA 5KNDA 2XRSD 5CV7A 1VQBA 1V43A 2L12A 2EXZA 2RDFA 4IURA 4BA2I 2RSOA 1B3AA 1SYBA 1MIUA 1SR3A 4MTKA 2F3WA 4XIGS 2B63H 4GKKL 2JA8B 2HD3A 3DHQA 1VF5C 3NEMA 3I90A 4R4IA 4IPDA 4LF7L 4GZYC 1SYDA 1EOTA 3K6OA 1ASYA 2B2UC 2ZM6Q 3R93A 3H0GG 4I7ZC 2E2DC 1VQAA 4DV1L 3W3AA 2A19A 1XNRQ 2XVSA 4P74A 1LUZA 2CKZB 2OCEA 1EU3A 4RFBA 4KKSA 3GTQH 3PO3H 2XGTA 3GP7A 3HZXA 1ICWA 4X65L 1VQFA 5KYIA 2JA5B 4U673 4C2MH 1TWFB 2B2VC 3STBD 3VYSA 2B8FA 1XX8A 2J7ZA 3IFDA 1SBBB 3X3MA 1D6EC 2NZHA 2WKDA 4DV5Q 3VYRA 5GAHC 1UE1A 1PTOB 4KD4A 2F4VQ 1EIYB 5GADC 1DJRD 4DV2Q 2E2HB 1KXLA 1CM9A 4G7ZC 1GUSA 4DR1Q 3MZ5A 1P8LA 1GKHA 3GTJB 4JI6Q 2MQHA 2MO0A 1SJHD 2PZUA 2O5JC 5IGBA 1A3TA 1WVLA 3GTGH 4IOCA 1S4ZA 2Q2HA 3NBIA 2NTTA 4HEDA 1CKNA 2Z4IA 3I4LA 2IT1A 3I4MB 3T51B 3M4OH 3D6WA 1XMQL 2ZJRA 4LF8Q 4R4OA 4JI3L 4OWWB 1HQRD 2B8GA 4BXXG 1QUQB 3CCSA 2BA1A 4PMBA 1B2TA 2Z6KA 3U50C 4BY7H 3OIQA 4GKJQ 3M4QA 1SYCA 4K2LA 2AQ2B 1QG7A 4FF3A 5M3FB 2R3ZA 1I4QA 3KF8B 1B50A 4N9PA 3TSSA 5EQ0A 3PSIA 1JB7A 3HG9A 4C3JB 4DR6L 3H0GH 1WTHA 1KAAA 4S3SA 1N34L 1TWAH 5M3MH 4B9XA 2N78A 4LK1C 5BN5A 4OO1H 3AB9A 4A3BG 3D4RA 4DR5Q 4NKLA 2MNAA 1WJJA 1DOKA 4EGVA 1D8LA 1SFOB 4DV1Q 3J7A5 4AYBG 3EN2A 4BBRB 2LFNA 1JICA 3TMEA 4RGNA 2R92G 4O0AA 1JCKB 3KK7A 4A3LH 1QCBD 1EFID 3RN2A 1LTBD 4FXDA 4I7AA 2Q2UA 4LFCQ 1YNJC 2UXDQ 1RTNA 1EQTA 3PIP3 1LT4D 2OTJA 4JI0L 5IGDA 4X64L 1Q7YC 4J8QA 1I4RA 1Q8KA 5I2XA 1SMYC 3PQIA 1A6XA 1VQIA 1FJGQ 1EYCA 3M85A 5KEEA 2E75C 5IP9H 3CPWA 1P16A 1PRTB 4TVAB 2EJFC 2Y0SB 3P7JA 1Q86C 3VR6A 4DFAA 3PIOA 4CJ2C 3P20A 1WTXA 3T1HL 2B2TA 1VQ4A 4IUPA 4EQOA 3FHWA 5C44H 2DJGC 2QGQA 1PZKD 2KCCA 1K73C 1K3RA 1L0YB 4NMZA 3I4NG 2F0UA 2K4KA 3MC0B 1E1OA 4JI3Q 5EJWA 4DXGA 2B63G 3A8IE 2NVTH 5C4ZA 1STHA 3G7LA 4ZRZA 3JAML 3NE5B 1B44D 2WAQG 4CGYB 2HHHL 3ONAB
chains in the Genus database with same CATH topology
4A76A 4L5RC 2XTIA 1PVOA 1YJ9A 3CC2A 4YCVA 1PH1A 3TQYA 1NBWA 1A0IA 3BU2A 1K0RA 3L2PA 1IXRA 1YIJA 4B3RQ 1R9TH 1I6HH 1JT8A 4HIOA 1C9OA 2N8NA 4JI7Q 2OQKA 1YJWA 2UUBL 1VQ6A 1VQPA 4JI1L 3KOJA 3HKZE 2AWOA 3TREA 1N34Q 5C0XJ 2VQEQ 3ULLA 3PUYA 1MJCA 1PV4A 3JAMc 3U4VA 1HH2P 4YY3Q 4QIWE 4DV0Q 1LYLA 2JA6G 5GROA 2IHEA 2IY5B 1G291 1PH2A 3HOXG 3JC66 3K7UC 2C35B 4LF9Q 1HZBA 4JI8Q 1VQLA 3M3YH 1XMOL 1DGSA 2VS1A 5C3EH 4IFDG 4X6AH 1SROA 3I4MG 4R4QA 2E5LQ 2JEAI 5JJIA 2EQSA 3F1ZA 5JEAG 1V1QA 1AE2A 1PH7A 1JMCA 4LUVA 4EX5A 4DV5L 5ELNA 4JI7L 4QL5A 3KYHC 4GKJL 4PZ7A 1K9MC 1G51A 3BZCA 3FP9A 4DV3Q 3A0JA 3CCUA 3RZOH 3HFZB 3UE1A 4DR1L 1TWHH 4OWTB 5GQOA 1IYJB 2V1CC 4YY3L 3HOXH 3G4SA 3U4ZA 3AFPA 3UDFA 3OTOL 3F8TA 4HIDA 4LF4L 4A3LG 4BBRH 1EIFA 3TS0A 1QVGA 4PG3A 4GN3B 1K8GA 1U5KA 4YWMA 3PUXA 1CUKA 2RF4A 3GD7A 4R4CA 4LUOA 1SMXA 4DR2L 4GN4B 1VQ8A 2CQOA 4DV6Q 4JBMA 2JA7G 4OO1G 1XTDA 3GTPH 1NTGA 1OXXK 4O2DA 5IY0A 2CCZA 4A3DG 1KRTA 4UP9A 5IYCH 5IWAL 2VY3A 1XPRA 1IZ6A 3JAMi 4KLKA 1UE5A 3J81c 3H3VI 4DV4L 4GOPB 1M90C 4IFDI 4AH6A 1WCMH 2GVBA 3PO2H 4K0KL 2KBNA 3KF6A 2AKWB 4GN5A 4R1JA 4DK6C 5M3MG 3CCJA 3T1HQ 3S14H 3S2DH 5JJLA 1JJGA 3B6YA 2BH2A 2HIVA 3CCMA 4BY7G 3H15A 3ULPA 2JE6I 4B3SQ 4YHHL 5M5XH 1JJ2A 4BBSG 5H1SE 1BKBA 1YZ6A 2A1AA 1VS0A 3D31A 5C4JH 4QJFA 4X64Q 1Y1WG 1PH5A 2UUAL 5C44G 5M3FH 4GLXA 4DV7Q 3I7FA 1N8RC 2R93G 3RR5A 1L1OC 2UXCL 3EIVA 3GDEA 2L15A 5IYBH 1A63A 2BA0A 3ICEA 1CKOA 3CCQA 2JA7H 2UXBQ 3K0XA 3HOWG 3NELA 4XTCS 2YYZA 1WYDA 5FLMG 4OO1I 2PQAA 5DLQE 1B8AA 1YNXA 3MXNB 4TQUS 3RLNA 1UEBA 4OONA 1YITA 4B3RL 3NENA 1I3QH 4DUYL 1X55A 2JA8H 1WFQA 3PUZA 2IX0A 2JA9A 3ZJYC 3OW2A 4A3MH 1N36Q 3K81C 2PMZE 5M5WH 4LF5Q 1Q81C 2VUMH 1HNWL 1MKHA 4DAMA 1KC8C 3PUVA 2ZTDA 4A75A 2AMCB 2YU9H 4A3CG 4JI4Q 2F3IA 5IP9G 2VW9A 2KENA 4QQBX 1QVCA 1HZAA 4LF9L 1MJEA 2CWPA 3HKSA 3H3VH 5IYDG 1D7QA 3GTJH 3M9BA 4LFBQ 3CPFA 1NJIC 3AFQA 2WB1E 3RNUA 2DGYA 3UDIA 3GTKH 1NMFA 2HT1A 1XNQL 1XNRL 4JBJA 1BBWA 3RN5A 2ATWA 1RIPA 2VQFL 4FDBA 5JJKA 3I56A 1TWGH 1Z9FA 4DUYQ 3W5OA 3AYHB 2KHJA 1X3FA 4KHZA 4X62L 3T1YL 2I0QA 3TS2A 4A93H 2JK8A 1X56A 1YHBA 3CCLA 1JE5A 4DPGA 1N33L 4JI6L 3PV0A 4AQYQ 3I55A 2YTYA 1KL9A 1GVPA 2N49A 4JCVE 4MNOA 1HR0W 3M7NA 4A3IG 4JI1Q 1EYGA 1IBMQ 4YWKA 4PMWA 3UDXA 3BJUA 3PO3G 3J81i 5HY6A 4JI2Q 4NXMQ 1X9NA 4IPCA 4LW1A 4H02A 4UP7A 5GAEC 2B29A 4PZ6A 1KIXA 1GM5A 4NXNQ 1C0AA 3S1QH 2WAQE 2UU9Q 4WJ3M 2GVAA 1CKNB 1J6QA 3G6EA 5IYBG 4LF8L 3F2BA 3M4PA 3S2HH 1IBKL 1YI2A 1PH6A 3ERSX 4HIMA 5E7NA 1X3EA 4UPAA 4DUZL 4DK3C 3DM3A 3T1YQ 2NVYH 5LMUL 2FXQA 1E1TA 2WFWA 2CFMA 1YEZA 5ELOA 3WWVA 4A3KH 1YJNA 1QUQA 4QY7A 4EQ5A 4LF6L 2F4VL 1CSQA 3HKZG 5J3BA 4GOPA 2E5LL 1UE7A 1G6PA 4JBKA 1GO3E 3KDFA 4LFAQ 3D0FA 5IYCG 1Q1BA 5AJ3Q 1OXSC 3W1GA 3I2ZA 3HOVH 2HHHQ 3PF5A 2DUDA 3GTOH 1K8AC 2IHFA 4LNQA 1EOVA 4KHPQ 4GLVB 4DV3L 4B3SL 1PYSB 3PUWA 1E24A 5JEAJ 4X65Q 4A3KG 1XPOA 3CCVA 4POGA 1WCMG 3CD6A 3PO2G 3STBC 3J81j 4IFDJ 1AE3A 2E2HH 1VQMA 2OTLA 4YCWA 5HGQA 1XMQQ 1HNXL 4DR2Q 4A3JG 2K5VA 2EXDA 1X54A 4X66L 3G71A 5LMUQ 1EQRA 1VQDA 2WP8J 2KCMA 3PCOB 2H5XA 4DNIA 4JYAL 3OYYA 3AEVA 4JI5L 2NN6I 4IO9A 3NBHB 1Q12A 5C0XG 1WOCA 1VCIA 3S1RH 4BY1H 4P73A 1EWIA 2F52A 1PH8A 4C3IH 3RLFA 1EFWA 4HIKA 1HR0L 3CW2C 4A3MG 1Y14B 2K50A 3I4MH 1OXVA 3G48A 1S3OA 2K5HA 2I5LX 1PA6A 1SFOH 1PHJA 2UUCL 4Y7NH 1LTLA 1I94L 3TRZA 2LXKA 1FGUA 1C7YA 4LF5L 2K75A 2K52A 1NE3A 3CAMA 1X3GA 4YHHQ 2JA6H 4DR7L 4K0KQ 2UXDL 2ID0A 1KAWA 4X66Q 2IX1A 1Y1VH 5M5YH 1V9PA 3IRBA 4RG1A 1IBLL 4JI4L 3K7AH 1PFSA 2NVXH 1NMGA 5C4XH 4NXML 4A3DH 2YV5A 2VUMG 3HOYH 1SN8A 5LMNQ 4P71A 1BBUA 2E8GA 2Z6KC 4R4TA 4YCUA 3F2DA 4YWLA 3CMAA 1HNZQ 3W1BA 1Q46A 3I4OA 2VL6A 1PH3A 4B3ML 4IOAA 3HOYG 2VQFQ 1YHAA 2D62A 2ES2A 1PYBA 5C3EG 1IL2A 1VQCA 4UY8C 4P72A 1OXTA 2ALYB 3A74A 4AQYL 4A3FG 5BR8Q 3CC4A 4LFAL 2KCTA 2UXBL 3KF6B 3EBEA 5C0XI 4DV2L 2D0PA 5IP7H 2AWNA 4A3EH 1N32Q 4JC0A 1VQBA 5FJ8H 4NB3A 4KHPL 1Z47A 3J80i 3BZKA 1Y1WH 2NVQH 1I5FA 1V43A 4DR4L 3I4NH 4BA2I 1VQ7A 2MO1A 5FLXc 1N36L 2Z0SA 1MIUA 1SR3A 1K83H 1VQHA 4XIGS 1TXYA 3KLWA 2B63H 4GKKL 4POFA 1FJGL 1HNWQ 3LGJA 1E7ZA 3NEMA 4R4IA 4BBSH 4IPHA 4IPDA 3CQZH 1GD7A 4JYAQ 4BA1I 2OWOA 5LMNW 4LF7L 1L1OA 2UUAQ 2RHQB 1X6OA 1I50H 1ASYA 2PNHA 2ZM6Q 4ME3A 3H0GG 3HOUH 2PQAB 1VQAA 2EIFA 4L5QA 2R6GA 1N33Q 1W2BA 4DV1L 1VQ5A 4OX9Q 2QEXA 2A19A 1RL2A 5AJ3L 4X62Q 1XNRQ 4P74A 1Q82C 3S15H 1LUZA 2CKZB 2OCEA 1I94Q 1BVSA 1TWFH 3GTQH 3PO3H 2XGTA 4Y52H 4B3TL 2N3SA 3J7ZC 1S72A 1X65A 4X65L 2A8VA 3HOZG 1AH9A 2HQLA 2JEBI 1VQFA 2Y0SE 3S1NH 2OQ0A 4JI2L 2JJQA 1L0WA 4C2MH 2PI2A 2VNUD 1E22A 4JI0Q 1XPUA 3E9IA 3STBD 2KHIA 4DR5L 2Q2IA 4IJLA 4BBRG 1KD1C 1SRUA 4GLAC 1KQSA 2E2IH 2AHOB 2UU9L 4A3IH 1HZCA 2NZHA 4DV5Q 1J5EL 5IT9c 5GAHC 4DR3L 3CC7A 1UE1A 4QGUA 4JV5L 2F4VQ 2I5HA 1E3PA 5BR8L 5IE8A 5GADC 1EIYB 5C4XG 4DV2Q 4LF6Q 4A93G 1KXLA 3L0OA 1A8VA 3A5UA 4DR1Q 1JJCB 1P8LA 4RMFA 3E0EA 1GKHA 2NZOA 2B3GA 4JI6Q 2K5NA 2MQHA 3S17H 4DR4Q 1UE6A 1VQKA 4DR7Q 1L2FA 1YBYA 2MO0A 5FLMH 1QZHA 4PZ8A 1TWCH 3HOWH 1VQOA 3GTGH 4JBWA 4MTNA 4GNXB 4IOCA 1YHQA 2Q2HA 1S40A 2R7DA 1NY4A 4DV6L 4AYBE 1CKNA 4A3CH 5LMNL 4A3GH 4JI5Q 2E2JH 3HOZH 2IT1A 3M4OH 1N9WA 2I5MX 1XMQL 1HNXQ 3CXCA 2ZJRA 1HNZL 4LF8Q 4R4OA 2Y0SG 4JI3L 1IBKQ 4OWWB 5K36G 1O7IA 2D0OA 1OTCA 2JA8G 4BXXG 1QUQB 3CCSA 2BA1A 1XMOQ 2Z6KA 3SGIA 3U50C 3F2CA 1H95A 4BY7H 2VZAA 3E9HA 3KDFB 3M4QA 4GKJQ 4A3BH 3KJOA 1HR0Q 2NN6G 3CP0A 1VQGA 1U0LA 3KF8B 4LWCA 3FKIH 2WB1G 4P75A 3PSIA 3OTOQ 1JB7A 4A3GG 4B3TQ 4APVA 4DR6L 3H0GH 3HOUG 2YTXA 1WI5A 3A5ZB 4MZ9A 4UP8A 4HJAA 1N34L 3CF5A 3HOVG 1TWAH 3ER0A 2UUBQ 1B70B 1W3SA 4JOIA 2N78A 5M3MH 4IJHA 4LFCL 1IBLQ 1FVIA 4BXXH 4GKKQ 1EQQA 5GAGC 2ASBA 4A3BG 1CSPA 4LUZA 4HJ8A 1PH9A 3ULJA 4DR5Q 1QVFA 3AQQA 4LF7Q 2MNAA 1WJJA 3K8AA 1D8LA 2R7FA 1A62A 4L5SA 4DV1Q 4JI8L 1VQ9A 4OX9L 4AYBG 3S24A 3J7A5 4A3FH 1CKMA 1SE8A 3EN2A 3MEFA 1HZ9A 2ZTEA 4NPSA 5IWAQ 3Q8DA 2QA4A 4GNXC 1QZGA 4A4IA 2MFIA 1Y1VG 2R92G 4O0AA 5FJ8G 1VQNA 1FL0A 1LM0A 3PIPA 4OXPA 5IP7G 2BH8A 3DLLA 4L5TA 4GOPC 4A3EG 2R7ZG 4A3LH 3RN2A 2UUCQ 3U58A 2PI2E 4WJ4A 2Q2UA 4LFCQ 4DKAC 3S1MH 1PH4A 5IYDH 2UXDQ 4HJ9A 3KFUA 3CMEA 4LF4Q 2ZJPA 2OTJA 4JI0L 1VQJA 4X64L 1Q7YC 1Q8KA 2GN5A 4JG2A 3VDYA 2R7ZH 2K14A 3CCRA 2RCNA 1VQIA 2R92H 1XJVA 4DV7L 1FJGQ 3L7ZC 4B3MQ 3S16H 1EUJA 2JQOA 3RLOA 4C3HH 4JV5Q 3M85A 1J5EQ 5IP9H 3CPWA 1P16A 3GO5A 4JOIC 4TVAB 4DR3Q 1SLJA 1Q86C 1Q1EA 3PIOA 4DV4Q 1VQEA 3FKIG 4AIMA 1IBML 2LSSA 2CWAA 3CCEA 1HJPA 1N32L 3T1HL 1VQ4A 3RZDH 4GS3A 4KI0A 3TEHB 4DR6Q 3FHWA 5C44H 5M3FG 4ALPA 2R93H 4NXNL 3GTLH 2QGQA 1M1KC 4A3JH 3K80C 4LFBL 4BY1G 1K73C 4GNXA 2Q2TA 1K3RA 1UWVA 4IPGA 3I4NG 1XNQQ 4DUZQ 3GTMH 2VQEL 1YVCA 4OWXB 4HJ5A 3PF4A 2K4KA 1L1OB 4J15A 4C3JH 1ASZA 2LXJA 2JA5G 3UE0A 1KRSA 4DV0L 1B7YB 1E1OA 1T9HA 2RHSB 2ZTCA 3PGZA 4DAYB 2JA5H 1KHIA 4JI3Q 2B63G 1OXUA 2YTVA 2NVTH 3KJPA 2ZJQA 2UXCQ 3J80c 2HIXA 5EAYA 2WAQG 2ZM6L 4HJ7A 2HHHL 3UDGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A76 A;  4L5R C;  2XTI A;  1PVO A;  1YJ9 A;  3CC2 A;  4YCV A;  1PH1 A;  3TQY A;  1NBW A;  1A0I A;  3BU2 A;  1K0R A;  3L2P A;  1IXR A;  1YIJ A;  4B3R Q;  1R9T H;  1I6H H;  1JT8 A;  4HIO A;  1C9O A;  2N8N A;  4JI7 Q;  2OQK A;  1YJW A;  2UUB L;  1VQ6 A;  1VQP A;  4JI1 L;  3KOJ A;  3HKZ E;  2AWO A;  3TRE A;  1N34 Q;  5C0X J;  2VQE Q;  3ULL A;  3PUY A;  1MJC A;  1PV4 A;  3JAM c;  3U4V A;  1HH2 P;  4YY3 Q;  4QIW E;  4DV0 Q;  1LYL A;  2JA6 G;  5GRO A;  2IHE A;  2IY5 B;  1G29 1;  1PH2 A;  3HOX G;  3JC6 6;  3K7U C;  2C35 B;  4LF9 Q;  1HZB A;  4JI8 Q;  1VQL A;  3M3Y H;  1XMO L;  1DGS A;  2VS1 A;  5C3E H;  4IFD G;  4X6A H;  1SRO A;  3I4M G;  4R4Q A;  2E5L Q;  2JEA I;  5JJI A;  2EQS A;  3F1Z A;  5JEA G;  1V1Q A;  1AE2 A;  1PH7 A;  1JMC A;  4LUV A;  4EX5 A;  4DV5 L;  5ELN A;  4JI7 L;  4QL5 A;  3KYH C;  4GKJ L;  4PZ7 A;  1K9M C;  1G51 A;  3BZC A;  3FP9 A;  4DV3 Q;  3A0J A;  3CCU A;  3RZO H;  3HFZ B;  3UE1 A;  4DR1 L;  1TWH H;  4OWT B;  5GQO A;  1IYJ B;  2V1C C;  4YY3 L;  3HOX H;  3G4S A;  3U4Z A;  3AFP A;  3UDF A;  3OTO L;  3F8T A;  4HID A;  4LF4 L;  4A3L G;  4BBR H;  1EIF A;  3TS0 A;  1QVG A;  4PG3 A;  4GN3 B;  1K8G A;  1U5K A;  4YWM A;  3PUX A;  1CUK A;  2RF4 A;  3GD7 A;  4R4C A;  4LUO A;  1SMX A;  4DR2 L;  4GN4 B;  1VQ8 A;  2CQO A;  4DV6 Q;  4JBM A;  2JA7 G;  4OO1 G;  1XTD A;  3GTP H;  1NTG A;  1OXX K;  4O2D A;  5IY0 A;  2CCZ A;  4A3D G;  1KRT A;  4UP9 A;  5IYC H;  5IWA L;  2VY3 A;  1XPR A;  1IZ6 A;  3JAM i;  4KLK A;  1UE5 A;  3J81 c;  3H3V I;  4DV4 L;  4GOP B;  1M90 C;  4IFD I;  4AH6 A;  1WCM H;  2GVB A;  3PO2 H;  4K0K L;  2KBN A;  3KF6 A;  2AKW B;  4GN5 A;  4R1J A;  4DK6 C;  5M3M G;  3CCJ A;  3T1H Q;  3S14 H;  3S2D H;  5JJL A;  1JJG A;  3B6Y A;  2BH2 A;  2HIV A;  3CCM A;  4BY7 G;  3H15 A;  3ULP A;  2JE6 I;  4B3S Q;  4YHH L;  5M5X H;  1JJ2 A;  4BBS G;  5H1S E;  1BKB A;  1YZ6 A;  2A1A A;  1VS0 A;  3D31 A;  5C4J H;  4QJF A;  4X64 Q;  1Y1W G;  1PH5 A;  2UUA L;  5C44 G;  5M3F H;  4GLX A;  4DV7 Q;  3I7F A;  1N8R C;  2R93 G;  3RR5 A;  1L1O C;  2UXC L;  3EIV A;  3GDE A;  2L15 A;  5IYB H;  1A63 A;  2BA0 A;  3ICE A;  1CKO A;  3CCQ A;  2JA7 H;  2UXB Q;  3K0X A;  3HOW G;  3NEL A;  4XTC S;  2YYZ A;  1WYD A;  5FLM G;  4OO1 I;  2PQA A;  5DLQ E;  1B8A A;  1YNX A;  3MXN B;  4TQU S;  3RLN A;  1UEB A;  4OON A;  1YIT A;  4B3R L;  3NEN A;  1I3Q H;  4DUY L;  1X55 A;  2JA8 H;  1WFQ A;  3PUZ A;  2IX0 A;  2JA9 A;  3ZJY C;  3OW2 A;  4A3M H;  1N36 Q;  3K81 C;  2PMZ E;  5M5W H;  4LF5 Q;  1Q81 C;  2VUM H;  1HNW L;  1MKH A;  4DAM A;  1KC8 C;  3PUV A;  2ZTD A;  4A75 A;  2AMC B;  2YU9 H;  4A3C G;  4JI4 Q;  2F3I A;  5IP9 G;  2VW9 A;  2KEN A;  4QQB X;  1QVC A;  1HZA A;  4LF9 L;  1MJE A;  2CWP A;  3HKS A;  3H3V H;  5IYD G;  1D7Q A;  3GTJ H;  3M9B A;  4LFB Q;  3CPF A;  1NJI C;  3AFQ A;  2WB1 E;  3RNU A;  2DGY A;  3UDI A;  3GTK H;  1NMF A;  2HT1 A;  1XNQ L;  1XNR L;  4JBJ A;  1BBW A;  3RN5 A;  2ATW A;  1RIP A;  2VQF L;  4FDB A;  5JJK A;  3I56 A;  1TWG H;  1Z9F A;  4DUY Q;  3W5O A;  3AYH B;  2KHJ A;  1X3F A;  4KHZ A;  4X62 L;  3T1Y L;  2I0Q A;  3TS2 A;  4A93 H;  2JK8 A;  1X56 A;  1YHB A;  3CCL A;  1JE5 A;  4DPG A;  1N33 L;  4JI6 L;  3PV0 A;  4AQY Q;  3I55 A;  2YTY A;  1KL9 A;  1GVP A;  2N49 A;  4JCV E;  4MNO A;  1HR0 W;  3M7N A;  4A3I G;  4JI1 Q;  1EYG A;  1IBM Q;  4YWK A;  4PMW A;  3UDX A;  3BJU A;  3PO3 G;  3J81 i;  5HY6 A;  4JI2 Q;  4NXM Q;  1X9N A;  4IPC A;  4LW1 A;  4H02 A;  4UP7 A;  5GAE C;  2B29 A;  4PZ6 A;  1KIX A;  1GM5 A;  4NXN Q;  1C0A A;  3S1Q H;  2WAQ E;  2UU9 Q;  4WJ3 M;  2GVA A;  1CKN B;  1J6Q A;  3G6E A;  5IYB G;  4LF8 L;  3F2B A;  3M4P A;  3S2H H;  1IBK L;  1YI2 A;  1PH6 A;  3ERS X;  4HIM A;  5E7N A;  1X3E A;  4UPA A;  4DUZ L;  4DK3 C;  3DM3 A;  3T1Y Q;  2NVY H;  5LMU L;  2FXQ A;  1E1T A;  2WFW A;  2CFM A;  1YEZ A;  5ELO A;  3WWV A;  4A3K H;  1YJN A;  1QUQ A;  4QY7 A;  4EQ5 A;  4LF6 L;  2F4V L;  1CSQ A;  3HKZ G;  5J3B A;  4GOP A;  2E5L L;  1UE7 A;  1G6P A;  4JBK A;  1GO3 E;  3KDF A;  4LFA Q;  3D0F A;  5IYC G;  1Q1B A;  5AJ3 Q;  1OXS C;  3W1G A;  3I2Z A;  3HOV H;  2HHH Q;  3PF5 A;  2DUD A;  3GTO H;  1K8A C;  2IHF A;  4LNQ A;  1EOV A;  4KHP Q;  4GLV B;  4DV3 L;  4B3S L;  1PYS B;  3PUW A;  1E24 A;  5JEA J;  4X65 Q;  4A3K G;  1XPO A;  3CCV A;  4POG A;  1WCM G;  3CD6 A;  3PO2 G;  3STB C;  3J81 j;  4IFD J;  1AE3 A;  2E2H H;  1VQM A;  2OTL A;  4YCW A;  5HGQ A;  1XMQ Q;  1HNX L;  4DR2 Q;  4A3J G;  2K5V A;  2EXD A;  1X54 A;  4X66 L;  3G71 A;  5LMU Q;  1EQR A;  1VQD A;  2WP8 J;  2KCM A;  3PCO B;  2H5X A;  4DNI A;  4JYA L;  3OYY A;  3AEV A;  4JI5 L;  2NN6 I;  4IO9 A;  3NBH B;  1Q12 A;  5C0X G;  1WOC A;  1VCI A;  3S1R H;  4BY1 H;  4P73 A;  1EWI A;  2F52 A;  1PH8 A;  4C3I H;  3RLF A;  1EFW A;  4HIK A;  1HR0 L;  3CW2 C;  4A3M G;  1Y14 B;  2K50 A;  3I4M H;  1OXV A;  3G48 A;  1S3O A;  2K5H A;  2I5L X;  1PA6 A;  1SFO H;  1PHJ A;  2UUC L;  4Y7N H;  1LTL A;  1I94 L;  3TRZ A;  2LXK A;  1FGU A;  1C7Y A;  4LF5 L;  2K75 A;  2K52 A;  1NE3 A;  3CAM A;  1X3G A;  4YHH Q;  2JA6 H;  4DR7 L;  4K0K Q;  2UXD L;  2ID0 A;  1KAW A;  4X66 Q;  2IX1 A;  1Y1V H;  5M5Y H;  1V9P A;  3IRB A;  4RG1 A;  1IBL L;  4JI4 L;  3K7A H;  1PFS A;  2NVX H;  1NMG A;  5C4X H;  4NXM L;  4A3D H;  2YV5 A;  2VUM G;  3HOY H;  1SN8 A;  5LMN Q;  4P71 A;  1BBU A;  2E8G A;  2Z6K C;  4R4T A;  4YCU A;  3F2D A;  4YWL A;  3CMA A;  1HNZ Q;  3W1B A;  1Q46 A;  3I4O A;  2VL6 A;  1PH3 A;  4B3M L;  4IOA A;  3HOY G;  2VQF Q;  1YHA A;  2D62 A;  2ES2 A;  1PYB A;  5C3E G;  1IL2 A;  1VQC A;  4UY8 C;  4P72 A;  1OXT A;  2ALY B;  3A74 A;  4AQY L;  4A3F G;  5BR8 Q;  3CC4 A;  4LFA L;  2KCT A;  2UXB L;  3KF6 B;  3EBE A;  5C0X I;  4DV2 L;  2D0P A;  5IP7 H;  2AWN A;  4A3E H;  1N32 Q;  4JC0 A;  1VQB A;  5FJ8 H;  4NB3 A;  4KHP L;  1Z47 A;  3J80 i;  3BZK A;  1Y1W H;  2NVQ H;  1I5F A;  1V43 A;  4DR4 L;  3I4N H;  4BA2 I;  1VQ7 A;  2MO1 A;  5FLX c;  1N36 L;  2Z0S A;  1MIU A;  1SR3 A;  1K83 H;  1VQH A;  4XIG S;  1TXY A;  3KLW A;  2B63 H;  4GKK L;  4POF A;  1FJG L;  1HNW Q;  3LGJ A;  1E7Z A;  3NEM A;  4R4I A;  4BBS H;  4IPH A;  4IPD A;  3CQZ H;  1GD7 A;  4JYA Q;  4BA1 I;  2OWO A;  5LMN W;  4LF7 L;  1L1O A;  2UUA Q;  2RHQ B;  1X6O A;  1I50 H;  1ASY A;  2PNH A;  2ZM6 Q;  4ME3 A;  3H0G G;  3HOU H;  2PQA B;  1VQA A;  2EIF A;  4L5Q A;  2R6G A;  1N33 Q;  1W2B A;  4DV1 L;  1VQ5 A;  4OX9 Q;  2QEX A;  2A19 A;  1RL2 A;  5AJ3 L;  4X62 Q;  1XNR Q;  4P74 A;  1Q82 C;  3S15 H;  1LUZ A;  2CKZ B;  2OCE A;  1I94 Q;  1BVS A;  1TWF H;  3GTQ H;  3PO3 H;  2XGT A;  4Y52 H;  4B3T L;  2N3S A;  3J7Z C;  1S72 A;  1X65 A;  4X65 L;  2A8V A;  3HOZ G;  1AH9 A;  2HQL A;  2JEB I;  1VQF A;  2Y0S E;  3S1N H;  2OQ0 A;  4JI2 L;  2JJQ A;  1L0W A;  4C2M H;  2PI2 A;  2VNU D;  1E22 A;  4JI0 Q;  1XPU A;  3E9I A;  3STB D;  2KHI A;  4DR5 L;  2Q2I A;  4IJL A;  4BBR G;  1KD1 C;  1SRU A;  4GLA C;  1KQS A;  2E2I H;  2AHO B;  2UU9 L;  4A3I H;  1HZC A;  2NZH A;  4DV5 Q;  1J5E L;  5IT9 c;  5GAH C;  4DR3 L;  3CC7 A;  1UE1 A;  4QGU A;  4JV5 L;  2F4V Q;  2I5H A;  1E3P A;  5BR8 L;  5IE8 A;  5GAD C;  1EIY B;  5C4X G;  4DV2 Q;  4LF6 Q;  4A93 G;  1KXL A;  3L0O A;  1A8V A;  3A5U A;  4DR1 Q;  1JJC B;  1P8L A;  4RMF A;  3E0E A;  1GKH A;  2NZO A;  2B3G A;  4JI6 Q;  2K5N A;  2MQH A;  3S17 H;  4DR4 Q;  1UE6 A;  1VQK A;  4DR7 Q;  1L2F A;  1YBY A;  2MO0 A;  5FLM H;  1QZH A;  4PZ8 A;  1TWC H;  3HOW H;  1VQO A;  3GTG H;  4JBW A;  4MTN A;  4GNX B;  4IOC A;  1YHQ A;  2Q2H A;  1S40 A;  2R7D A;  1NY4 A;  4DV6 L;  4AYB E;  1CKN A;  4A3C H;  5LMN L;  4A3G H;  4JI5 Q;  2E2J H;  3HOZ H;  2IT1 A;  3M4O H;  1N9W A;  2I5M X;  1XMQ L;  1HNX Q;  3CXC A;  2ZJR A;  1HNZ L;  4LF8 Q;  4R4O A;  2Y0S G;  4JI3 L;  1IBK Q;  4OWW B;  5K36 G;  1O7I A;  2D0O A;  1OTC A;  2JA8 G;  4BXX G;  1QUQ B;  3CCS A;  2BA1 A;  1XMO Q;  2Z6K A;  3SGI A;  3U50 C;  3F2C A;  1H95 A;  4BY7 H;  2VZA A;  3E9H A;  3KDF B;  3M4Q A;  4GKJ Q;  4A3B H;  3KJO A;  1HR0 Q;  2NN6 G;  3CP0 A;  1VQG A;  1U0L A;  3KF8 B;  4LWC A;  3FKI H;  2WB1 G;  4P75 A;  3PSI A;  3OTO Q;  1JB7 A;  4A3G G;  4B3T Q;  4APV A;  4DR6 L;  3H0G H;  3HOU G;  2YTX A;  1WI5 A;  3A5Z B;  4MZ9 A;  4UP8 A;  4HJA A;  1N34 L;  3CF5 A;  3HOV G;  1TWA H;  3ER0 A;  2UUB Q;  1B70 B;  1W3S A;  4JOI A;  2N78 A;  5M3M H;  4IJH A;  4LFC L;  1IBL Q;  1FVI A;  4BXX H;  4GKK Q;  1EQQ A;  5GAG C;  2ASB A;  4A3B G;  1CSP A;  4LUZ A;  4HJ8 A;  1PH9 A;  3ULJ A;  4DR5 Q;  1QVF A;  3AQQ A;  4LF7 Q;  2MNA A;  1WJJ A;  3K8A A;  1D8L A;  2R7F A;  1A62 A;  4L5S A;  4DV1 Q;  4JI8 L;  1VQ9 A;  4OX9 L;  4AYB G;  3S24 A;  3J7A 5;  4A3F H;  1CKM A;  1SE8 A;  3EN2 A;  3MEF A;  1HZ9 A;  2ZTE A;  4NPS A;  5IWA Q;  3Q8D A;  2QA4 A;  4GNX C;  1QZG A;  4A4I A;  2MFI A;  1Y1V G;  2R92 G;  4O0A A;  5FJ8 G;  1VQN A;  1FL0 A;  1LM0 A;  3PIP A;  4OXP A;  5IP7 G;  2BH8 A;  3DLL A;  4L5T A;  4GOP C;  4A3E G;  2R7Z G;  4A3L H;  3RN2 A;  2UUC Q;  3U58 A;  2PI2 E;  4WJ4 A;  2Q2U A;  4LFC Q;  4DKA C;  3S1M H;  1PH4 A;  5IYD H;  2UXD Q;  4HJ9 A;  3KFU A;  3CME A;  4LF4 Q;  2ZJP A;  2OTJ A;  4JI0 L;  1VQJ A;  4X64 L;  1Q7Y C;  1Q8K A;  2GN5 A;  4JG2 A;  3VDY A;  2R7Z H;  2K14 A;  3CCR A;  2RCN A;  1VQI A;  2R92 H;  1XJV A;  4DV7 L;  1FJG Q;  3L7Z C;  4B3M Q;  3S16 H;  1EUJ A;  2JQO A;  3RLO A;  4C3H H;  4JV5 Q;  3M85 A;  1J5E Q;  5IP9 H;  3CPW A;  1P16 A;  3GO5 A;  4JOI C;  4TVA B;  4DR3 Q;  1SLJ A;  1Q86 C;  1Q1E A;  3PIO A;  4DV4 Q;  1VQE A;  3FKI G;  4AIM A;  1IBM L;  2LSS A;  2CWA A;  3CCE A;  1HJP A;  1N32 L;  3T1H L;  1VQ4 A;  3RZD H;  4GS3 A;  4KI0 A;  3TEH B;  4DR6 Q;  3FHW A;  5C44 H;  5M3F G;  4ALP A;  2R93 H;  4NXN L;  3GTL H;  2QGQ A;  1M1K C;  4A3J H;  3K80 C;  4LFB L;  4BY1 G;  1K73 C;  4GNX A;  2Q2T A;  1K3R A;  1UWV A;  4IPG A;  3I4N G;  1XNQ Q;  4DUZ Q;  3GTM H;  2VQE L;  1YVC A;  4OWX B;  4HJ5 A;  3PF4 A;  2K4K A;  1L1O B;  4J15 A;  4C3J H;  1ASZ A;  2LXJ A;  2JA5 G;  3UE0 A;  1KRS A;  4DV0 L;  1B7Y B;  1E1O A;  1T9H A;  2RHS B;  2ZTC A;  3PGZ A;  4DAY B;  2JA5 H;  1KHI A;  4JI3 Q;  2B63 G;  1OXU A;  2YTV A;  2NVT H;  3KJP A;  2ZJQ A;  2UXC Q;  3J80 c;  2HIX A;  5EAY A;  2WAQ G;  2ZM6 L;  4HJ7 A;  2HHH L;  3UDG A; 
#chains in the Genus database with same CATH topology
 1GUT A;  1YJ9 A;  5IOC A;  1PH1 A;  4BBS B;  3BDC A;  1TWG B;  2OQK A;  2UUB L;  4A93 B;  4JI1 L;  3KOJ A;  3ND9 A;  5C0X J;  3Q23 A;  3ULL A;  2F0D A;  5HGT A;  3U4V A;  3DUZ A;  5KNC A;  4QIW E;  5GRO A;  2IHE A;  1FGB D;  1G29 1;  5G3L D;  4J1M A;  5C3X A;  2C35 B;  4LF9 Q;  3M3Y H;  3TZD A;  1DGS A;  5C3E H;  1ICF B;  5EPL A;  4G7O C;  1SRO A;  1ESF A;  1U4L A;  5M5W B;  4CKB A;  1AE2 A;  5IGF A;  1W6J A;  1G51 A;  3FP9 A;  3HS0 C;  2NVY B;  3MVV A;  4WRD A;  3DXJ C;  3E5S A;  1SNQ A;  3HFZ B;  1IYJ B;  4YY3 L;  4LF4 L;  5CV9 A;  3AFP A;  4HID A;  3F8T A;  3TS0 A;  4PG3 A;  1B9M A;  4GN3 B;  4H44 C;  5FO9 B;  4YWM A;  1CUK A;  5NUC A;  2CH4 A;  2JA7 G;  4V0B A;  4DR2 L;  4GN4 B;  1ENA A;  4DV6 Q;  4JBM A;  3HOV B;  4QUF A;  1XTD A;  1RTO A;  1NTG A;  4ZK9 B;  2CCZ A;  1KRT A;  5IWA L;  1OO9 B;  1XPR A;  4RAU C;  3EVQ A;  1O80 A;  1SDF A;  2YU9 B;  3I91 A;  1M90 C;  4MIU A;  3SK8 A;  4AH6 A;  3PO2 H;  1YNJ D;  5M3M G;  1SNM A;  2AKW B;  4DK6 C;  3S14 H;  1JJG A;  2PZT A;  2D5D A;  1KDC A;  4BY7 G;  5A2Q E;  1K0S A;  2N55 A;  1LTA D;  5FK9 C;  1GHK A;  1HXY D;  1TKW B;  1BKB A;  1ONL A;  1PH5 A;  2CH4 W;  2UUA L;  5C44 G;  2FMM A;  5M5Y B;  2IJ0 A;  1A63 A;  5IYB H;  3SK4 A;  1IYV A;  1F9Q A;  4C2M B;  5E1F A;  4C1N K;  4OON A;  2KEE A;  2EOT A;  3HOY G;  3CRK C;  1Q81 C;  1CHP D;  1KC8 C;  2F0H A;  2XWJ B;  4PMC A;  1I50 B;  1HRJ A;  4A3C G;  1SEB D;  2Q8I B;  2VW9 A;  4QQB X;  1PXU A;  3GTJ H;  4PV1 C;  2EDG A;  4ULL A;  1NJI C;  1KDA A;  4FF1 A;  2Z4H A;  1NMF A;  3I4N B;  1XNQ L;  1XNR L;  4JBJ A;  2ATW A;  1A2T A;  5CV8 A;  1HUM A;  2KHJ A;  3AYH B;  2KOL A;  4X62 L;  3J80 E;  1N33 L;  3PV0 A;  1R4P B;  1X3P A;  2PO4 A;  1GVP A;  2N49 A;  1RF2 D;  5CGK A;  4YWK A;  2B2U A;  3BJU A;  3PO3 G;  2AUK A;  4JPB W;  2ZXO A;  2A73 B;  1GM5 A;  4NXN Q;  2KHS A;  2WAQ E;  1CKN B;  4G57 A;  4Y7N B;  3G6E A;  1CFM A;  3F2B A;  4IUV A;  1TT2 A;  4KY6 A;  2EJG C;  3WWV A;  1WTO A;  2WFW A;  2CFM A;  4LF6 L;  1QUQ A;  3HKZ G;  5J3B A;  1UE7 A;  4OHJ A;  4JBK A;  1G6P A;  1GO3 E;  4LFA Q;  1EWC A;  3D0F A;  5IYC G;  1Q1B A;  2EYO A;  3I2Z A;  2HHH Q;  2DUD A;  2XIW A;  3GTO H;  5COR A;  1EOV A;  5EBC A;  4DV3 L;  4B3S L;  4A3K G;  3PUW A;  2F03 A;  1EEI D;  1WTV A;  3STB C;  3OPO A;  4K6L A;  1AFP A;  4K5W A;  4YCW A;  1HNX L;  4A3J G;  1STA A;  3G71 A;  4C3I B;  1VQD A;  1VDZ A;  2KJX A;  2WP8 J;  2KCM A;  3H0G B;  3PCO B;  4FVM A;  4JYA L;  4JI5 L;  1F9P A;  4IO9 A;  3TP7 A;  1JOO A;  4KJO A;  1WOC A;  1VCI A;  5EGT A;  4ZYS A;  1PH8 A;  3BVZ A;  1EFW A;  3I4M H;  3M4O B;  2K50 A;  1AW7 A;  4RCO A;  2K5H A;  1NR4 A;  4F88 A;  1SFO H;  4K8J A;  4X3K A;  4LF5 L;  3CRL C;  3CAM A;  1X3G A;  4EQN A;  4K0K Q;  1ET6 A;  3LX0 A;  4X66 Q;  1Y1V H;  1IBL L;  4NXM L;  3K7A H;  1NMG A;  1GUN A;  4XYQ A;  3NQI A;  4IUU A;  4HR7 B;  1LT6 D;  2ICE C;  4YCU A;  3TP5 A;  5ELE A;  1B9N A;  4RGO S;  4HTH A;  1TR5 A;  2VQF Q;  5JJZ A;  5C4X B;  2LY7 A;  3EQL C;  1PYB A;  1JR0 D;  1VQC A;  3RD4 A;  4A3F G;  1WTQ A;  3ERO A;  2QCP X;  3M7G A;  4A3E H;  1STN A;  1WD0 A;  1TQO A;  2B2Y C;  1N32 Q;  4ZUJ A;  1Z47 A;  1Y1W H;  1I5F A;  1DD2 A;  1VQ7 A;  3I3C A;  2MGS A;  3HEJ A;  4CDE C;  1NUC A;  2DN8 A;  2M00 A;  2G5D A;  1RD9 D;  3GTO B;  3PO2 B;  1E7Z A;  2K5Q A;  4BBS H;  4IPH A;  4JYA Q;  4C1N I;  1GD7 A;  5LMN W;  2FJ2 A;  2UUA Q;  1X6O A;  4LJZ C;  4ME3 A;  1W2B A;  4ZQ3 A;  1JWS D;  2EPB A;  1Y8P B;  1I94 Q;  2NWG A;  4BY1 B;  1TWF H;  3KUP A;  4Y52 H;  4B3T L;  2N3S A;  1GXD C;  3DEP A;  3HOZ G;  1FNV A;  1MSH A;  4A3I B;  2K33 A;  3GTQ B;  3PO3 B;  1XPU A;  1HFG A;  4IJL A;  2A5H A;  1SRU A;  2B2T C;  4GLA C;  3NBH A;  2E2I H;  2AHO B;  1HZC A;  3OMG A;  1I6H B;  1DOL A;  5IT9 c;  5CC4 A;  3EA6 A;  2G9H D;  4QGU A;  1H9M A;  1E3P A;  3E0J A;  4RHS A;  4LF6 Q;  4JW0 A;  1A8V A;  3A5U A;  1JJC B;  2H4O A;  3HKZ B;  2NZO A;  2B3G A;  1O7Z A;  2A74 C;  4RHR A;  3Q24 A;  2K5N A;  4DNR B;  1L2F A;  1YBY A;  1PZI D;  1QZH A;  2A69 D;  3D4D A;  4PZ8 A;  1TWC H;  3P75 A;  4JBW A;  4MTN A;  4MHE A;  1YHQ A;  4A3K B;  1NY4 A;  4DV6 L;  1Q3L A;  1TS3 A;  3BVM A;  5T1I A;  4N9T A;  4DK0 A;  3I72 A;  1DM0 B;  1N9W A;  2I5M X;  5KNB A;  1PFM A;  2Y0S G;  2DY8 A;  5FLX L;  5K36 G;  3J7A V;  1K83 B;  1CI3 M;  1FR3 A;  3SGI A;  2XRQ D;  3F2C A;  5EPK A;  2VZA A;  1ZEQ X;  1TWA B;  1Z7T A;  2BE5 D;  1SYF A;  2NN6 G;  4P75 A;  1KDB A;  1YNN C;  4B3T Q;  4APV A;  3U9O A;  2NTS A;  3V2T A;  3MXU A;  1ET9 A;  1GUO A;  4IJH A;  4LFC L;  1D5X C;  1I6V C;  5AFW A;  1G8Z D;  1GOZ A;  4GKK Q;  3DWP A;  2ASB A;  2A69 C;  4HJ8 A;  1PH9 A;  2EVB A;  3IFT A;  4QMG A;  4JI8 L;  3S24 A;  1PTO F;  4OO1 I;  1KLU D;  1HZ9 A;  2ZTE A;  5M9O A;  2RDG A;  5ELF A;  1Q90 A;  5FJ8 G;  3BVG A;  1FNU A;  1VQN A;  1FL0 A;  4OXP A;  5IP7 G;  4GOP C;  2LS0 1;  3U58 A;  4A3F B;  5J39 A;  4DKA C;  3S1M H;  2I46 A;  1QNK A;  2K03 A;  1LTS D;  3KFU A;  3BYT B;  3QOJ A;  3VDY A;  2K14 A;  2RCN A;  1RDP D;  3SEB A;  2V4D A;  1BCP C;  3R3O A;  3SXH A;  4ZKC B;  1B3Q A;  3S1Q B;  1RJT A;  1SLJ A;  4CDC C;  1K8O A;  1IKM A;  4DV4 Q;  2PNR C;  2A68 D;  2CWA A;  4FXG C;  1TS4 A;  1HJP A;  2L4N A;  1CK1 A;  3RZD H;  4DR6 Q;  2HDM A;  5M3F G;  2JA7 B;  3GTL H;  2HDL A;  1HTL D;  4A3J H;  3K80 C;  4HCE A;  4BY1 G;  3S15 B;  3T13 A;  1E2Z A;  4C3J G;  2CW0 D;  1NCV A;  1XNQ Q;  5CR3 A;  2VQE L;  4OWX B;  2D2C C;  4C3J H;  2LXJ A;  3A7L A;  1KRS A;  1DXM A;  2ZTC A;  1T9H A;  3PGZ A;  1I4G A;  1OXU A;  2UXC Q;  3KBX A;  1H9R A;  4X3S A;  2ZM6 L;  4M1U B;  4L5R C;  4IQZ A;  2XTI A;  3QR8 A;  1PVO A;  2Z9H A;  3CC2 A;  1HA6 A;  5T1G A;  4Q5V A;  3L2P A;  1IYU A;  4I65 A;  4B3R Q;  1R9T H;  5I9O A;  2R92 B;  2EY6 A;  5JAV A;  1SXT A;  5J1Z A;  1BO0 A;  1TVX A;  3S2D B;  4YY3 Q;  1S5C D;  1LYL A;  2JA6 G;  1EY7 A;  1BOS A;  2NBF A;  3HOX G;  3K7U C;  4MN3 A;  4JI8 Q;  1VQL A;  1G2S A;  2P5Z X;  2VS1 A;  4CHT B;  1HHV A;  3C1E A;  2E5L Q;  2JEA I;  3F1Z A;  5D14 A;  1V1Q A;  4EX5 A;  5FKA C;  2JSO A;  1K9M C;  3M3Y B;  3BZC A;  3A0J A;  4DR1 L;  1TWH H;  2PQE A;  4OWT B;  5GQO A;  3BDO A;  1LV9 A;  4BBR H;  1EIF A;  3NPP A;  2WB1 B;  4DXF A;  2EYJ A;  3PUX A;  1T5E A;  4R4C A;  1DCZ A;  5IT9 E;  4J6H A;  3X3N A;  5EPJ A;  2B39 A;  3OWE B;  3P1H A;  5F2D A;  3JAM i;  3T16 A;  1G6Z A;  4IFD I;  1H9J A;  3KF6 A;  4R1J A;  3CCJ A;  2F0T A;  2XN9 C;  1HUN A;  3CCM A;  3QO2 A;  3ULP A;  4FYD A;  3K5L A;  2JE6 I;  2WIN B;  4A3E B;  4BBS G;  5H1S E;  1VS0 A;  1F77 A;  4QJF A;  1Y1W G;  5M3F H;  4GLX A;  2K05 A;  4KKT A;  1ZYR C;  4B9W A;  3GDE A;  3CCQ A;  4ILW A;  3HOW G;  1S5E D;  1Z6H A;  2QDL A;  2PW5 A;  3S1M B;  3I70 A;  1UEB A;  1YIT A;  3NEN A;  1IW7 D;  5J22 A;  1X55 A;  1WTW A;  3BDL A;  3QB3 A;  3ZJY C;  2JA9 A;  3OW2 A;  1HNW L;  3K81 C;  5M5W H;  4C3I G;  3NUC A;  1GHJ A;  4DAM A;  3PUV A;  1EIH A;  4A75 A;  3TN2 A;  1CA6 A;  1I3Q B;  1BXT A;  2F3I A;  2KEN A;  1MJE A;  2CWP A;  1D5M C;  3HKS A;  3H3V H;  1D7Q A;  1XWE A;  1EEF D;  3M9B A;  4LFB Q;  2O5I C;  2DGY A;  1RIP A;  3EJI A;  2VQF L;  4FDB A;  4ID6 A;  1TWG H;  1HPC A;  1X3F A;  4KHZ A;  2I0Q A;  1YHB A;  3I8Z A;  3CCL A;  1JE5 A;  2E74 C;  1ZKO A;  4JI6 L;  3I55 A;  4QIW B;  2X69 A;  4JCV E;  4RCN A;  4JI1 Q;  5HY6 A;  4JI2 Q;  2K6A A;  3SVM A;  4NXM Q;  4IPC A;  1BDO A;  5GAE C;  1S5B D;  3S1Q H;  1BCP D;  2DNC A;  1J6Q A;  5IYB G;  1J9O A;  3A8K E;  3M4P A;  5IGG A;  1XXG A;  1U4P A;  4KD3 A;  1YI2 A;  4HIM A;  1X3E A;  5C4H A;  4CKE A;  2NVY H;  2VXW A;  3TZU A;  4A3K H;  1TY2 A;  2EJM A;  3A55 A;  2MP1 A;  5C44 B;  2F4V L;  1CSQ A;  4F87 A;  5AJ3 Q;  1X32 A;  4JVZ A;  4NW2 A;  3HOV H;  3QG1 A;  4XQN A;  2KQ3 A;  1K8A C;  2IHF A;  4LNQ A;  4CDD C;  1C8C A;  4CBV A;  4QUC A;  4POG A;  3CCV A;  1WCM G;  2KCN A;  5CBA E;  4G7H C;  5I4D A;  2B2W C;  2E2H H;  1VQM A;  1JQY D;  5HGQ A;  2EZV A;  4DR2 Q;  2K5V A;  3DM1 A;  1KNA A;  1MI2 A;  4DA2 A;  4DAP A;  3K5N A;  2NVQ B;  2H5X A;  5CYU A;  3NP8 A;  2JN4 A;  3NTI A;  1UAP A;  3RZO B;  1TWH B;  1VF7 A;  3RLF A;  3V05 A;  3NSW A;  3G48 A;  1PHJ A;  1ROD A;  1I94 L;  2LXK A;  1FGU A;  1EWH A;  1NE3 A;  1ILP A;  4DR7 L;  5M5Y H;  3IRB A;  3BYY B;  3K57 A;  1PFS A;  1K3B C;  4ZAI A;  2VUM G;  2F0J A;  5LMN Q;  1BBU A;  5DAU A;  4AYB B;  4IUN A;  3F2D A;  1KAB A;  4YWL A;  3I4O A;  1NAP A;  1PH3 A;  1YHA A;  2RA4 A;  2L55 A;  3GTL B;  3S17 B;  1DOM A;  3FPU B;  4P72 A;  3CC4 A;  2ALY B;  2F0Q A;  3A74 A;  3H09 A;  1EY8 A;  2KCT A;  2VB3 X;  5C0X I;  1BCP B;  4JC0 A;  4NB3 A;  4KHP L;  3BZK A;  1ML0 D;  2N88 A;  2MO1 A;  5FLX c;  3J81 L;  2Z0S A;  1MSG A;  1S5F D;  1TXY A;  1EY4 A;  3KLW A;  1HNW Q;  1BUV T;  1F2M A;  3LGJ A;  3MWY W;  3CQZ H;  2X6L A;  1L1O A;  2RHQ B;  3FRP B;  5D65 A;  4A3J B;  2F0F A;  1U4R A;  4KY5 A;  1V1P A;  1SNO A;  4L5Q A;  2EIF A;  1H9S B;  4B08 A;  4OX9 Q;  1EY6 A;  1Q82 C;  3S15 H;  3SDZ A;  5L37 A;  3H3V C;  4F7X A;  3K5M A;  4C3H B;  1JWU D;  3NTK A;  3J7Z C;  1ILQ A;  1LLR D;  2HQL A;  4OEL B;  1LTT D;  2IWH A;  1JOQ A;  1PRT C;  2JJQ A;  1F2Y A;  4CKC A;  5FLX E;  2VNU D;  4JI0 Q;  1PTO H;  3QIA A;  2KHI A;  3BS1 A;  2Q2I A;  1KD1 C;  2WAQ B;  1SE3 A;  1KQS A;  3NTH A;  2UU9 L;  2TMP A;  1JWM D;  4ZCK A;  3CC7 A;  4JV5 L;  1A15 A;  1B1Z A;  5C4X G;  3F2U A;  4A93 G;  3L0O A;  3GTG B;  4KTA A;  4RMF A;  4K8I A;  2CHB D;  1E2W A;  2B2Y A;  2WAC A;  4KV6 A;  3S17 H;  4DR4 Q;  1UE6 A;  2K5D A;  3ND8 A;  3DEO A;  5E3F A;  1EU4 A;  3WDN A;  1VQO A;  4H7B A;  1S40 A;  2R7D A;  3A54 A;  4AYB E;  5LMN L;  3BZD B;  4JI5 Q;  3LWE A;  2E2J H;  1ZXT A;  2NN6 H;  3CXC A;  2B2V A;  1IBK Q;  2D0O A;  3MAQ A;  2QEJ C;  3D6C A;  3FKI B;  3SK6 A;  1H95 A;  2MHV A;  3KDF B;  1GJX A;  4A3B H;  2OF1 A;  2J4X A;  3K7A B;  1EYA A;  3R2I A;  4ODG A;  1VQG A;  1U0L A;  3FKI H;  3S2H B;  2AQ1 B;  3O13 A;  1YNN D;  1CTM A;  2OT2 A;  4DU9 A;  4A3G G;  1CA5 A;  1AEX A;  2YTX A;  1WI5 A;  4HJA A;  3HOV G;  3CF5 A;  3ER0 A;  5D3I B;  2UUB Q;  1W3S A;  4JOI A;  1IBL Q;  4KKU A;  4BXX H;  1PRT D;  2L1B A;  2WKC A;  1EQQ A;  1LT3 D;  3NQT A;  4LUZ A;  5KGU A;  4QB4 A;  3AQQ A;  2PCF B;  2VUM B;  2A6E D;  3K8A A;  3Q6S A;  5M3M B;  2R7F A;  1A62 A;  4L5S A;  4OX9 L;  1VMC A;  1CKM A;  1F9S A;  1SE8 A;  5ELC A;  1QZG A;  3MFG A;  4XT3 B;  4IUT A;  2G9D A;  4KY7 A;  3OIP A;  1Y1V G;  2NUC A;  5LHY 1;  3DLL A;  2BH8 A;  4L5T A;  1CZW A;  1O7L A;  2RSN A;  4L6T B;  3OWF A;  3URY A;  3TDQ A;  5IYD H;  3IAY A;  3D4W A;  1Q8I A;  4HJ9 A;  5IIF A;  2ZJP A;  3J7A F;  2A6H D;  1VQJ A;  3H94 A;  3OHX C;  2IPK D;  2F0V A;  2QIL A;  1FD7 D;  5FO8 B;  2FFK B;  1V8Q A;  3CCR A;  2L0C A;  2R61 A;  2R92 H;  3IKJ A;  1XJV A;  4DV7 L;  5LL6 X;  3S16 H;  4C3H H;  3D8G A;  3RLO A;  1CZG A;  1J5E Q;  1QNU A;  4RGM A;  4JOI C;  1TU2 B;  3CQZ B;  2ZXP A;  1K28 A;  1XYI A;  2A6E C;  3HOY B;  3S1N B;  2NZ1 D;  2F0K A;  3MXG A;  2WII B;  4AIM A;  1IBM L;  2EYF A;  3CCE A;  2EYL A;  1CQF A;  1N32 L;  4KI0 A;  2AQ3 B;  4ALP A;  2R93 H;  4KHV A;  2DY7 A;  4NXN L;  3VR2 A;  4LFB L;  2XNA C;  2EY1 A;  1V1O A;  1UWV A;  4IPG A;  3HOU B;  3NWT A;  4LMQ D;  4DUZ Q;  3GTM H;  1A2U A;  4L8J A;  1YVC A;  3PF4 A;  3LNN A;  4HJ5 A;  3DWQ A;  2JA5 G;  5CV6 A;  4DV0 L;  1B7Y B;  4DAY B;  2RHS B;  2JA5 H;  4X3T A;  2YTV A;  3KJP A;  4DAV A;  1PMR A;  2RQX A;  3J80 c;  2HIX A;  1B4O A;  2KVM A;  3J81 E;  3WOF A;  4R9W A;  4YCV A;  4F8M A;  1NBW A;  1A0I A;  1C9O A;  3L9A X;  1YJW A;  2F0M A;  3HKZ E;  4JK1 C;  1KTK A;  1N34 Q;  1MJC A;  2L5T A;  3VYT A;  1PV4 A;  2FHT A;  2X6G A;  3DMU A;  5I6Y A;  3S14 B;  2JXM B;  1JOR A;  4R8N A;  4CJ0 B;  4X6A H;  4IFD G;  1SYE A;  3I4M G;  4R4Q A;  5BN3 A;  2EQS A;  5EKK A;  4K6D A;  2K1B A;  2IX3 A;  4QL5 A;  3K58 A;  3KYH C;  4PZ7 A;  4DV3 Q;  1I4H A;  3CU7 A;  3RZO H;  3C2P A;  1ENC A;  3QWN A;  5G3L F;  3RMH A;  3G4S A;  1HA5 A;  4A3L G;  3VR5 A;  1A3U A;  1UUP A;  1NNX A;  2RF4 A;  5JPM C;  3GD7 A;  4Q0F A;  5JVG 3;  1PFB A;  2I07 B;  1VQ8 A;  2MJ8 A;  2CQO A;  2PZW A;  2PMZ B;  4OO1 G;  3GTP H;  1JOK A;  5IY0 A;  1XTC D;  4K5X A;  4UP9 A;  5IYC H;  3NHH A;  2VY3 A;  4TSS A;  1IZ6 A;  1PTO C;  3J81 c;  3H3V I;  4GOP B;  1WCM H;  2GVB A;  2KBN A;  1BNZ A;  4GN5 A;  2E76 C;  3T1H Q;  5JJL A;  1O7Y A;  4RGT A;  1QIL A;  4HSV A;  2BOS A;  1TS5 A;  4YHH L;  3WOE A;  1QWY A;  4KN7 C;  1YZ6 A;  2A1A A;  2C5C A;  3D31 A;  3LWU A;  2JYO A;  4PNY A;  4X64 Q;  2R93 G;  4DV7 Q;  3RR5 A;  1TS2 A;  1ZYR D;  3EIV A;  3K0Y A;  2O4X A;  1PDQ A;  1JC7 A;  4DAY A;  3ICE A;  1M8A A;  2UXB Q;  2JA7 H;  2JA6 B;  1DON A;  1V1P B;  4XTC S;  4IN3 A;  5DM6 3;  3SE0 A;  3HOX B;  2PQA A;  5DLQ E;  1B8A A;  3E3X A;  2F3V A;  1BQQ T;  4TQU S;  2K5W A;  3V96 A;  4PQX A;  1SAP A;  4B3R L;  1A3V A;  4YIJ A;  1I3Q H;  3FEW X;  4DUY L;  3QOL A;  1AZP A;  2JA8 H;  3PUZ A;  2IX0 A;  2VUM H;  1WTR A;  2ZTD A;  2YU9 H;  2F0P A;  3OSO A;  1QVC A;  1HZA A;  3L3O C;  5IYD G;  1CQV A;  1F9R A;  3GV3 A;  1F2L A;  3CPF A;  2WB1 E;  3K59 A;  1LO5 D;  4BWG B;  4C56 C;  1BBW A;  3RN5 A;  1G2T A;  2EYP A;  3T1Y L;  3MXP A;  3W5O A;  4DUY Q;  4A3D B;  2JK8 A;  3HOZ B;  2B63 B;  3FVQ A;  2KA7 A;  5C4J B;  1KL9 A;  4MNO A;  1HR0 W;  3M7N A;  4A3I G;  1EYG A;  3E6Z X;  4WFN 3;  2AUJ D;  1EL0 A;  5IGC A;  5C5L A;  4UP7 A;  2B29 A;  1KIX A;  1C0A A;  2PW7 A;  4WJ3 M;  2GVA A;  3EFX D;  4LF8 L;  1IBK L;  2EE1 A;  4FO2 A;  3C1F A;  3ERS X;  1RCV D;  3T1Y Q;  4UPA A;  3DM3 A;  5LMU L;  1E1T A;  5ELO A;  1YEZ A;  1YJN A;  2BE5 C;  4QY7 A;  4XYO A;  2E5L L;  5I2Y A;  2KED A;  3HP3 A;  1OXS C;  3W1G A;  3AMU A;  3HOW B;  3AU7 A;  2RBM A;  2F4I A;  4GLV B;  1E24 A;  5JEA J;  1XPO A;  1SSO A;  4NDX A;  5E4X A;  2BDN A;  4IFD J;  2FIN B;  2EXD A;  5LMU Q;  5ELB A;  4DNI A;  1LAB A;  2F0S A;  3OYY A;  5LL6 S;  2SDF A;  2NN6 I;  1JB3 A;  4Z9C B;  1TWC B;  3NBH B;  1Q12 A;  4H13 C;  5C0X G;  4BY1 H;  4O42 A;  1ESR A;  4P73 A;  4G4K A;  1MGS A;  3TBI B;  3J7Y W;  5EKL A;  1HR0 L;  3CW2 C;  1Y14 B;  3OMC A;  5A35 A;  1T5X D;  1LTG D;  1CHQ D;  4H0L C;  4R8I A;  2I5L X;  1PA6 A;  1F2Z A;  2UUC L;  1LTL A;  3TRZ A;  1C7Y A;  3A56 A;  3GV6 A;  2GA4 B;  2RVL A;  4YHH Q;  3S16 B;  2UXD L;  2ID0 A;  1D5Z C;  1KAW A;  1V9P A;  2A68 C;  1PTO D;  1RKN A;  1D2B A;  1SE2 A;  4BY7 B;  1U9R A;  3UI2 A;  1FYC A;  4R4T A;  4N8F A;  3CMA A;  1HNZ Q;  1M4V A;  4IOA A;  4B3M L;  2VL6 A;  5JEA H;  3N6R A;  1STG A;  1SE4 A;  4OEM B;  2R7Z B;  3VA7 A;  5BR8 Q;  2HQE A;  1AZQ A;  4LFA L;  3KF6 B;  3EBE A;  2VB2 X;  5IP7 H;  5M5X B;  3NK9 A;  5FJ8 H;  3RUZ A;  2E2J B;  3J80 i;  3T53 B;  2NVQ H;  4DR4 L;  4K2K A;  3I4N H;  2XSC A;  1N36 L;  5C5M A;  1K83 H;  2F1M A;  1VQH A;  2Q8R E;  4POF A;  1FJG L;  1WCM B;  3MHB A;  2IW3 A;  4BA1 I;  2OWO A;  4NP5 A;  4WJW A;  2PYK A;  1I50 H;  5EKI A;  2PNH A;  3HOU H;  2ICI A;  2PQA B;  5JVH 3;  4OIK A;  2R6G A;  1L0X B;  1PFN A;  1E2V A;  3T56 B;  1VQ5 A;  1N33 Q;  2QEX A;  4A3G B;  4IUQ A;  1RL2 A;  5AJ3 L;  4X62 Q;  2KEC A;  3UDG A;  1STB A;  2K28 A;  3J80 L;  1BVS A;  3M4Y A;  2F0I A;  4RA8 A;  1X65 A;  1S72 A;  2A8V A;  1AH9 A;  2F0L A;  2JEB I;  2Y0S E;  5HUR A;  3S1N H;  2OQ0 A;  4JI2 L;  2RDH A;  3ITP A;  1L0W A;  2PI2 A;  1E22 A;  1EY5 A;  2SNM A;  3E9I A;  4TRD A;  1I4P A;  5I9P A;  2K32 A;  4K5V A;  4DR5 L;  4BBR G;  5FO7 B;  4QCL A;  1MHW C;  1Y1V B;  4A3I H;  1KNE A;  4DK1 A;  1RHP A;  1NR2 A;  1TY0 A;  5TSS A;  1J5E L;  1R9T B;  4E6I A;  4DR3 L;  2WV6 D;  2I5H A;  5BR8 L;  5IE8 A;  5C3E B;  2PPB C;  3E0E A;  3K5O A;  3GTM B;  3BG3 A;  1EZ8 A;  2SOB A;  5CV5 A;  4HMJ A;  1VQK A;  4DR7 Q;  1C48 A;  5FLM H;  3GTK B;  3HOW H;  4GNX B;  4ZUI A;  4A3C H;  1B53 A;  4A3G H;  1KLG D;  4KN4 C;  1TII D;  3HOZ H;  4ZLT F;  3FPP A;  1HNX Q;  2DNE A;  1HNZ L;  4TKO B;  3I73 A;  1O7I A;  1OTC A;  2JA8 G;  4O1N A;  1XMO Q;  3NXW A;  5DEH A;  4DN4 M;  3E9H A;  1LTI D;  2FMC A;  3U9S A;  3KJO A;  1HR0 Q;  4FF4 A;  2NVX B;  4RKB A;  2XWB B;  3CP0 A;  4WOR A;  4LWC A;  2WB1 G;  1EY0 A;  3W2D A;  4HAE A;  3OTO Q;  3GQB A;  3HOU G;  5ISR A;  4UP8 A;  3A5Z B;  4MZ9 A;  2CVR A;  1IW7 C;  1D1I A;  2RKS A;  3KBG A;  4XXE A;  1G91 A;  3VR4 A;  2NVT B;  4C3H G;  1B70 B;  1FVI A;  5GAG C;  1NSN S;  2EYM A;  2L11 A;  4DGZ A;  1CSP A;  1QVF A;  3ULJ A;  3SHL A;  5DNF A;  4LF7 Q;  4L63 B;  1JE4 A;  2QW7 A;  1VQ9 A;  4A3F H;  1H9S A;  4NPS A;  3MEF A;  5IWA Q;  2QA4 A;  3Q8D A;  4GNX C;  4A4I A;  1BCP F;  2MFI A;  1LM0 A;  3PIP A;  4A3E G;  2R7Z G;  4ME5 A;  2UUC Q;  2PI2 E;  4WJ4 A;  4KK7 A;  4EQP A;  1PH4 A;  4X3U A;  3CME A;  4LF4 Q;  4IZ8 A;  3R8B A;  1STE A;  1AN8 A;  4FF2 A;  2GN5 A;  4JG2 A;  1E0B A;  2B2W A;  2R7Z H;  2JP1 A;  1UNS A;  2D9U A;  4K14 A;  4RKL A;  1PLF A;  3PIO 3;  3L7Z C;  4B3M Q;  1EUJ A;  2JQO A;  4JV5 Q;  1J8I A;  2EYH A;  3GO5 A;  4DR3 Q;  1S5D D;  1H9K A;  1Q1E A;  2LKV A;  3VYU A;  1VQE A;  3FKI G;  2LSS A;  2F0W A;  2E2I B;  5KYL A;  3FDT A;  4GS3 A;  4OGQ C;  3TEH B;  5CBE E;  3JAM E;  4XQJ A;  2Q8T A;  4ZKB B;  3H6M A;  1M1K C;  3KLS A;  4GNX A;  2Q2T A;  3OW7 A;  5C6A A;  5JOB A;  3RZD B;  1L1O B;  4J15 A;  1ASZ A;  1Y69 U;  3UE0 A;  5K5P A;  3FMC A;  1KHI A;  2ZJQ A;  1ENF A;  1DZ1 A;  2M9V A;  5EAY A;  5D3D A;  4HJ7 A;  3TP6 A;  4A76 A;  2KUM A;  5CV4 A;  4FNF A;  3GTP B;  5DM7 3;  3TQY A;  2LMC B;  1HCZ A;  3BU2 A;  1K0R A;  1IXR A;  1YIJ A;  1JT8 A;  1I6H H;  4HIO A;  4JI7 Q;  2N8N A;  1FNW A;  4LAA A;  1VQ6 A;  1VQP A;  3A7A B;  2AWO A;  3TRE A;  2VQE Q;  5I6W A;  3PUY A;  1VMP A;  3JAM c;  3ZYY X;  4XQQ A;  1HH2 P;  4DV0 Q;  2IY5 B;  1PH2 A;  3SK5 A;  5EBD A;  5IGE A;  3JC6 6;  1I4X A;  1HZB A;  4HMI A;  4FP5 D;  1XMO L;  3IL8 A;  1MBY A;  3TP8 A;  2CW0 C;  5JJI A;  5JEA G;  2NYZ D;  1JMC A;  3A8J E;  4LUV A;  4DV5 L;  5ELN A;  4JI7 L;  4KMU C;  4GKJ L;  2HCI A;  2OXP A;  3CCU A;  4V19 0;  1Y8N B;  1HTP A;  1CT1 D;  1UEA B;  3UE1 A;  1PYW D;  2V1C C;  3HOX H;  3U4Z A;  3UDF A;  2MUY A;  3OTO L;  3ERQ A;  1QVG A;  4DNT B;  1K8G A;  1U5K A;  2K01 A;  3NWS A;  1QB5 D;  4LUO A;  1SMX A;  5IT9 L;  1HFN A;  1OXX K;  2HCC A;  3KLR A;  4O2D A;  3Q0A A;  4A3M B;  4A3D G;  4M8A A;  2ZT9 C;  1K8M A;  5C0X H;  5C3W A;  4KLK A;  1HQM C;  1UE5 A;  4DV4 L;  2NB0 A;  1BBX C;  4HCS A;  4K0K L;  3S2D H;  1WTP A;  2Z8L A;  2ZXR A;  2J0T D;  1O78 A;  3B6Y A;  2BH2 A;  2HIV A;  1GUW A;  3VR3 A;  3H15 A;  4B3S Q;  5M5X H;  4DF7 A;  1JJ2 A;  4OL7 A;  2C9O A;  3SR1 A;  5K36 H;  3G6J B;  4FXK C;  5C4J H;  4CDF C;  2F0G A;  3C3L A;  2EY5 A;  2F0N A;  2DJF C;  1W6K A;  3I7F A;  1SNP A;  5KRU A;  1N8R C;  1L1O C;  2UXC L;  2L15 A;  4HN7 A;  2BA0 A;  1CKO A;  2K7V A;  3K0X A;  1QJO A;  3NEL A;  2YYZ A;  1WYD A;  2QDB A;  3HGB A;  2M2L A;  5FLM G;  2BDO A;  4IAL A;  1YNX A;  3MXN B;  3PMF A;  1EYD A;  2RCF A;  3RLN A;  2QF7 A;  4UHV A;  1SMY D;  2TSS A;  3R2T A;  4U68 A;  1AP0 A;  1WFQ A;  1DYQ A;  1N36 Q;  4A3M H;  2PMZ E;  4LF5 Q;  1MD2 D;  1MKH A;  2HUG A;  2F0O A;  3VA5 A;  2AMC B;  4JI4 Q;  2IL8 A;  5IP9 G;  1BF4 A;  4LF9 L;  2QKI C;  3AFQ A;  3MTS A;  3CHB D;  3RNU A;  4CJ1 B;  3UDI A;  3GTK H;  2HT1 A;  4ABN A;  1IL8 A;  1IHZ A;  2Z1C A;  1D1K A;  5JJK A;  3I56 A;  1Z9F A;  1QOH A;  1EQV A;  2L9H A;  1IKL A;  4HSP A;  4A93 H;  3TS2 A;  2H1E A;  1X56 A;  4RWS C;  4DPG A;  4AQY Q;  2YTY A;  1IBM Q;  3HRZ C;  4XDX A;  4PMW A;  3UDX A;  3J81 i;  1R4Q B;  1PRT F;  5E4W C;  3T4A C;  1EIG A;  1X9N A;  4LW1 A;  4H02 A;  4OIJ A;  4PZ6 A;  4XT1 B;  2UU9 Q;  2ENB A;  4QF4 A;  1SYG A;  2OEO A;  4BS9 A;  3MA2 B;  3S2H H;  1SND A;  1PH6 A;  5E7N A;  5ELD A;  4DUZ L;  4DK3 C;  2FXQ A;  1PH7 A;  4EQ5 A;  1U4M A;  2K04 A;  2R93 B;  3DWA A;  3H91 A;  3C46 A;  1LTR D;  1LT5 D;  4GOP A;  4KJN A;  3KDF A;  3PF5 A;  2MPM A;  4KHP Q;  3KF8 A;  1PYS B;  4X65 Q;  3PO2 G;  3CD6 A;  3J81 j;  1II3 A;  4UDU C;  1AE3 A;  2OTL A;  1X3Q A;  2A6H C;  3S1R B;  1XMQ Q;  3N52 A;  1GUG A;  1X54 A;  1SJE D;  4X66 L;  5BN4 A;  3Q22 A;  1EQR A;  2SEB D;  2Z6B A;  3AEV A;  1C4Q A;  5CMD A;  1PZJ D;  3S1R H;  1STY A;  1EWI A;  2F52 A;  4C3I H;  4HIK A;  1EY9 A;  1EZ6 A;  4A3M G;  3MXN A;  5IOD A;  3KLS X;  1OXV A;  1S3O A;  4RH6 A;  4Y7N H;  2K75 A;  2K52 A;  3CKI B;  5COY A;  1Y8O B;  5FOB B;  2JA6 H;  1QE6 A;  2IX1 A;  2CQA A;  4JI4 L;  4RG1 A;  1WD1 A;  4A3B B;  2NVX H;  4A3D H;  5C4X H;  2YV5 A;  3HOY H;  1SNC A;  3MFY A;  1LAC A;  5KIX A;  1SN8 A;  4IFD H;  4P71 A;  2E8G A;  2Z6K C;  3QJY A;  3W1B A;  1Q46 A;  2F0E A;  2O2L D;  2D62 A;  3D3R A;  1BR9 A;  2ES2 A;  1Y1W B;  5C3E G;  2EY2 A;  3MEH A;  5JPN C;  2SNS A;  1IL2 A;  4UY8 C;  2BCO A;  1OXT A;  4AQY L;  3OOC A;  5A2Q L;  2UXB L;  4EVO A;  4DV2 L;  2D0P A;  2AWN A;  4P2C B;  4N8X 1;  4UAI A;  3S9W A;  5KND A;  2XRS D;  5CV7 A;  1VQB A;  1V43 A;  2L12 A;  2EXZ A;  2RDF A;  4IUR A;  4BA2 I;  2RSO A;  1B3A A;  1SYB A;  1MIU A;  1SR3 A;  4MTK A;  2F3W A;  4XIG S;  2B63 H;  4GKK L;  2JA8 B;  2HD3 A;  3DHQ A;  1VF5 C;  3NEM A;  3I90 A;  4R4I A;  4IPD A;  4LF7 L;  4GZY C;  1SYD A;  1EOT A;  3K6O A;  1ASY A;  2B2U C;  2ZM6 Q;  3R93 A;  3H0G G;  4I7Z C;  2E2D C;  1VQA A;  4DV1 L;  3W3A A;  2A19 A;  1XNR Q;  2XVS A;  4P74 A;  1LUZ A;  2CKZ B;  2OCE A;  1EU3 A;  4RFB A;  4KKS A;  3GTQ H;  3PO3 H;  2XGT A;  3GP7 A;  3HZX A;  1ICW A;  4X65 L;  1VQF A;  5KYI A;  2JA5 B;  4U67 3;  4C2M H;  1TWF B;  2B2V C;  3STB D;  3VYS A;  2B8F A;  1XX8 A;  2J7Z A;  3IFD A;  1SBB B;  3X3M A;  1D6E C;  2NZH A;  2WKD A;  4DV5 Q;  3VYR A;  5GAH C;  1UE1 A;  1PTO B;  4KD4 A;  2F4V Q;  1EIY B;  5GAD C;  1DJR D;  4DV2 Q;  2E2H B;  1KXL A;  1CM9 A;  4G7Z C;  1GUS A;  4DR1 Q;  3MZ5 A;  1P8L A;  1GKH A;  3GTJ B;  4JI6 Q;  2MQH A;  2MO0 A;  1SJH D;  2PZU A;  2O5J C;  5IGB A;  1A3T A;  1WVL A;  3GTG H;  4IOC A;  1S4Z A;  2Q2H A;  3NBI A;  2NTT A;  4HED A;  1CKN A;  2Z4I A;  3I4L A;  2IT1 A;  3I4M B;  3T51 B;  3M4O H;  3D6W A;  1XMQ L;  2ZJR A;  4LF8 Q;  4R4O A;  4JI3 L;  4OWW B;  1HQR D;  2B8G A;  4BXX G;  1QUQ B;  3CCS A;  2BA1 A;  4PMB A;  1B2T A;  2Z6K A;  3U50 C;  4BY7 H;  3OIQ A;  4GKJ Q;  3M4Q A;  1SYC A;  4K2L A;  2AQ2 B;  1QG7 A;  4FF3 A;  5M3F B;  2R3Z A;  1I4Q A;  3KF8 B;  1B50 A;  4N9P A;  3TSS A;  5EQ0 A;  3PSI A;  1JB7 A;  3HG9 A;  4C3J B;  4DR6 L;  3H0G H;  1WTH A;  1KAA A;  4S3S A;  1N34 L;  1TWA H;  5M3M H;  4B9X A;  2N78 A;  4LK1 C;  5BN5 A;  4OO1 H;  3AB9 A;  4A3B G;  3D4R A;  4DR5 Q;  4NKL A;  2MNA A;  1WJJ A;  1DOK A;  4EGV A;  1D8L A;  1SFO B;  4DV1 Q;  3J7A 5;  4AYB G;  3EN2 A;  4BBR B;  2LFN A;  1JIC A;  3TME A;  4RGN A;  2R92 G;  4O0A A;  1JCK B;  3KK7 A;  4A3L H;  1QCB D;  1EFI D;  3RN2 A;  1LTB D;  4FXD A;  4I7A A;  2Q2U A;  4LFC Q;  1YNJ C;  2UXD Q;  1RTN A;  1EQT A;  3PIP 3;  1LT4 D;  2OTJ A;  4JI0 L;  5IGD A;  4X64 L;  1Q7Y C;  4J8Q A;  1I4R A;  1Q8K A;  5I2X A;  1SMY C;  3PQI A;  1A6X A;  1VQI A;  1FJG Q;  1EYC A;  3M85 A;  5KEE A;  2E75 C;  5IP9 H;  3CPW A;  1P16 A;  1PRT B;  4TVA B;  2EJF C;  2Y0S B;  3P7J A;  1Q86 C;  3VR6 A;  4DFA A;  3PIO A;  4CJ2 C;  3P20 A;  1WTX A;  3T1H L;  2B2T A;  1VQ4 A;  4IUP A;  4EQO A;  3FHW A;  5C44 H;  2DJG C;  2QGQ A;  1PZK D;  2KCC A;  1K73 C;  1K3R A;  1L0Y B;  4NMZ A;  3I4N G;  2F0U A;  2K4K A;  3MC0 B;  1E1O A;  4JI3 Q;  5EJW A;  4DXG A;  2B63 G;  3A8I E;  2NVT H;  5C4Z A;  1STH A;  3G7L A;  4ZRZ A;  3JAM L;  3NE5 B;  1B44 D;  2WAQ G;  4CGY B;  2HHH L;  3ONA B; 
#chains in the Genus database with same CATH homology
 4A76 A;  4L5R C;  2XTI A;  1PVO A;  1YJ9 A;  3CC2 A;  4YCV A;  1PH1 A;  3TQY A;  1NBW A;  1A0I A;  3BU2 A;  1K0R A;  3L2P A;  1IXR A;  1YIJ A;  4B3R Q;  1R9T H;  1I6H H;  1JT8 A;  4HIO A;  1C9O A;  2N8N A;  4JI7 Q;  2OQK A;  1YJW A;  2UUB L;  1VQ6 A;  1VQP A;  4JI1 L;  3KOJ A;  3HKZ E;  2AWO A;  3TRE A;  1N34 Q;  5C0X J;  2VQE Q;  3ULL A;  3PUY A;  1MJC A;  1PV4 A;  3JAM c;  3U4V A;  1HH2 P;  4YY3 Q;  4QIW E;  4DV0 Q;  1LYL A;  2JA6 G;  5GRO A;  2IHE A;  2IY5 B;  1G29 1;  1PH2 A;  3HOX G;  3JC6 6;  3K7U C;  2C35 B;  4LF9 Q;  1HZB A;  4JI8 Q;  1VQL A;  3M3Y H;  1XMO L;  1DGS A;  2VS1 A;  5C3E H;  4IFD G;  4X6A H;  1SRO A;  3I4M G;  4R4Q A;  2E5L Q;  2JEA I;  5JJI A;  2EQS A;  3F1Z A;  5JEA G;  1V1Q A;  1AE2 A;  1PH7 A;  1JMC A;  4LUV A;  4EX5 A;  4DV5 L;  5ELN A;  4JI7 L;  4QL5 A;  3KYH C;  4GKJ L;  4PZ7 A;  1K9M C;  1G51 A;  3BZC A;  3FP9 A;  4DV3 Q;  3A0J A;  3CCU A;  3RZO H;  3HFZ B;  3UE1 A;  4DR1 L;  1TWH H;  4OWT B;  5GQO A;  1IYJ B;  2V1C C;  4YY3 L;  3HOX H;  3G4S A;  3U4Z A;  3AFP A;  3UDF A;  3OTO L;  3F8T A;  4HID A;  4LF4 L;  4A3L G;  4BBR H;  1EIF A;  3TS0 A;  1QVG A;  4PG3 A;  4GN3 B;  1K8G A;  1U5K A;  4YWM A;  3PUX A;  1CUK A;  2RF4 A;  3GD7 A;  4R4C A;  4LUO A;  1SMX A;  4DR2 L;  4GN4 B;  1VQ8 A;  2CQO A;  4DV6 Q;  4JBM A;  2JA7 G;  4OO1 G;  1XTD A;  3GTP H;  1NTG A;  1OXX K;  4O2D A;  5IY0 A;  2CCZ A;  4A3D G;  1KRT A;  4UP9 A;  5IYC H;  5IWA L;  2VY3 A;  1XPR A;  1IZ6 A;  3JAM i;  4KLK A;  1UE5 A;  3J81 c;  3H3V I;  4DV4 L;  4GOP B;  1M90 C;  4IFD I;  4AH6 A;  1WCM H;  2GVB A;  3PO2 H;  4K0K L;  2KBN A;  3KF6 A;  2AKW B;  4GN5 A;  4R1J A;  4DK6 C;  5M3M G;  3CCJ A;  3T1H Q;  3S14 H;  3S2D H;  5JJL A;  1JJG A;  3B6Y A;  2BH2 A;  2HIV A;  3CCM A;  4BY7 G;  3H15 A;  3ULP A;  2JE6 I;  4B3S Q;  4YHH L;  5M5X H;  1JJ2 A;  4BBS G;  5H1S E;  1BKB A;  1YZ6 A;  2A1A A;  1VS0 A;  3D31 A;  5C4J H;  4QJF A;  4X64 Q;  1Y1W G;  1PH5 A;  2UUA L;  5C44 G;  5M3F H;  4GLX A;  4DV7 Q;  3I7F A;  1N8R C;  2R93 G;  3RR5 A;  1L1O C;  2UXC L;  3EIV A;  3GDE A;  2L15 A;  5IYB H;  1A63 A;  2BA0 A;  3ICE A;  1CKO A;  3CCQ A;  2JA7 H;  2UXB Q;  3K0X A;  3HOW G;  3NEL A;  4XTC S;  2YYZ A;  1WYD A;  5FLM G;  4OO1 I;  2PQA A;  5DLQ E;  1B8A A;  1YNX A;  3MXN B;  4TQU S;  3RLN A;  1UEB A;  4OON A;  1YIT A;  4B3R L;  3NEN A;  1I3Q H;  4DUY L;  1X55 A;  2JA8 H;  1WFQ A;  3PUZ A;  2IX0 A;  2JA9 A;  3ZJY C;  3OW2 A;  4A3M H;  1N36 Q;  3K81 C;  2PMZ E;  5M5W H;  4LF5 Q;  1Q81 C;  2VUM H;  1HNW L;  1MKH A;  4DAM A;  1KC8 C;  3PUV A;  2ZTD A;  4A75 A;  2AMC B;  2YU9 H;  4A3C G;  4JI4 Q;  2F3I A;  5IP9 G;  2VW9 A;  2KEN A;  4QQB X;  1QVC A;  1HZA A;  4LF9 L;  1MJE A;  2CWP A;  3HKS A;  3H3V H;  5IYD G;  1D7Q A;  3GTJ H;  3M9B A;  4LFB Q;  3CPF A;  1NJI C;  3AFQ A;  2WB1 E;  3RNU A;  2DGY A;  3UDI A;  3GTK H;  1NMF A;  2HT1 A;  1XNQ L;  1XNR L;  4JBJ A;  1BBW A;  3RN5 A;  2ATW A;  1RIP A;  2VQF L;  4FDB A;  5JJK A;  3I56 A;  1TWG H;  1Z9F A;  4DUY Q;  3W5O A;  3AYH B;  2KHJ A;  1X3F A;  4KHZ A;  4X62 L;  3T1Y L;  2I0Q A;  3TS2 A;  4A93 H;  2JK8 A;  1X56 A;  1YHB A;  3CCL A;  1JE5 A;  4DPG A;  1N33 L;  4JI6 L;  3PV0 A;  4AQY Q;  3I55 A;  2YTY A;  1KL9 A;  1GVP A;  2N49 A;  4JCV E;  4MNO A;  1HR0 W;  3M7N A;  4A3I G;  4JI1 Q;  1EYG A;  1IBM Q;  4YWK A;  4PMW A;  3UDX A;  3BJU A;  3PO3 G;  3J81 i;  5HY6 A;  4JI2 Q;  4NXM Q;  1X9N A;  4IPC A;  4LW1 A;  4H02 A;  4UP7 A;  5GAE C;  2B29 A;  4PZ6 A;  1KIX A;  1GM5 A;  4NXN Q;  1C0A A;  3S1Q H;  2WAQ E;  2UU9 Q;  4WJ3 M;  2GVA A;  1CKN B;  1J6Q A;  3G6E A;  5IYB G;  4LF8 L;  3F2B A;  3M4P A;  3S2H H;  1IBK L;  1YI2 A;  1PH6 A;  3ERS X;  4HIM A;  5E7N A;  1X3E A;  4UPA A;  4DUZ L;  4DK3 C;  3DM3 A;  3T1Y Q;  2NVY H;  5LMU L;  2FXQ A;  1E1T A;  2WFW A;  2CFM A;  1YEZ A;  5ELO A;  3WWV A;  4A3K H;  1YJN A;  1QUQ A;  4QY7 A;  4EQ5 A;  4LF6 L;  2F4V L;  1CSQ A;  3HKZ G;  5J3B A;  4GOP A;  2E5L L;  1UE7 A;  1G6P A;  4JBK A;  1GO3 E;  3KDF A;  4LFA Q;  3D0F A;  5IYC G;  1Q1B A;  5AJ3 Q;  1OXS C;  3W1G A;  3I2Z A;  3HOV H;  2HHH Q;  3PF5 A;  2DUD A;  3GTO H;  1K8A C;  2IHF A;  4LNQ A;  1EOV A;  4KHP Q;  4GLV B;  4DV3 L;  4B3S L;  1PYS B;  3PUW A;  1E24 A;  5JEA J;  4X65 Q;  4A3K G;  1XPO A;  3CCV A;  4POG A;  1WCM G;  3CD6 A;  3PO2 G;  3STB C;  3J81 j;  4IFD J;  1AE3 A;  2E2H H;  1VQM A;  2OTL A;  4YCW A;  5HGQ A;  1XMQ Q;  1HNX L;  4DR2 Q;  4A3J G;  2K5V A;  2EXD A;  1X54 A;  4X66 L;  3G71 A;  5LMU Q;  1EQR A;  1VQD A;  2WP8 J;  2KCM A;  3PCO B;  2H5X A;  4DNI A;  4JYA L;  3OYY A;  3AEV A;  4JI5 L;  2NN6 I;  4IO9 A;  3NBH B;  1Q12 A;  5C0X G;  1WOC A;  1VCI A;  3S1R H;  4BY1 H;  4P73 A;  1EWI A;  2F52 A;  1PH8 A;  4C3I H;  3RLF A;  1EFW A;  4HIK A;  1HR0 L;  3CW2 C;  4A3M G;  1Y14 B;  2K50 A;  3I4M H;  1OXV A;  3G48 A;  1S3O A;  2K5H A;  2I5L X;  1PA6 A;  1SFO H;  1PHJ A;  2UUC L;  4Y7N H;  1LTL A;  1I94 L;  3TRZ A;  2LXK A;  1FGU A;  1C7Y A;  4LF5 L;  2K75 A;  2K52 A;  1NE3 A;  3CAM A;  1X3G A;  4YHH Q;  2JA6 H;  4DR7 L;  4K0K Q;  2UXD L;  2ID0 A;  1KAW A;  4X66 Q;  2IX1 A;  1Y1V H;  5M5Y H;  1V9P A;  3IRB A;  4RG1 A;  1IBL L;  4JI4 L;  3K7A H;  1PFS A;  2NVX H;  1NMG A;  5C4X H;  4NXM L;  4A3D H;  2YV5 A;  2VUM G;  3HOY H;  1SN8 A;  5LMN Q;  4P71 A;  1BBU A;  2E8G A;  2Z6K C;  4R4T A;  4YCU A;  3F2D A;  4YWL A;  3CMA A;  1HNZ Q;  3W1B A;  1Q46 A;  3I4O A;  2VL6 A;  1PH3 A;  4B3M L;  4IOA A;  3HOY G;  2VQF Q;  1YHA A;  2D62 A;  2ES2 A;  1PYB A;  5C3E G;  1IL2 A;  1VQC A;  4UY8 C;  4P72 A;  1OXT A;  2ALY B;  3A74 A;  4AQY L;  4A3F G;  5BR8 Q;  3CC4 A;  4LFA L;  2KCT A;  2UXB L;  3KF6 B;  3EBE A;  5C0X I;  4DV2 L;  2D0P A;  5IP7 H;  2AWN A;  4A3E H;  1N32 Q;  4JC0 A;  1VQB A;  5FJ8 H;  4NB3 A;  4KHP L;  1Z47 A;  3J80 i;  3BZK A;  1Y1W H;  2NVQ H;  1I5F A;  1V43 A;  4DR4 L;  3I4N H;  4BA2 I;  1VQ7 A;  2MO1 A;  5FLX c;  1N36 L;  2Z0S A;  1MIU A;  1SR3 A;  1K83 H;  1VQH A;  4XIG S;  1TXY A;  3KLW A;  2B63 H;  4GKK L;  4POF A;  1FJG L;  1HNW Q;  3LGJ A;  1E7Z A;  3NEM A;  4R4I A;  4BBS H;  4IPH A;  4IPD A;  3CQZ H;  1GD7 A;  4JYA Q;  4BA1 I;  2OWO A;  5LMN W;  4LF7 L;  1L1O A;  2UUA Q;  2RHQ B;  1X6O A;  1I50 H;  1ASY A;  2PNH A;  2ZM6 Q;  4ME3 A;  3H0G G;  3HOU H;  2PQA B;  1VQA A;  2EIF A;  4L5Q A;  2R6G A;  1N33 Q;  1W2B A;  4DV1 L;  1VQ5 A;  4OX9 Q;  2QEX A;  2A19 A;  1RL2 A;  5AJ3 L;  4X62 Q;  1XNR Q;  4P74 A;  1Q82 C;  3S15 H;  1LUZ A;  2CKZ B;  2OCE A;  1I94 Q;  1BVS A;  1TWF H;  3GTQ H;  3PO3 H;  2XGT A;  4Y52 H;  4B3T L;  2N3S A;  3J7Z C;  1S72 A;  1X65 A;  4X65 L;  2A8V A;  3HOZ G;  1AH9 A;  2HQL A;  2JEB I;  1VQF A;  2Y0S E;  3S1N H;  2OQ0 A;  4JI2 L;  2JJQ A;  1L0W A;  4C2M H;  2PI2 A;  2VNU D;  1E22 A;  4JI0 Q;  1XPU A;  3E9I A;  3STB D;  2KHI A;  4DR5 L;  2Q2I A;  4IJL A;  4BBR G;  1KD1 C;  1SRU A;  4GLA C;  1KQS A;  2E2I H;  2AHO B;  2UU9 L;  4A3I H;  1HZC A;  2NZH A;  4DV5 Q;  1J5E L;  5IT9 c;  5GAH C;  4DR3 L;  3CC7 A;  1UE1 A;  4QGU A;  4JV5 L;  2F4V Q;  2I5H A;  1E3P A;  5BR8 L;  5IE8 A;  5GAD C;  1EIY B;  5C4X G;  4DV2 Q;  4LF6 Q;  4A93 G;  1KXL A;  3L0O A;  1A8V A;  3A5U A;  4DR1 Q;  1JJC B;  1P8L A;  4RMF A;  3E0E A;  1GKH A;  2NZO A;  2B3G A;  4JI6 Q;  2K5N A;  2MQH A;  3S17 H;  4DR4 Q;  1UE6 A;  1VQK A;  4DR7 Q;  1L2F A;  1YBY A;  2MO0 A;  5FLM H;  1QZH A;  4PZ8 A;  1TWC H;  3HOW H;  1VQO A;  3GTG H;  4JBW A;  4MTN A;  4GNX B;  4IOC A;  1YHQ A;  2Q2H A;  1S40 A;  2R7D A;  1NY4 A;  4DV6 L;  4AYB E;  1CKN A;  4A3C H;  5LMN L;  4A3G H;  4JI5 Q;  2E2J H;  3HOZ H;  2IT1 A;  3M4O H;  1N9W A;  2I5M X;  1XMQ L;  1HNX Q;  3CXC A;  2ZJR A;  1HNZ L;  4LF8 Q;  4R4O A;  2Y0S G;  4JI3 L;  1IBK Q;  4OWW B;  5K36 G;  1O7I A;  2D0O A;  1OTC A;  2JA8 G;  4BXX G;  1QUQ B;  3CCS A;  2BA1 A;  1XMO Q;  2Z6K A;  3SGI A;  3U50 C;  3F2C A;  1H95 A;  4BY7 H;  2VZA A;  3E9H A;  3KDF B;  3M4Q A;  4GKJ Q;  4A3B H;  3KJO A;  1HR0 Q;  2NN6 G;  3CP0 A;  1VQG A;  1U0L A;  3KF8 B;  4LWC A;  3FKI H;  2WB1 G;  4P75 A;  3PSI A;  3OTO Q;  1JB7 A;  4A3G G;  4B3T Q;  4APV A;  4DR6 L;  3H0G H;  3HOU G;  2YTX A;  1WI5 A;  3A5Z B;  4MZ9 A;  4UP8 A;  4HJA A;  1N34 L;  3CF5 A;  3HOV G;  1TWA H;  3ER0 A;  2UUB Q;  1B70 B;  1W3S A;  4JOI A;  2N78 A;  5M3M H;  4IJH A;  4LFC L;  1IBL Q;  1FVI A;  4BXX H;  4GKK Q;  1EQQ A;  5GAG C;  2ASB A;  4A3B G;  1CSP A;  4LUZ A;  4HJ8 A;  1PH9 A;  3ULJ A;  4DR5 Q;  1QVF A;  3AQQ A;  4LF7 Q;  2MNA A;  1WJJ A;  3K8A A;  1D8L A;  2R7F A;  1A62 A;  4L5S A;  4DV1 Q;  4JI8 L;  1VQ9 A;  4OX9 L;  4AYB G;  3S24 A;  3J7A 5;  4A3F H;  1CKM A;  1SE8 A;  3EN2 A;  3MEF A;  1HZ9 A;  2ZTE A;  4NPS A;  5IWA Q;  3Q8D A;  2QA4 A;  4GNX C;  1QZG A;  4A4I A;  2MFI A;  1Y1V G;  2R92 G;  4O0A A;  5FJ8 G;  1VQN A;  1FL0 A;  1LM0 A;  3PIP A;  4OXP A;  5IP7 G;  2BH8 A;  3DLL A;  4L5T A;  4GOP C;  4A3E G;  2R7Z G;  4A3L H;  3RN2 A;  2UUC Q;  3U58 A;  2PI2 E;  4WJ4 A;  2Q2U A;  4LFC Q;  4DKA C;  3S1M H;  1PH4 A;  5IYD H;  2UXD Q;  4HJ9 A;  3KFU A;  3CME A;  4LF4 Q;  2ZJP A;  2OTJ A;  4JI0 L;  1VQJ A;  4X64 L;  1Q7Y C;  1Q8K A;  2GN5 A;  4JG2 A;  3VDY A;  2R7Z H;  2K14 A;  3CCR A;  2RCN A;  1VQI A;  2R92 H;  1XJV A;  4DV7 L;  1FJG Q;  3L7Z C;  4B3M Q;  3S16 H;  1EUJ A;  2JQO A;  3RLO A;  4C3H H;  4JV5 Q;  3M85 A;  1J5E Q;  5IP9 H;  3CPW A;  1P16 A;  3GO5 A;  4JOI C;  4TVA B;  4DR3 Q;  1SLJ A;  1Q86 C;  1Q1E A;  3PIO A;  4DV4 Q;  1VQE A;  3FKI G;  4AIM A;  1IBM L;  2LSS A;  2CWA A;  3CCE A;  1HJP A;  1N32 L;  3T1H L;  1VQ4 A;  3RZD H;  4GS3 A;  4KI0 A;  3TEH B;  4DR6 Q;  3FHW A;  5C44 H;  5M3F G;  4ALP A;  2R93 H;  4NXN L;  3GTL H;  2QGQ A;  1M1K C;  4A3J H;  3K80 C;  4LFB L;  4BY1 G;  1K73 C;  4GNX A;  2Q2T A;  1K3R A;  1UWV A;  4IPG A;  3I4N G;  1XNQ Q;  4DUZ Q;  3GTM H;  2VQE L;  1YVC A;  4OWX B;  4HJ5 A;  3PF4 A;  2K4K A;  1L1O B;  4J15 A;  4C3J H;  1ASZ A;  2LXJ A;  2JA5 G;  3UE0 A;  1KRS A;  4DV0 L;  1B7Y B;  1E1O A;  1T9H A;  2RHS B;  2ZTC A;  3PGZ A;  4DAY B;  2JA5 H;  1KHI A;  4JI3 Q;  2B63 G;  1OXU A;  2YTV A;  2NVT H;  3KJP A;  2ZJQ A;  2UXC Q;  3J80 c;  2HIX A;  5EAY A;  2WAQ G;  2ZM6 L;  4HJ7 A;  2HHH L;  3UDG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...