1HZCA

Bacillus caldolyticus cold-shock protein mutants to study determinants of protein stability
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
66
structure length
66
Chain Sequence
MQEGKVKWFNNEKGYGFIEVEGGSDVFVHFTAIQGEGFKTLEEGQAVSFEIVQGNRGPQAANVVKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COLD SHOCK PROTEIN CSPB
publication title Crystal structures of mutant forms of the Bacillus caldolyticus cold shock protein differing in thermal stability.
pubmed doi rcsb
source organism Bacillus caldolyticus
molecule tags Transcription
total genus 11
structure length 66
sequence length 66
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00313 CSD 'Cold-shock' DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1hzcA00
4PG3A 3KLWA 1Y1WG 4A3CG 1Q82C 2VUMH 4GKKQ 4AQYQ 1YZ6A 3RZOH 1K0RA 3HOXG 4A3FH 4JYAL 2E2IH 3F2DA 1W3SA 1QUQA 4A93G 4A3LG 4OWXB 4AYBE 2PQAA 2YV5A 4BXXG 3PUVA 4DV1L 1VQDA 1KXLA 1X3GA 2PNHA 4QJFA 4A4IA 3GTGH 4K0KQ 1L0WA 4HIKA 4H02A 1C7YA 3ZJYC 4IOAA 4EX5A 1HZBA 2Z6KA 1VQPA 4J15A 1JJ2A 4XIGS 3UDGA 4DR5Q 3CCEA 2E2HH 4OO1G 4POFA 4YHHL 3UDFA 1NJIC 3CP0A 4JI6Q 3GTPH 2UUAL 5HY6A 4R4QA 1N33L 3HOUH 1HNXL 1Q8KA 3TEHB 3NBHB 4FDBA 1OXSC 1EQQA 3PO3H 5IYDH 4X65L 4DV4L 2OWOA 1R9TH 3HOZH 2VNUD 5IP9H 1NMFA 1BVSA 1CKMA 4YY3Q 5M5XH 4A3JG 4NXML 2R7FA 2VZAA 5JEAG 1QUQB 2B63H 1I50H 2Q2UA 4DR6L 1Z9FA 5IYBG 1NMGA 2I5HA 2PQAB 5LMUL 3TS0A 1MJCA 5K36G 4A3MG 5AJ3Q 1OXUA 2H5XA 4IJHA 1KD1C 4JI8Q 1HZAA 4UP7A 4IFDJ 4YCUA 1P8LA 3J80i 3HOWH 5IP7G 3T1HQ 4GNXC 4GOPA 3GDEA 3I4MG 3S15H 1JJCB 4DUZL 3TS2A 1A0IA 2ZJQA 1MIUA 3AYHB 4MZ9A 1OTCA 4JBJA 4WJ4A 1KRSA 1B70B 4KLKA 1B8AA 1Y1VG 2NVTH 2WAQE 3CCVA 1HR0W 2AWNA 5M3MG 3FHWA 2B3GA 4HJ9A 2E2JH 1GD7A 1K9MC 2NVXH 1FVIA 4A3DG 1FL0A 1N34L 4DV1Q 2EQSA 4B3SL 3PF5A 2NN6G 1QZHA 5M3FH 4IPHA 4LF4Q 2CCZA 3PV0A 3JAMi 1PVOA 3H0GH 3KYHC 3GO5A 1LM0A 3BU2A 1IBKQ 4IOCA 1SR3A 2UUAQ 2JA7G 1XTDA 2IHEA 4GOPB 2I5LX 3CCUA 4IFDI 1YBYA 3EN2A 2EIFA 4X65Q 1EIFA 4DV4Q 2OQKA 3EBEA 2NZHA 1CKNA 5GADC 2ZM6Q 2ZTCA 3STBD 1HNWL 3NENA 4APVA 3I2ZA 4P71A 4XTCS 1FGUA 2K5HA 3KF8B 3HFZB 5ELOA 2OCEA 4L5TA 5GAGC 1I5FA 4A3KH 4AH6A 1C9OA 1X3EA 2K75A 3KOJA 1YNXA 1HJPA 5HGQA 3PUZA 2Z0SA 4JI4L 1UE7A 2K5NA 1CSQA 1SFOH 4B3TL 3PO2H 4R4OA 1VQHA 2HQLA 1OXTA 4HJAA 2YU9H 2JJQA 3SGIA 1WI5A 1SLJA 2KBNA 4X66L 1CUKA 3CCQA 1GO3E 4ALPA 3PSIA 4BBSG 4DV3Q 3G4SA 5H1SE 3K80C 4LFCL 1V9PA 2NZOA 1A63A 4P73A 4JI3L 4DR3L 1NBWA 1AE2A 2UXDL 1UE5A 2VUMG 1X65A 1K3RA 4JOIC 2A1AA 3U4ZA 1Q86C 4A3FG 4JBKA 1CKNB 4B3SQ 4DV5L 4DK6C 3CCJA 3UDIA 5LMNL 1Q1EA 2VQEQ 4DR4L 1J6QA 1YHBA 1YVCA 4LUVA 4DV0L 3RNUA 1KC8C 2E5LL 3BZCA 4DV6L 1XNQL 3H3VH 1IXRA 3VDYA 3PUXA 1VQCA 2V1CC 2VS1A 3KF6A 1FJGQ 4JI2Q 2K52A 3ULLA 4JI7L 4JI1L 4GKJL 4LF5Q 4A3EH 1SN8A 3HOUG 1X56A 4A76A 1WJJA 2WP8J 4A3GH 4DAMA 5C4XH 2C35B 2K4KA 3PO3G 1HNWQ 2KCMA 3PGZA 5IYDG 1D7QA 3HOZG 3U50C 1TWAH 4OX9L 3WWVA 4DR2L 2WB1E 2F4VL 4OONA 2D62A 3H15A 3G71A 3JAMc 4JV5Q 3AFQA 1J5EL 4JG2A 3MEFA 2XGTA 4RMFA 2FXQA 1PH9A 4DV7L 3TREA 4B3TQ 3CCRA 4PZ7A 2WFWA 3S1QH 1QVCA 1VS0A 3HOWG 2MNAA 2RHQB 3G48A 3KF6B 2I5MX 4C2MH 1KQSA 4LFCQ 3CC7A 2R92H 1SROA 2HIVA 2D0OA 2MFIA 5IYCH 4DR1Q 4JI3Q 4LNQA 2IT1A 1NE3A 4JBWA 4QY7A 1XPUA 1UE6A 4POGA 4LFBQ 3KFUA 3I4NH 2YTYA 2JA5H 1OXXK 4DV5Q 5C4JH 4UPAA 1E1TA 1VQEA 1G51A 5LMNQ 3PUYA 1YITA 4LF9L 1K83H 2F3IA 2JEBI 2LXKA 1V43A 1VQ4A 4B3ML 4TQUS 1TWHH 3F2CA 2JK8A 3CAMA 5M3FG 4DV6Q 1IBMQ 2E5LQ 2UUBL 1XNQQ 4GNXA 1BKBA 1E1OA 3I56A 3H0GG 4DV2L 1PH2A 3I55A 4JYAQ 3W1GA 1Q81C 3STBC 2F52A 3CW2C 1OXVA 3NELA 3AQQA 1KAWA 2NVYH 1WYDA 1EQRA 4YCWA 3HOVH 3RLFA 1VQBA 1PH5A 3I7FA 4MTNA 4IPDA 2GN5A 2N78A 3F1ZA 1JJGA 4DNIA 4YWLA 1VQ5A 4GN4B 4OX9Q 1S72A 4X64L 1RIPA 4DR2Q 4KHPL 2CWAA 2MO0A 2AWOA 2Z6KC 2N3SA 2PI2A 3J7ZC 1QZGA 1LUZA 1YHAA 4R4IA 3CCSA 1J5EQ 4Y52H 4A3CH 2UUCL 1PYBA 4LF7L 3PIOA 1Q12A 3RLNA 4P74A 5GQOA 4HJ8A 1HH2P 5C0XG 1QVGA 5JEAJ 3MXNB 2R7DA 2VL6A 3K81C 4A93H 1PHJA 3HKSA 5FLMH 4GNXB 1HR0L 4A3LH 5BR8L 3F2BA 4PZ8A 2Y0SG 3M4OH 3E0EA 4HIOA 3BZKA 3J81c 1MKHA 4YHHQ 1PH1A 1UEBA 2Q2IA 1PV4A 3S14H 2KCTA 4GN3B 2MO1A 1E7ZA 1N33Q 1HNXQ 4OO1I 2R93H 4QL5A 3GD7A 3CQZH 1XMOL 1JMCA 3A5ZB 3PCOB 2IX1A 3K8AA 4P72A 2UUBQ 4QQBX 3DM3A 4DV2Q 1WOCA 4LF6L 4NXMQ 1TWCH 2ZTDA 5ELNA 3E9IA 2R7ZH 2YTVA 4DR6Q 5JJIA 4GN5A 4JI0L 4AYBG 1WFQA 4OXPA 5FLXc 3A0JA 1P16A 4YCVA 4BBRH 5C44G 3OTOL 1UWVA 5LMUQ 4R4TA 1XPOA 1Q7YC 2UXBL 3KJOA 1G291 3CC4A 3M3YH 3A74A 1X3FA 3RN2A 4DR7L 2L15A 1VQFA 2ALYB 4JOIA 4A3EG 1EFWA 4LUZA 4LF8L 1T9HA 4GLAC 4DUZQ 1AE3A 4A75A 1YJ9A 4X64Q 2BH8A 2Q2HA 4A3GG 5C4XG 2UU9L 3TRZA 1YI2A 2AHOB 1EWIA 1KRTA 4PZ6A 2VQFL 2JA6H 1LYLA 2JA8H 1PH6A 1PH8A 5M5YH 4Y7NH 3M4PA 4O0AA 2RF4A 1SE8A 3EIVA 3JC66 3OYYA 2K50A 4IO9A 4LWCA 1N34Q 4BXXH 4HJ7A 1YIJA 1N32L 1O7IA 2ATWA 1Y14B 5BR8Q 3CD6A 2BA1A 1M1KC 4L5RC 4L5QA 1UE1A 4A3DH 5JJLA 4B3RL 1G6PA 5GAEC 3E9HA 2K14A 2OQ0A 2YTXA 3L2PA 1U5KA 3S17H 3HKZG 1IL2A 2NN6I 1EOVA 3U58A 4A3BH 5EAYA 3RN5A 2I0QA 2VY3A 1WCMH 4R4CA 1L2FA 1PH4A 2EXDA 1VQNA 3B6YA 5IYCG 3KJPA 3K7UC 1VQ8A 1CSPA 1MJEA 1VQOA 2JA5G 1VQGA 1V1QA 4DR5L 2ES2A 5LMNW 1XMOQ 4L5SA 4BA2I 4PMWA 1L1OC 1YEZA 3AFPA 4DKAC 4HJ5A 4JI6L 3J81i 2CQOA 2DUDA 2JA9A 5IP9G 4A3IH 1VQMA 4OWTB 3OTOQ 3CF5A 1YHQA 4OWWB 1K73C 2B63G 1GKHA 4BY7H 3CC2A 4JI4Q 2AKWB 5FJ8H 2KHJA 1IZ6A 2KENA 4LF8Q 5C3EH 1HNZL 4TVAB 4C3HH 1BBUA 4X66Q 2IHFA 2CFMA 3A5UA 4IJLA 1VQKA 2UU9Q 2JQOA 1VQ6A 3K0XA 3S1MH 1RL2A 5GROA 3K7AH 4HIDA 1VQLA 2IY5B 2B29A 4MNOA 4DR3Q 1KL9A 3CXCA 1NY4A 2UXDQ 2GVBA 2DGYA 3ULJA 3OW2A 2UXCL 3F8TA 1N32Q 3RLOA 2ZTEA 1Q1BA 3S1NH 4UY8C 3CCMA 3GTLH 4B3RQ 4DR4Q 5FLMG 4DV0Q 1X55A 1SMXA 1VQ9A 4C3JH 3NEMA 1EYGA 3S24A 4X62L 3CCLA 1E3PA 3LGJA 3FKIH 1U0LA 1EUJA 4LF4L 4JI7Q 4JI1Q 2ZJPA 4GKJQ 2N8NA 1N9WA 1PH7A 3HOYH 1VQJA 4IFDG 4ME3A 2RHSB 3W5OA 2Q2TA 1IBKL 2R93G 1PFSA 3W1BA 1PH3A 1A8VA 5JJKA 4BY1H 1Z47A 1X9NA 1JE5A 3DLLA 2F4VQ 4NPSA 1X6OA 3D31A 1ASYA 5IE8A 4DUYL 1SRUA 1HZCA 2R7ZG 4RG1A 5J3BA 1Y1WH 2ZM6L 2ID0A 3S2DH 4BBRG 2JE6I 3I4OA 5IY0A 4DV7Q 3CMEA 2QA4A 3ULPA 2LXJA 1HNZQ 4A3KG 3GTMH 3HOXH 4LFAL 1D8LA 1E24A 1JB7A 2JEAI 4AIMA 2ZJRA 3PO2G 3HKZE 3Q8DA 1PYSB 3TQYA 1B7YB 3T1YL 1TXYA 3FP9A 2JA6G 3M85A 2GVAA 2A8VA 3ER0A 2UXCQ 2JA8G 3CPWA 1I94L 1XPRA 1CKOA 3M7NA 4JI5L 3D0FA 4DV3L 1N36L 1TWFH 2N49A 4LF9Q 3IRBA 2HHHL 2PMZE 1TWGH 2WB1G 4KI0A 1XMQL 4NXNL 3GTJH 3J7A5 2QEXA 3ERSX 2CKZB 4B3MQ 1XNRL 3GTKH 4GOPC 1AH9A 5C0XJ 3RR5A 4X62Q 1NTGA 2XTIA 4DPGA 1XJVA 2OTLA 2E8GA 3S2HH 3UDXA 2PI2E 1K8GA 1GVPA 3PIPA 4A3BG 3GTQH 2CWPA 2D0PA 3L0OA 3L7ZC 4NB3A 4QGUA 1WCMG 2VQEL 4A3JH 1IBLL 3UE1A 5IYBH 5IWAL 4HIMA 2BH2A 3CMAA 1H95A 1FJGL 4A3MH 4JI2L 4QIWE 1Q46A 3S16H 4LF5L 4KHPQ 4IPGA 5IP7H 5M5WH 4DUYQ 3I4MH 4YWMA 3S1RH 2KHIA 4A3IG 2UUCQ 1S3OA 1N8RC 3M9BA 1I6HH 4X6AH 4LF7Q 5E7NA 5GAHC 1Y1VH 2QGQA 3ICEA 4LFAQ 4BY7G 1KHIA 4KHZA 5M3MH 3RZDH 5FJ8G 1HR0Q 3I4NG 4GKKL 4JV5L 5C3EG 4AQYL 1ASZA 4LW1A 3KDFA 4IPCA 4R1JA 5C0XI 5IT9c 4UP9A 3T1YQ 2ASBA 1L1OA 2BA0A 4WJ3M 3AEVA 3CPFA 3U4VA 2R92G 1BBWA 1I94Q 1K8AC 1JT8A 4BA1I 4GS3A 4YWKA 2YYZA 1VQ7A 4JI5Q 1DGSA 1N36Q 4K0KL 2OTJA 5DLQE 2LSSA 1S40A 2HHHQ 1GM5A 2AMCB 1YJWA 3BJUA 1XMQQ 2K5VA 1W2BA 1IYJB 4NXNQ 2JA7H 1A62A 2MQHA 1VQAA 1VQIA 2IX0A 4DR1L 1EIYB 1QVFA 1XNRQ 2NVQH 3PF4A 3G6EA 4LFBL 1E22A 1I3QH 2WAQG 1HZ9A 4DAYB 4LF6Q 1PA6A 1YJNA 3GTOH 2HT1A 4JI0Q 4C3IH 2A19A 4LUOA 1IBLQ 2RCNA 1C0AA 3FKIG 3J80c 2UXBQ 3PUWA 3UE0A 1IBML 5IWAQ 3KDFB 4YY3L 4DR7Q 4UP8A 5C44H 3H3VI 1LTLA 1M90C 4JCVE 1KIXA 3HOVG 1L1OB 2HIXA 2R6GA 4P75A 1VCIA 2VW9A 4GLXA 3HOYG 2Y0SE 4EQ5A 4O2DA 4JBMA 2VQFQ 4BY1G 4DK3C 5AJ3L 4GLVB 4JI8L 1X54A 4BBSH 3T1HL 3M4QA 4JC0A 3J81j
chains in the Genus database with same CATH superfamily
3OOCA 2EZVA 3O13A 4QB4A 2CH4A 1Y1WG 5ELEA 1Q82C 2ICIA 3L3OC 2FMCA 4A3LG 3TP5A 2MPMA 2YV5A 3PUVA 1VQDA 1LT3D 2EYPA 3D4DA 3TBIB 1SEBD 1HZBA 4K8JA 1AZQA 2DNCA 2IWHA 4DR5Q 2M9VA 4OO1G 3SR1A 2K33A 2NB0A 2QW7A 4R4QA 3K58A 1HNXL 1PRTD 1ML0D 3NTHA 1OXSC 1EQQA 2BOSA 5IYDH 4X65L 4DV4L 1NR4A 3DWQA 4Q0FA 5IP9H 2VNUD 1NMFA 2V4DA 1CKMA 1JR0D 4IUQA 1GUWA 3DUZA 2A6HD 3NQIA 5L37A 1NMGA 3TS0A 3I3CA 5AJ3Q 1KD1C 4IFDJ 4YCUA 5IP7G 3IFDA 1ET9A 1STBA 3EJIA 3GDEA 2EJFC 3S1NB 1PXUA 2IJ0A 3GTLB 1OTCA 1KNEA 4ZKCB 2D2CC 3RMHA 4KLKA 4K14A 4C3JB 1BR9A 5FO7B 3FHWA 2E2JH 3OIQA 1C4QA 3RUZA 5K5PA 4DV1Q 1CM9A 5IGBA 4I7ZC 2B8FA 2NN6G 1QZHA 1V1PB 4DFAA 4H7BA 1PVOA 4BY1B 3GO5A 4M1UB 1MSGA 5C4HA 1KTKA 3BU2A 1SR3A 4Q5VA 4DAVA 1DXMA 4KY5A 1YBYA 3EN2A 3GTMB 3HOXB 1B50A 2Z9HA 2NTSA 3ND8A 2NZHA 2K6AA 1HNWL 1SE4A 4XTCS 1A6XA 1G6ZA 1GUOA 3J7AV 1I6VC 5C0XH 4AH6A 1DD2A 1X3EA 2K75A 1YNXA 4JI4L 1UE7A 1TWFB 4R4OA 2HQLA 3SGIA 4X66L 4ALPA 1AEXA 3PSIA 4DV3Q 3D4RA 5CV8A 1F9SA 5H1SE 3K80C 4LFCL 1WTXA 1ICFB 1TS4A 3S2HB 4P73A 1BXTA 2OXPA 3NTKA 1NBWA 1AE2A 4K2LA 1UE5A 3GTQB 2A1AA 5E1FA 3U4ZA 3D3RA 1CKNB 4B3SQ 4DK6C 1X32A 2A68C 3UDIA 2F0LA 1B2TA 5LMNL 4DR4L 4U68A 4A3MB 1YVCA 4LUVA 3BZCA 1WTPA 1CI3M 2KJXA 3PUXA 2XRQD 2V1CC 2VS1A 2O4XA 4CKBA 1RDPD 3HRZC 4ID6A 4JI7L 1D6EC 4V190 1Y1VB 4KN4C 1EFID 1MSHA 1JORA 1L0XB 4DAMA 1Q90A 2KCMA 5IYDG 1PTOF 4TSSA 2MHVA 4RCNA 4DR2L 2RSNA 4N8FA 1RTOA 1J5EL 5CMDA 3MFGA 1EOTA 1QVCA 1VS0A 2M2LA 1JQYD 1CHQD 2I5MX 2R92H 1BO0A 4LNQA 4DR1Q 3LWEA 1NE3A 1XPUA 5TSSA 4FXDA 1A3TA 4DV5Q 5C4JH 1EZ6A 1E1TA 2LKVA 1VQEA 1G51A 3PUYA 1CK1A 2B2VA 2LXKA 4TQUS 1TWHH 1O7ZA 3F2CA 3MXNA 3M7GA 5CYUA 2K5DA 3I56A 2F52A 3CW2C 3AQQA 4ABNA 1KAWA 2Z8LA 4IN3A 1ILPA 2NVYH 1WYDA 3RZDB 4HMJA 1A2TA 3TP6A 3HOVH 2L5TA 1SMYD 5C5LA 3I7FA 1PH5A 5CBEE 3I73A 4B9XA 2RBMA 2VUMB 3F1ZA 1TT2A 4KHPL 2MO0A 2PI2A 1QNKA 3J7ZC 5DM73 1LUZA 1YHAA 1TR5A 3TSSA 4A3CH 1ILQA 1PYBA 3GTGB 3HKZB 1YNJC 1Q12A 3RLNA 5GQOA 1HH2P 5C0XG 1QOHA 5JEAJ 3GP7A 2B2WA 1GXDC 1QVGA 3K81C 5F2DA 2E2HB 2K01A 5CORA 5BR8L 5IGCA 3Q23A 4PZ8A 2Y0SG 3I8ZA 3E0EA 2BCOA 2DJFC 1BF4A 1MKHA 1UUPA 4YHHQ 1PH1A 1R9TB 4L8JA 4OO1I 1AW7A 2IX1A 1CTMA 3JAME 3DM3A 5EKKA 1EY7A 4LF6L 3GQBA 1TWCH 2MUYA 4JI0L 1H9JA 3OTOL 1UWVA 5IGFA 1XPOA 3S15B 2UXBL 1G291 3OW7A 3M3YH 1L0YB 1Q3LA 4DR7L 1VQFA 5IGEA 4K6LA 2NVTB 1WTHA 4GLAC 2LFNA 2FINB 4DUZQ 4A75A 1YJ9A 2UU9L 3TRZA 2AHOB 1KRTA 2JA6H 3NHHA 4IALA 2KCNA 5KIXA 4KKUA 1N34Q 1WTRA 3H0GB 4HJ7A 5COYA 1ESRA 3CD6A 2BA1A 3SK5A 4L5RC 4A3DH 1G6PA 5GAEC 3L2PA 1IHZA 2NN6I 1EOVA 3U58A 1O80A 2VY3A 1II3A 2DY7A 2EXDA 1VQNA 3OHXC 1MJEA 2ES2A 5LMNW 2K05A 4PMWA 1YEZA 3AFPA 4DKAC 4JI6L 4HJ5A 3J81i 2CQOA 2DUDA 4XYQA 2JA9A 5FOBB 4ODGA 1VQMA 4R9WA 4OWTB 1JWUD 1XYIA 2YU9B 2B63G 2A5HA 2JXMB 2R61A 3A8IE 3VR3A 3NPPA 4H13C 1G8ZD 3J81E 4DK0A 2JQOA 3MWYW 5KEEA 1IYVA 4MNOA 1RODA 1NNXA 1NY4A 2F0QA 4X3UA 1N32Q 5HGTA 2ZTEA 3S1NH 1SJHD 3GTLH 4Z9CB 4RGTA 1EWCA 1EY0A 1VQ9A 4KN7C 4C3JH 3BYYB 5I4DA 1DJRD 3KUPA 2RCFA 1U0LA 4A3GB 1I4RA 1H9SB 2ZJPA 1F9PA 3K0YA 2AQ2B 1D5ZC 1N9WA 2N8NA 2WKCA 1IBKL 4BY1H 2Q8TA 1PZKD 1JE5A 5NUCA 3W3AA 3A7LA 2F4VQ 3A54A 5IE8A 4RG1A 2RQXA 4G4KA 2E2DC 4IUUA 3P20A 3BDOA 4A3KG 3HOXH 3GTMH 2IX3A 2RSOA 4DK1A 2JEAI 2IPKD 2KECA 4AIMA 3PO2G 3HKZE 1FNUA 2JA5B 2I07B 1LACA 2O2LD 1TXYA 2JA6G 1JWSD 1K83B 3CPWA 3KLSX 1TWFH 4LF9Q 3J7A5 1W6KA 3T13A 1W6JA 3ERSX 4B3MQ 1XNRL 2EYLA 4HCEA 2XTIA 1XJVA 3CRLC 1LO5D 3S2HH 2G5DA 1QB5D 1GVPA 3PIPA 4DXGA 3GTQH 4NB3A 2VQEL 4XYOA 3CU7A 2F0FA 3UE1A 5IYBH 5ISRA 1STHA 2B2WC 4HTHA 4G7OC 1H95A 4RKLA 4A3MH 1FJGL 2F3VA 4WJWA 3URYA 4LF5L 1CZWA 1PZID 2EY2A 4DAYA 4X6AH 5GAHC 1Y1VH 2AQ1B 3DWPA 3R93A 4LFAQ 3SK8A 5LL6S 3DWAA 1KHIA 4ZKBB 4JV5L 1EEFD 2F0WA 4AQYL 5I6WA 3S14B 1MI2A 4R1JA 5C0XI 1L1OA 3AEVA 3CPFA 1PYWD 2XWJB 1JT8A 1I94Q 3DHQA 1VQ7A 2YYZA 2TSSA 4K0KL 1DGSA 5DLQE 4RGNA 2HHHQ 1GM5A 2K7VA 1IYJB 1U9RA 3VYRA 5I2XA 1D7QA 3PF4A 2F4IA 2F0EA 3G6EA 2NBFA 2HT1A 2ICEC 4C3JG 2EDGA 1S5BD 4UHVA 4XT1B 4WRDA 1KLGD 1PMRA 4F8MA 3PUWA 1BNZA 1IBML 5JAVA 3KDFB 5CBAE 4JYAL 2JA8B 2R6GA 2HIXA 4GLXA 1BCPF 4NW2A 2DJGC 2L55A 4BY1G 1IL8A 4DK3C 4GLVB 3I70A 3RZDH 4JC0A 3J81j 5E3FA 4KKTA 3KLWA 4DXFA 2VUMH 4GKKQ 2EYJA 3HOXG 4G57A 4QF4A 1WD0A 4A93G 1QUQA 3KK7A 1TIID 2EY6A 3H3VC 2PCFB 4OHJA 4QJFA 4CGYB 3GTGH 4IOAA 4H02A 3D8GA 3FVQA 4J15A 5ELBA 3UDGA 3A8KE 3CCEA 2E2HH 3UDFA 2WACA 2A68D 5CR3A 5HY6A 1EU3A 1N33L 4BY7B 1Q8KA 4P2CB 3TEHB 3NBHB 3C1FA 5EPJA 4FF1A 1NSNS 5FO8B 5C3EB 2PW7A 1R9TH 1J9OA 2X6LA 4YY3Q 4NXML 5KNBA 4EGVA 3BVMA 3BVZA 4DR6L 5IYBG 4BS9A 1MJCA 1PFBA 2SNSA 4A3MG 1OXUA 4IJHA 4OEMB 4JI8Q 1HZAA 4WFN3 1V1OA 4GOPA 3S15H 1ONLA 2ZJQA 1MIUA 3TP7A 3E3XA 1KRSA 4IURA 1B8AA 1Y1VG 2NVTH 2HD3A 1G2SA 3CCVA 1QG7A 3KBGA 2B3GA 3HOYB 1E0BA 4IPHA 4LF4Q 2CCZA 4MN3A 3H0GH 3KYHC 5DNFA 3NWTA 2EPBA 3OIPA 2DN8A 4ZK9B 2MGSA 4IFDH 3DXJC 4MIUA 2EIFA 4X65Q 4DV4Q 2OQKA 4S3SA 5GADC 2ZM6Q 1E2ZA 3D6WA 1SE3A 4XDXA 1FGUA 2KEDA 3K5MA 5JPMC 3FDTA 4L5TA 5GAGC 3KLSA 3KBXA 1QWYA 1HJPA 1JICA 2K5NA 5EKIA 2EXZA 4B3TL 4DAPA 1OXTA 5CGKA 2YU9H 2WKDA 2G9HD 1YNJD 1A63A 4DR3L 3EVQA 2VUMG 1K3RA 4A3JB 1Q1EA 1K3BC 1MD2D 1UEAB 3J7AF 3A56A 2E5LL 4DV6L 3H94A 1XNQL 4FF4A 3S16B 1IXRA 5M5WB 1EZ8A 1B1ZA 3I4MB 2B2UC 4IQZA 3KF6A 3S1RB 1A15A 4PNYA 3ULLA 4JI1L 3HEJA 1I6HB 4CJ1B 2QILA 3JAML 2WP8J 1S5DD 4A3GH 2C35B 2K4KA 1HNWQ 3C1EA 1J8IA 1M8AA 2HCIA 1BQQT 3E5SA 3H15A 1FR3A 3JAMc 1HQRD 3AFQA 2E74C 2LS01 1ENAA 2XGTA 1PH9A 4DV7L 2JYOA 3MXUA 3PQIA 1Q8IA 2VXWA 2JA7B 2WFWA 1LTAD 1I3QB 4LFCQ 3CC7A 5KGUA 2LMCB 4NDXA 3CHBD 2B39A 1S5CD 3BZDB 4JBWA 4C3IB 4K2KA 1UE6A 1O78A 2JA5H 1OXXK 5LMNQ 1K83H 2LY7A 5C44B 1V43A 4ZAIA 5IIFA 2UUBL 2QEJC 4GNXA 3H0GG 5LHY1 5J39A 1Q81C 5HURA 2KEEA 1OXVA 2F0SA 2QF7A 4BBSB 2D5DA 1VQBA 2N78A 3HGBA 1JJGA 1PTOB 1LT4D 3RZOB 1SNCA 1S72A 4DR2Q 1HFNA 4JPBW 2CWAA 4J1MA 1V8QA 3TZUA 4RKBA 3MA2B 1J5EQ 3CCSA 1I4PA 3X3NA 4LF7L 3PIOA 1SE2A 3C46A 3TMEA 2DNEA 3MXNB 2VL6A 4RGMA 4N9PA 1PHJA 5FLMH 1HR0L 4B9WA 1T5EA 3HOUB 3KLRA 3BZKA 2ENBA 3J81c 1UEBA 2PMZB 3PO3B 3S14H 5C3WA 4GN3B 1SNDA 5BN4A 1GJXA 3MZ5A 4LAAA 5M5XB 4PMCA 3V96A 1XMOL 5BN3A 4O1NA 4KD3A 3OMCA 2F0HA 1PRTF 2ZTDA 4OL7A 3E9IA 5JJIA 4GN5A 3HOWB 4TKOB 4UDUC 1VQ6A 3K57A 5LMUQ 5JEAH 1Q7YC 4X3SA 1Y8NB 2PNRC 3A74A 3QB3A 4JOIA 1EFWA 4LF8L 4LUZA 2M00A 1AE3A 1HA5A 2J4XA 4A3GG 4DA2A 1CQFA 3PMFA 1YI2A 1EWIA 2VQFL 1JB3A 2NVXB 1NUCA 2JA8H 1PH6A 1SNPA 1EY5A 2K03A 5M3FB 2RF4A 1GUNA 2K50A 3C2PA 5BR8Q 2Z1CA 2CW0C 1KDAA 1UE1A 5JJLA 4B3RL 4QMGA 1U5KA 2AUKA 1EYDA 4RWSC 2I0QA 1PH4A 3EQLC 3K7UC 5T1IA 1VQ8A 1JOQA 1CT1D 1VQOA 2JA5G 4DR5L 2K5QA 3TN2A 2Z6BA 1QCBD 3OSOA 5EPKA 3ZYYX 3FMCA 5IP9G 3OTOQ 2EVBA 3CF5A 4B08A 2X6GA 3S9WA 4BY7H 3CC2A 2AKWB 2KHJA 5G3LD 5C3EH 3NSWA 3T53B 3PIO3 3DM1A 4TVAB 1BBUA 5FK9C 4H44C 2CFMA 3VR2A 3A5UA 2UU9Q 1SSOA 4DGZA 1LTSD 2KVMA 1RL2A 5GROA 4HIDA 1I4XA 5I2YA 2B29A 2UXDQ 1KL9A 2GVBA 3OW2A 2UXCL 3F8TA 4AYBB 1Q1BA 4UY8C 2F0VA 1NCVA 5FLMG 4ZRZA 4DV0Q 2F0KA 5FLXE 1SMXA 1EYGA 3S24A 4X62L 4XT3B 3CCLA 1SYDA 3R3OA 5C4XB 2PZWA 3LWUA 1U4PA 4GKJQ 1SYEA 5EBCA 4CDEC 4F7XA 1TWAB 1PH7A 3HOYH 3IFTA 2Q2TA 2I46A 1A8VA 3ERQA 2JSOA 1HA6A 3NQTA 1TKWB 4NPSA 3D31A 1SRUA 5J3BA 1S5ED 2ID0A 3S1QB 3T56B 2JE6I 2L0CA 3I4OA 3CMEA 2QA4A 2LXJA 4C2MB 4K5XA 1D2BA 1D8LA 1E24A 1EL0A 2N55A 1VDZA 1B7YB 2OEOA 3I4NB 2WAQB 2JA8G 1XPRA 4JI5L 4DV3L 5I9OA 2N49A 3IRBA 2PMZE 1XMQL 4KI0A 1ZXTA 5EGTA 2CKZB 3OPOA 5A35A 1AH9A 2XN9C 5C0XJ 1EQTA 1NTGA 4DPGA 2E8GA 3T4AC 2PI2E 1Y8OB 2CWPA 2D0PA 5E4XA 4QGUA 1IBLL 4A3JH 1TQOA 3K5NA 3U9SA 2BH2A 2O5IC 3S16H 4IPGA 5M5WH 3I4MH 3S1RH 3QOJA 2Z4HA 2UUCQ 1I6HH 1O7YA 2SEBD 2NTTA 4C56C 3ICEA 4BY7G 3M4OB 1RJTA 1XX8A 5M3MH 3AB9A 3MHBA 5C3EG 2NWGA 1ASZA 3SDZA 5DEHA 4HMIA 2R92G 1K8AC 5J22A 4GS3A 3BDCA 2Q8IB 2K5VA 2JA7H 3IKJA 2IX0A 4TRDA 4DR1L 1EIYB 1QVFA 1XNRQ 1KDCA 4BBRB 1E22A 1I3QH 4DAYB 1PA6A 2PPBC 2F0GA 4C3IH 2B2TA 1AZPA 1JC7A 4J8QA 5KNCA 4CDFC 3IAYA 3VYSA 5C44H 1XTCD 5I9PA 5A2QE 3HOVG 4JCVE 1L1OB 3HOYG 3M7NA 1VCIA 5M5YB 1E2WA 4Y7NB 4RHRA 4JBMA 1GUGA 3P75A 3D6CA 4BBSH 3T1HL 3M4QA 2EYHA 4PG3A 4CKCA 4A3CG 2K32A 1QILA 3S17B 1B9MA 3DEPA 1PTOH 1YZ6A 4AQYQ 3RZOH 1K0RA 4A3BB 3TZDA 1B4OA 1W3SA 4FNFA 1SYCA 1SNQA 3ITPA 4AYBE 1PFMA 2PQAA 1U4RA 1KXLA 1X3GA 4A4IA 4K0KQ 1L0WA 1IKLA 4HIKA 1M4VA 2Z6KA 2H4OA 1ET6A 4POFA 3T51B 4YHHL 3CP0A 2UUAL 2IL8A 3HOUH 5CV9A 5ELCA 1EY8A 4ULLA 3IL8A 4FDBA 4H0LC 3PO3H 2OWOA 1PTOC 2L4NA 4V0BA 5E4WC 5M5XH 4A3JG 2R7FA 2VZAA 4K5WA 4FYDA 1QUQB 4HEDA 2Q2UA 3K7AB 1Z9FA 4I65A 1BCPB 1U4LA 3LNNA 1FD7D 3N52A 2B2VC 4EQOA 2H5XA 2EYMA 4UP7A 1ZYRC 1P8LA 3J80i 3HOWH 3I4MG 3TS2A 4DUZL 1A0IA 4K8IA 3AYHB 4MZ9A 2QDBA 1RKNA 4WORA 1FNWA 2WAQE 3E0JA 2BE5C 5M3MG 3J7YW 3KF8A 2NVXH 1FVIA 4A3DG 1N34L 1LLRD 2EQSA 2HDLA 3J80E 3PF5A 3VR4A 4XQNA 5M3FH 1PLFA 1B3AA 1XXGA 4CDCC 3VR5A 4NKLA 2WINB 1RF2D 5KRUA 3BG3A 4RAUC 3HS0C 2JA7G 1RCVD 2G9DA 2IHEA 4GOPB 3S2DB 3CCUA 2F0OA 3QOLA 2DY8A 2RKSA 2ZTCA 4C3IG 3SVMA 3NENA 4APVA 4P71A 1WD1A 3BDLA 4UAIA 3MFYA 5ELOA 3DEOA 2L1BA 2OCEA 1I5FA 3KOJA 1QNUA 4KKSA 4HJAA 3F2UA 3GTJB 1CUKA 1GO3E 4BBSG 3GTKB 5D65A 1EIHA 4ZCKA 2NZOA 4KY7A 4JI3L 1X65A 1Q86C 4HCSA 4FF2A 3CCJA 5EPLA 2EY5A 4DN4M 3H3VH 3VDYA 1VQCA 5IGDA 1EQVA 2N88A 3WOFA 4JI2Q 1K0SA 2H1EA 1TS5A 1SN8A 3HOUG 4IUPA 1X56A 4A76A 1WJJA 1UAPA 5C4XH 3Q22A 1I4GA 3PO3G 2PYKA 3AU7A 3U50C 1TWAH 4OX9L 3WWVA 2F4VL 2A6EC 3G71A 2FJ2A 4FO2A 2F0IA 1K8OA 3G6JB 4QUFA 1NR2A 3TREA 4B3TQ 4ME5A 3CCRA 4PZ7A 1XWEA 3S1QH 3HOWG 4HN7A 4RFBA 2RHQB 3KF6B 4C2MH 3N6RA 3PIP3 1KQSA 2HCCA 4KV6A 2HIVA 4RCOA 2D0OA 4J6HA 4LFBQ 3KFUA 3I4NH 2YTYA 2CW0D 4ZUJA 4UPAA 1MBYA 4KJOA 1VF5C 5DM63 4LF9L 5I6YA 1VQ4A 4B3ML 1S4ZA 2E5LQ 2JK8A 5M3FG 1H9RA 4DV6Q 1XNQQ 3MVVA 1BKBA 4DV2L 4KD4A 1PH2A 3I55A 3W1GA 4DNTB 3STBC 5JJZA 3A7AB 4YCWA 3VA7A 3RLFA 1DOKA 3EFXD 4IPDA 2GN5A 1B53A 4DNIA 5IODA 1HFGA 1VQ5A 4A3FB 4GN4B 4KHVA 4X64L 1RIPA 3A55A 2E2IB 1NAPA 2Z6KC 4R4IA 2XNAC 4P74A 4HJ8A 1R4PB 2R7DA 1TY0A 4ZYSA 4GNXB 4A3LH 2GA4B 3NE5B 3F2BA 3GTPB 3M4OH 1Z7TA 2TMPA 2Q2IA 2KCTA 2J0TD 1EY6A 2NZ1D 3HOZB 4OO1H 1HNXQ 1EEID 2F03A 3MC0B 3Q6SA 5FLXL 2B63B 1I50B 3GD7A 3FPUB 4R8NA 1JMCA 3A5ZB 4LJZC 2UUBQ 3GV6A 5C4ZA 4QQBX 1DOLA 1WOCA 4OIJA 5BN5A 1JE4A 5EKLA 1WFQA 4AYBG 4HSVA 3A0JA 1P16A 5CV4A 4YCVA 4BBRH 5FLXc 3KJOA 2QDLA 3RN2A 2L15A 2ALYB 4PV1C 4MTKA 2BH8A 2Q2HA 5C4XG 3VYTA 4PZ6A 3TDQA 1LYLA 4HR7B 5M5YH 4Y7NH 1DCZA 1SE8A 3OYYA 3JC66 1O7LA 4IO9A 4LWCA 4BXXH 3MXGA 1Y14B 3C3LA 1M1KC 1SNMA 3E9HA 2K14A 1B9NA 2OQ0A 2Z4IA 3S17H 3HKZG 4A3BH 2A69C 5EAYA 1L2FA 3B6YA 1CA5A 2F0TA 1LT6D 1BUVT 1CSPA 4IZ8A 5D3IB 1GUSA 3ONAB 1XMOQ 1WTWA 4L5SA 1L1OC 2SOBA 3WOEA 1PRTB 4A3KB 3P7JA 1JOOA 1KABA 1SFOB 4OWWB 1D1IA 3PO2B 3ND9A 1GKHA 3U9OA 4JI4Q 4LF8Q 1HNZL 5C3XA 1AN8A 4X66Q 2IHFA 1VQKA 1ENCA 2PO4A 3K7AH 3RD4A 1VQLA 3CXCA 4IUNA 2DGYA 3HP3A 3QO2A 1IW7C 2A74C 3V05A 3CCMA 4B3RQ 4DR4Q 3NEMA 4A3EB 1E3PA 3LGJA 4LF4L 4JI7Q 4CJ2C 2B2YA 1JOKA 1ENFA 1VQJA 4IFDG 4ME3A 1BCPC 3NXWA 1Z47A 1X6OA 3NTIA 1ASYA 4DUYL 2XSCA 4ZQ3A 1HZCA 5A2QL 2ZM6L 3S2DH 4BBRG 5KNDA 5IY0A 4DNRB 3J81L 1IKMA 1A2UA 2SDFA 1HUNA 1CZGA 2ZJRA 3Q8DA 3TQYA 1SXTA 4YIJA 1SYBA 2P5ZX 3T1YL 2KCCA 3FP9A 1ZEQX 1WTQA 2UXCQ 2D9UA 1CKOA 4C1NK 3D0FA 1EYCA 5C6AA 1N36L 1TVXA 4BXXG 4NXNL 3GTJH 2K04A 2QEXA 3GTKH 4GOPC 3RR5A 4X62Q 2OTLA 1X3QA 4N9TA 2F0MA 2PQEA 4L6TB 5DAUA 4A3BG 1STNA 2KHSA 1SDFA 4G7ZC 5IWAL 4HIMA 2PW5A 2C9OA 5J1ZA 1BOSA 3CMAA 1STAA 2CQAA 5K36H 2SNMA 2K5WA 3Q0AA 5LL6X 1Q46A 1PTOD 4KHPQ 3BS1A 4YWMA 4A93B 4KY6A 1S3OA 1K8MA 3M9BA 1N8RC 2KQ3A 1EYAA 2QGQA 5EQ0A 3SK4A 3OWEB 2RA4A 1Z6HA 1ZYRD 4LW1A 4CJ0B 1CA6A 2HDMA 4IPCA 4UP9A 1C48A 1WTVA 1KNAA 2ASBA 1F9QA 4WJ3M 3U4VA 5JOBA 2R93B 1BBWA 4KTAA 4BA1I 3CQZB 2BE5D 3SHLA 4JI5Q 2C5CA 5CV6A 1FYCA 1SYGA 2OTJA 2O5JC 2AMCB 1YJWA 3BJUA 3FEWX 1XMQQ 1W2BA 2R7ZB 2MQHA 2EJMA 1LT5D 3J80L 1TY2A 4LF6Q 4EVOA 1YJNA 4JI0Q 1D5XC 2FFKB 3SE0A 4LUOA 1IBLQ 2AQ3B 1C0AA 1D1KA 3J80c 2Q8RE 2UXBQ 3UE0A 4DR7Q 3H3VI 1M90C 4PQXA 1KIXA 3I4LA 4IUTA 5AJ3L 2WB1B 1X54A 3NP8A 3HG9A 1LTRD 2QCPX 1CHPD 1DM0B 4EQPA 4A3FH 4OGQC 5CC4A 1WCMB 2E2IH 3F2DA 2EYOA 4JK1C 4OWXB 4F88A 1YNNC 2KOLA 4DV1L 2PNHA 1C7YA 1VMPA 3ZJYC 4EX5A 1VQPA 1C8CA 1JJ2A 4XIGS 4A3IB 1NJIC 4JI6Q 3GTPH 1RD9D 4LK1C 3R2TA 4RA8A 5JVG3 4U673 2XVSA 4C3HB 3HOZH 1G2TA 1BVSA 2OF1A 2ZXPA 3P1HA 3BVGA 3S1MB 1V1PA 5JEAG 2EE1A 2B63H 1I50H 5IT9E 2I5HA 2K28A 2PQAB 5LMUL 2RVLA 3NBIA 5K36G 5G3LF 5ELDA 2X69A 3NK9A 1FGBD 4RHSA 3T1HQ 4GNXC 2A6ED 3VA5A 1JJCB 4NP5A 4CBVA 4WJ4A 4JBJA 1B70B 2B2YC 2KUMA 1AP0A 3K5OA 1HR0W 2AWNA 3FKIB 4HJ9A 1GD7A 1K9MC 1G91A 4IUVA 1FL0A 1FNVA 4B3SL 1DYQA 2F0NA 3PV0A 3JAMi 3K5LA 2XRSD 1LM0A 1IBKQ 5IGGA 2F3WA 4IOCA 5M9OA 2UUAQ 1XTDA 1Y1WB 2I5LX 4IFDI 3EA6A 1EIFA 3EBEA 1CKNA 3STBD 1LTGD 1F2YA 2J7ZA 3I2ZA 1WTOA 2K5HA 2RDHA 3KF8B 3HFZB 2JN4A 3FRPB 3WDNA 3QG1A 4A3KH 3GV3A 1C9OA 1RTNA 5HGQA 1SBBB 3PUZA 2Z0SA 1SFOH 1CSQA 4OIKA 3PO2H 1ESFA 3TP8A 1VQHA 1ICWA 1H9KA 1TWGB 2JJQA 1WI5A 1SLJA 2KBNA 3CCQA 1KAAA 4LMQD 3G4SA 3D4WA 1DOMA 1V9PA 2NYZD 4CKEA 1F2LA 2UXDL 2MP1A 4JOIC 4A3FG 4JBKA 3QWNA 4DV5L 1VMCA 2RDGA 2EJGC 2VQEQ 1J6QA 1OO9B 4FP5D 1YHBA 3RNUA 1KC8C 1PRTC 4DV0L 2KA7A 2WV6D 3E6ZX 4NMZA 1H9MA 4KMUC 4QUCA 1FJGQ 5JVH3 2K1BA 4CDDC 2K52A 2A6HC 4GKJL 4LF5Q 4OELB 4A3EH 3CRKC 4XXEA 1STYA 3W2DA 4EQNA 2VB3X 3PGZA 3HOZG 1DZ1A 2WB1E 4CHTB 1PZJD 4OONA 1STEA 2D62A 4JV5Q 3I72A 4JG2A 3MEFA 1S5FD 3NUCA 4RMFA 2FXQA 3EROA 3QJYA 1Y69U 4RGOS 2NVQB 5KYIA 3LX0A 2MNAA 4E6IA 3G48A 1SROA 1Y8PB 2MFIA 2L9HA 5IYCH 4JI3Q 3GTOB 3VR6A 3BYTB 2IT1A 4QY7A 4POGA 2ZXOA 1YITA 1LTTD 1UNSA 2F3IA 2JEBI 4X3KA 2A69D 1EIGA 1IYUA 4KK7A 3CAMA 1IBMQ 3H6MA 3L9AX 1GUTA 1E1OA 3VYUA 4JYAQ 2IW3A 2HQEA 2EOTA 3NELA 2EYFA 1EQRA 2CVRA 4FXKC 4MTNA 4YWLA 4I7AA 4OX9Q 1HTLD 4GZYC 2N3SA 2AWOA 1PDQA 1QZGA 2A73B 1KDBA 4Y52H 2UUCL 4DF7A 1SYFA 3AMUA 4ILWA 5C5MA 4G7HC 5EBDA 4F87A 5IOCA 4A93H 3HKSA 3H09A 4HIOA 1QJOA 1EY9A 1IW7D 1PV4A 1U4MA 2MO1A 1E7ZA 1N33Q 2F0DA 2R93H 1PFNA 2WIIB 4QL5A 1TS3A 2RDFA 4X3TA 3CQZH 3PCOB 1BBXC 3K8AA 4P72A 5JPNC 4DV2Q 4NXMQ 5CV5A 5ELNA 3V2TA 1F77A 2YTVA 2R7ZH 4DR6Q 4OXPA 5C44G 4R4TA 1BCPD 1MHWC 2VB2X 4QIWB 3CC4A 1X3FA 2F0PA 4A3EG 2ZXRA 1T9HA 5AFWA 4X64Q 3SK6A 2E2JB 1HQMC 3I91A 3H91A 2XWBB 1PH8A 1DONA 2MJ8A 4FF3A 3M4PA 4O0AA 1LABA 3EIVA 2B2UA 1HHVA 1N32L 1YIJA 3R8BA 1O7IA 2ATWA 5KYLA 3OWFA 5FO9B 3DMUA 1T5XD 2B8GA 4L5QA 5T1GA 3CKIB 3SXHA 1X3PA 2YTXA 1EU4A 2FMMA 1A3UA 1STGA 1SAPA 1IL2A 3X3MA 3RN5A 1WCMH 4R4CA 5ELFA 3KJPA 5IYCG 2JP1A 3MTSA 1VF7A 1VQGA 1R4QB 1V1QA 1SJED 4BA2I 1SMYC 4QCLA 1BDOA 4A3IH 1YHQA 1K73C 3HZXA 4RH6A 2HUGA 2Y0SB 1JWMD 4L63B 5FJ8H 1IZ6A 2KENA 1H9SA 4C3HH 1LTBD 5EJWA 4IJLA 2B2TC 3K0XA 3S1MH 2IY5B 4DR3Q 1LV9A 3ULJA 4JW0A 2EY1A 3RLOA 1EY4A 3MAQA 1D5MC 1X55A 4ZUIA 1K28A 1AFPA 2F1MA 1TU2B 3NWSA 3A8JE 2XIWA 3FKIH 1EUJA 1B3QA 4JI1Q 3OMGA 4O42A 4ZLTF 2R3ZA 1B44D 3I90A 2RHSB 3W5OA 4BWGB 2R93G 1PFSA 3W1BA 1PH3A 5JJKA 1X9NA 4C1NI 3QR8A 3DLLA 2AUJD 2PZTA 2R7ZG 2BDOA 1Y1WH 3R2IA 2L12A 4DV7Q 3ULPA 3FPPA 1HNZQ 3T16A 2R92B 4LFAL 4HAEA 1JB7A 1KLUD 1JCKB 1PYSB 2CHBD 1GHKA 1TS2A 5C4JB 1A3VA 1HUMA 3M85A 2GVAA 2A8VA 3ER0A 2ZT9C 1I94L 4XQQA 1TWHB 1EWHA 1GHJA 2HHHL 1TWGH 2PZUA 2WB1G 2L11A 1YNND 2E75C 1F2MA 2NVYB 4PMBA 3HOVB 1F2ZA 3UDXA 1K8GA 3M4YA 5FKAC 3L0OA 3L7ZC 1WCMG 1CQVA 3MXPA 3QIAA 2CH4W 4JI2L 1HXYD 4K5VA 4QIWE 2NUCA 5IP7H 4DUYQ 4FVMA 1HRJA 1E2VA 2KHIA 4A3IG 2E76C 4DU9A 5IT9L 4LF7Q 5E7NA 1QE6A 1CFMA 3K6OA 4KHZA 5FJ8G 1HTPA 1HR0Q 3Q24A 4GKKL 2FHTA 4MHEA 4C3HG 3KDFA 4FXGC 1F9RA 2F0UA 5D14A 5IT9c 2OT2A 3T1YQ 2NN6H 2BA0A 4HSPA 4R8IA 1LTID 4YWKA 2QKIC 1N36Q 1I4HA 2LSSA 1HPCA 3SEBA 3K59A 1S40A 4JVZA 3I4NG 1TWCB 4NXNQ 1A62A 1VQAA 1VQIA 2NVQH 1HCZA 2WAQG 4LFBL 1HZ9A 3MEHA 3GTOH 3M3YB 4M8AA 2A19A 2RCNA 3FKIG 5CV7A 1ZKOA 1MGSA 2BDNA 5IWAQ 2F0JA 4YY3L 1I4QA 4UP8A 2JA6B 1LTLA 5D3DA 4P75A 2VW9A 1RHPA 2Y0SE 4EQ5A 4O2DA 2VQFQ 4XQJA 3G7LA 4JI8L 5M3MB 4KJNA 1GOZA 1WVLA 4K6DA 4N8X1 1SNOA 3UI2A 3NBHA 4A3DB
chains in the Genus database with same CATH topology
4PG3A 3KLWA 1Y1WG 4A3CG 1Q82C 2VUMH 4GKKQ 4AQYQ 1YZ6A 3RZOH 1K0RA 3HOXG 4A3FH 4JYAL 2E2IH 3F2DA 1W3SA 1QUQA 4A93G 4A3LG 4OWXB 4AYBE 2PQAA 2YV5A 4BXXG 3PUVA 4DV1L 1VQDA 1KXLA 1X3GA 2PNHA 4QJFA 4A4IA 3GTGH 4K0KQ 1L0WA 4HIKA 4H02A 1C7YA 3ZJYC 4IOAA 4EX5A 1HZBA 2Z6KA 1VQPA 4J15A 1JJ2A 4XIGS 3UDGA 4DR5Q 3CCEA 2E2HH 4OO1G 4POFA 4YHHL 3UDFA 1NJIC 3CP0A 4JI6Q 3GTPH 2UUAL 5HY6A 4R4QA 1N33L 3HOUH 1HNXL 1Q8KA 3TEHB 3NBHB 4FDBA 1OXSC 1EQQA 3PO3H 5IYDH 4X65L 4DV4L 2OWOA 1R9TH 3HOZH 2VNUD 5IP9H 1NMFA 1BVSA 1CKMA 4YY3Q 5M5XH 4A3JG 4NXML 2R7FA 2VZAA 5JEAG 1QUQB 2B63H 1I50H 2Q2UA 4DR6L 1Z9FA 5IYBG 1NMGA 2I5HA 2PQAB 5LMUL 3TS0A 1MJCA 5K36G 4A3MG 5AJ3Q 1OXUA 2H5XA 4IJHA 1KD1C 4JI8Q 1HZAA 4UP7A 4IFDJ 4YCUA 1P8LA 3J80i 3HOWH 5IP7G 3T1HQ 4GNXC 4GOPA 3GDEA 3I4MG 3S15H 1JJCB 4DUZL 3TS2A 1A0IA 2ZJQA 1MIUA 3AYHB 4MZ9A 1OTCA 4JBJA 4WJ4A 1KRSA 1B70B 4KLKA 1B8AA 1Y1VG 2NVTH 2WAQE 3CCVA 1HR0W 2AWNA 5M3MG 3FHWA 2B3GA 4HJ9A 2E2JH 1GD7A 1K9MC 2NVXH 1FVIA 4A3DG 1FL0A 1N34L 4DV1Q 2EQSA 4B3SL 3PF5A 2NN6G 1QZHA 5M3FH 4IPHA 4LF4Q 2CCZA 3PV0A 3JAMi 1PVOA 3H0GH 3KYHC 3GO5A 1LM0A 3BU2A 1IBKQ 4IOCA 1SR3A 2UUAQ 2JA7G 1XTDA 2IHEA 4GOPB 2I5LX 3CCUA 4IFDI 1YBYA 3EN2A 2EIFA 4X65Q 1EIFA 4DV4Q 2OQKA 3EBEA 2NZHA 1CKNA 5GADC 2ZM6Q 2ZTCA 3STBD 1HNWL 3NENA 4APVA 3I2ZA 4P71A 4XTCS 1FGUA 2K5HA 3KF8B 3HFZB 5ELOA 2OCEA 4L5TA 5GAGC 1I5FA 4A3KH 4AH6A 1C9OA 1X3EA 2K75A 3KOJA 1YNXA 1HJPA 5HGQA 3PUZA 2Z0SA 4JI4L 1UE7A 2K5NA 1CSQA 1SFOH 4B3TL 3PO2H 4R4OA 1VQHA 2HQLA 1OXTA 4HJAA 2YU9H 2JJQA 3SGIA 1WI5A 1SLJA 2KBNA 4X66L 1CUKA 3CCQA 1GO3E 4ALPA 3PSIA 4BBSG 4DV3Q 3G4SA 5H1SE 3K80C 4LFCL 1V9PA 2NZOA 1A63A 4P73A 4JI3L 4DR3L 1NBWA 1AE2A 2UXDL 1UE5A 2VUMG 1X65A 1K3RA 4JOIC 2A1AA 3U4ZA 1Q86C 4A3FG 4JBKA 1CKNB 4B3SQ 4DV5L 4DK6C 3CCJA 3UDIA 5LMNL 1Q1EA 2VQEQ 4DR4L 1J6QA 1YHBA 1YVCA 4LUVA 4DV0L 3RNUA 1KC8C 2E5LL 3BZCA 4DV6L 1XNQL 3H3VH 1IXRA 3VDYA 3PUXA 1VQCA 2V1CC 2VS1A 3KF6A 1FJGQ 4JI2Q 2K52A 3ULLA 4JI7L 4JI1L 4GKJL 4LF5Q 4A3EH 1SN8A 3HOUG 1X56A 4A76A 1WJJA 2WP8J 4A3GH 4DAMA 5C4XH 2C35B 2K4KA 3PO3G 1HNWQ 2KCMA 3PGZA 5IYDG 1D7QA 3HOZG 3U50C 1TWAH 4OX9L 3WWVA 4DR2L 2WB1E 2F4VL 4OONA 2D62A 3H15A 3G71A 3JAMc 4JV5Q 3AFQA 1J5EL 4JG2A 3MEFA 2XGTA 4RMFA 2FXQA 1PH9A 4DV7L 3TREA 4B3TQ 3CCRA 4PZ7A 2WFWA 3S1QH 1QVCA 1VS0A 3HOWG 2MNAA 2RHQB 3G48A 3KF6B 2I5MX 4C2MH 1KQSA 4LFCQ 3CC7A 2R92H 1SROA 2HIVA 2D0OA 2MFIA 5IYCH 4DR1Q 4JI3Q 4LNQA 2IT1A 1NE3A 4JBWA 4QY7A 1XPUA 1UE6A 4POGA 4LFBQ 3KFUA 3I4NH 2YTYA 2JA5H 1OXXK 4DV5Q 5C4JH 4UPAA 1E1TA 1VQEA 1G51A 5LMNQ 3PUYA 1YITA 4LF9L 1K83H 2F3IA 2JEBI 2LXKA 1V43A 1VQ4A 4B3ML 4TQUS 1TWHH 3F2CA 2JK8A 3CAMA 5M3FG 4DV6Q 1IBMQ 2E5LQ 2UUBL 1XNQQ 4GNXA 1BKBA 1E1OA 3I56A 3H0GG 4DV2L 1PH2A 3I55A 4JYAQ 3W1GA 1Q81C 3STBC 2F52A 3CW2C 1OXVA 3NELA 3AQQA 1KAWA 2NVYH 1WYDA 1EQRA 4YCWA 3HOVH 3RLFA 1VQBA 1PH5A 3I7FA 4MTNA 4IPDA 2GN5A 2N78A 3F1ZA 1JJGA 4DNIA 4YWLA 1VQ5A 4GN4B 4OX9Q 1S72A 4X64L 1RIPA 4DR2Q 4KHPL 2CWAA 2MO0A 2AWOA 2Z6KC 2N3SA 2PI2A 3J7ZC 1QZGA 1LUZA 1YHAA 4R4IA 3CCSA 1J5EQ 4Y52H 4A3CH 2UUCL 1PYBA 4LF7L 3PIOA 1Q12A 3RLNA 4P74A 5GQOA 4HJ8A 1HH2P 5C0XG 1QVGA 5JEAJ 3MXNB 2R7DA 2VL6A 3K81C 4A93H 1PHJA 3HKSA 5FLMH 4GNXB 1HR0L 4A3LH 5BR8L 3F2BA 4PZ8A 2Y0SG 3M4OH 3E0EA 4HIOA 3BZKA 3J81c 1MKHA 4YHHQ 1PH1A 1UEBA 2Q2IA 1PV4A 3S14H 2KCTA 4GN3B 2MO1A 1E7ZA 1N33Q 1HNXQ 4OO1I 2R93H 4QL5A 3GD7A 3CQZH 1XMOL 1JMCA 3A5ZB 3PCOB 2IX1A 3K8AA 4P72A 2UUBQ 4QQBX 3DM3A 4DV2Q 1WOCA 4LF6L 4NXMQ 1TWCH 2ZTDA 5ELNA 3E9IA 2R7ZH 2YTVA 4DR6Q 5JJIA 4GN5A 4JI0L 4AYBG 1WFQA 4OXPA 5FLXc 3A0JA 1P16A 4YCVA 4BBRH 5C44G 3OTOL 1UWVA 5LMUQ 4R4TA 1XPOA 1Q7YC 2UXBL 3KJOA 1G291 3CC4A 3M3YH 3A74A 1X3FA 3RN2A 4DR7L 2L15A 1VQFA 2ALYB 4JOIA 4A3EG 1EFWA 4LUZA 4LF8L 1T9HA 4GLAC 4DUZQ 1AE3A 4A75A 1YJ9A 4X64Q 2BH8A 2Q2HA 4A3GG 5C4XG 2UU9L 3TRZA 1YI2A 2AHOB 1EWIA 1KRTA 4PZ6A 2VQFL 2JA6H 1LYLA 2JA8H 1PH6A 1PH8A 5M5YH 4Y7NH 3M4PA 4O0AA 2RF4A 1SE8A 3EIVA 3JC66 3OYYA 2K50A 4IO9A 4LWCA 1N34Q 4BXXH 4HJ7A 1YIJA 1N32L 1O7IA 2ATWA 1Y14B 5BR8Q 3CD6A 2BA1A 1M1KC 4L5RC 4L5QA 1UE1A 4A3DH 5JJLA 4B3RL 1G6PA 5GAEC 3E9HA 2K14A 2OQ0A 2YTXA 3L2PA 1U5KA 3S17H 3HKZG 1IL2A 2NN6I 1EOVA 3U58A 4A3BH 5EAYA 3RN5A 2I0QA 2VY3A 1WCMH 4R4CA 1L2FA 1PH4A 2EXDA 1VQNA 3B6YA 5IYCG 3KJPA 3K7UC 1VQ8A 1CSPA 1MJEA 1VQOA 2JA5G 1VQGA 1V1QA 4DR5L 2ES2A 5LMNW 1XMOQ 4L5SA 4BA2I 4PMWA 1L1OC 1YEZA 3AFPA 4DKAC 4HJ5A 4JI6L 3J81i 2CQOA 2DUDA 2JA9A 5IP9G 4A3IH 1VQMA 4OWTB 3OTOQ 3CF5A 1YHQA 4OWWB 1K73C 2B63G 1GKHA 4BY7H 3CC2A 4JI4Q 2AKWB 5FJ8H 2KHJA 1IZ6A 2KENA 4LF8Q 5C3EH 1HNZL 4TVAB 4C3HH 1BBUA 4X66Q 2IHFA 2CFMA 3A5UA 4IJLA 1VQKA 2UU9Q 2JQOA 1VQ6A 3K0XA 3S1MH 1RL2A 5GROA 3K7AH 4HIDA 1VQLA 2IY5B 2B29A 4MNOA 4DR3Q 1KL9A 3CXCA 1NY4A 2UXDQ 2GVBA 2DGYA 3ULJA 3OW2A 2UXCL 3F8TA 1N32Q 3RLOA 2ZTEA 1Q1BA 3S1NH 4UY8C 3CCMA 3GTLH 4B3RQ 4DR4Q 5FLMG 4DV0Q 1X55A 1SMXA 1VQ9A 4C3JH 3NEMA 1EYGA 3S24A 4X62L 3CCLA 1E3PA 3LGJA 3FKIH 1U0LA 1EUJA 4LF4L 4JI7Q 4JI1Q 2ZJPA 4GKJQ 2N8NA 1N9WA 1PH7A 3HOYH 1VQJA 4IFDG 4ME3A 2RHSB 3W5OA 2Q2TA 1IBKL 2R93G 1PFSA 3W1BA 1PH3A 1A8VA 5JJKA 4BY1H 1Z47A 1X9NA 1JE5A 3DLLA 2F4VQ 4NPSA 1X6OA 3D31A 1ASYA 5IE8A 4DUYL 1SRUA 1HZCA 2R7ZG 4RG1A 5J3BA 1Y1WH 2ZM6L 2ID0A 3S2DH 4BBRG 2JE6I 3I4OA 5IY0A 4DV7Q 3CMEA 2QA4A 3ULPA 2LXJA 1HNZQ 4A3KG 3GTMH 3HOXH 4LFAL 1D8LA 1E24A 1JB7A 2JEAI 4AIMA 2ZJRA 3PO2G 3HKZE 3Q8DA 1PYSB 3TQYA 1B7YB 3T1YL 1TXYA 3FP9A 2JA6G 3M85A 2GVAA 2A8VA 3ER0A 2UXCQ 2JA8G 3CPWA 1I94L 1XPRA 1CKOA 3M7NA 4JI5L 3D0FA 4DV3L 1N36L 1TWFH 2N49A 4LF9Q 3IRBA 2HHHL 2PMZE 1TWGH 2WB1G 4KI0A 1XMQL 4NXNL 3GTJH 3J7A5 2QEXA 3ERSX 2CKZB 4B3MQ 1XNRL 3GTKH 4GOPC 1AH9A 5C0XJ 3RR5A 4X62Q 1NTGA 2XTIA 4DPGA 1XJVA 2OTLA 2E8GA 3S2HH 3UDXA 2PI2E 1K8GA 1GVPA 3PIPA 4A3BG 3GTQH 2CWPA 2D0PA 3L0OA 3L7ZC 4NB3A 4QGUA 1WCMG 2VQEL 4A3JH 1IBLL 3UE1A 5IYBH 5IWAL 4HIMA 2BH2A 3CMAA 1H95A 1FJGL 4A3MH 4JI2L 4QIWE 1Q46A 3S16H 4LF5L 4KHPQ 4IPGA 5IP7H 5M5WH 4DUYQ 3I4MH 4YWMA 3S1RH 2KHIA 4A3IG 2UUCQ 1S3OA 1N8RC 3M9BA 1I6HH 4X6AH 4LF7Q 5E7NA 5GAHC 1Y1VH 2QGQA 3ICEA 4LFAQ 4BY7G 1KHIA 4KHZA 5M3MH 3RZDH 5FJ8G 1HR0Q 3I4NG 4GKKL 4JV5L 5C3EG 4AQYL 1ASZA 4LW1A 3KDFA 4IPCA 4R1JA 5C0XI 5IT9c 4UP9A 3T1YQ 2ASBA 1L1OA 2BA0A 4WJ3M 3AEVA 3CPFA 3U4VA 2R92G 1BBWA 1I94Q 1K8AC 1JT8A 4BA1I 4GS3A 4YWKA 2YYZA 1VQ7A 4JI5Q 1DGSA 1N36Q 4K0KL 2OTJA 5DLQE 2LSSA 1S40A 2HHHQ 1GM5A 2AMCB 1YJWA 3BJUA 1XMQQ 2K5VA 1W2BA 1IYJB 4NXNQ 2JA7H 1A62A 2MQHA 1VQAA 1VQIA 2IX0A 4DR1L 1EIYB 1QVFA 1XNRQ 2NVQH 3PF4A 3G6EA 4LFBL 1E22A 1I3QH 2WAQG 1HZ9A 4DAYB 4LF6Q 1PA6A 1YJNA 3GTOH 2HT1A 4JI0Q 4C3IH 2A19A 4LUOA 1IBLQ 2RCNA 1C0AA 3FKIG 3J80c 2UXBQ 3PUWA 3UE0A 1IBML 5IWAQ 3KDFB 4YY3L 4DR7Q 4UP8A 5C44H 3H3VI 1LTLA 1M90C 4JCVE 1KIXA 3HOVG 1L1OB 2HIXA 2R6GA 4P75A 1VCIA 2VW9A 4GLXA 3HOYG 2Y0SE 4EQ5A 4O2DA 4JBMA 2VQFQ 4BY1G 4DK3C 5AJ3L 4GLVB 4JI8L 1X54A 4BBSH 3T1HL 3M4QA 4JC0A 3J81j
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PG3 A;  3KLW A;  1Y1W G;  4A3C G;  1Q82 C;  2VUM H;  4GKK Q;  4AQY Q;  1YZ6 A;  3RZO H;  1K0R A;  3HOX G;  4A3F H;  4JYA L;  2E2I H;  3F2D A;  1W3S A;  1QUQ A;  4A93 G;  4A3L G;  4OWX B;  4AYB E;  2PQA A;  2YV5 A;  4BXX G;  3PUV A;  4DV1 L;  1VQD A;  1KXL A;  1X3G A;  2PNH A;  4QJF A;  4A4I A;  3GTG H;  4K0K Q;  1L0W A;  4HIK A;  4H02 A;  1C7Y A;  3ZJY C;  4IOA A;  4EX5 A;  1HZB A;  2Z6K A;  1VQP A;  4J15 A;  1JJ2 A;  4XIG S;  3UDG A;  4DR5 Q;  3CCE A;  2E2H H;  4OO1 G;  4POF A;  4YHH L;  3UDF A;  1NJI C;  3CP0 A;  4JI6 Q;  3GTP H;  2UUA L;  5HY6 A;  4R4Q A;  1N33 L;  3HOU H;  1HNX L;  1Q8K A;  3TEH B;  3NBH B;  4FDB A;  1OXS C;  1EQQ A;  3PO3 H;  5IYD H;  4X65 L;  4DV4 L;  2OWO A;  1R9T H;  3HOZ H;  2VNU D;  5IP9 H;  1NMF A;  1BVS A;  1CKM A;  4YY3 Q;  5M5X H;  4A3J G;  4NXM L;  2R7F A;  2VZA A;  5JEA G;  1QUQ B;  2B63 H;  1I50 H;  2Q2U A;  4DR6 L;  1Z9F A;  5IYB G;  1NMG A;  2I5H A;  2PQA B;  5LMU L;  3TS0 A;  1MJC A;  5K36 G;  4A3M G;  5AJ3 Q;  1OXU A;  2H5X A;  4IJH A;  1KD1 C;  4JI8 Q;  1HZA A;  4UP7 A;  4IFD J;  4YCU A;  1P8L A;  3J80 i;  3HOW H;  5IP7 G;  3T1H Q;  4GNX C;  4GOP A;  3GDE A;  3I4M G;  3S15 H;  1JJC B;  4DUZ L;  3TS2 A;  1A0I A;  2ZJQ A;  1MIU A;  3AYH B;  4MZ9 A;  1OTC A;  4JBJ A;  4WJ4 A;  1KRS A;  1B70 B;  4KLK A;  1B8A A;  1Y1V G;  2NVT H;  2WAQ E;  3CCV A;  1HR0 W;  2AWN A;  5M3M G;  3FHW A;  2B3G A;  4HJ9 A;  2E2J H;  1GD7 A;  1K9M C;  2NVX H;  1FVI A;  4A3D G;  1FL0 A;  1N34 L;  4DV1 Q;  2EQS A;  4B3S L;  3PF5 A;  2NN6 G;  1QZH A;  5M3F H;  4IPH A;  4LF4 Q;  2CCZ A;  3PV0 A;  3JAM i;  1PVO A;  3H0G H;  3KYH C;  3GO5 A;  1LM0 A;  3BU2 A;  1IBK Q;  4IOC A;  1SR3 A;  2UUA Q;  2JA7 G;  1XTD A;  2IHE A;  4GOP B;  2I5L X;  3CCU A;  4IFD I;  1YBY A;  3EN2 A;  2EIF A;  4X65 Q;  1EIF A;  4DV4 Q;  2OQK A;  3EBE A;  2NZH A;  1CKN A;  5GAD C;  2ZM6 Q;  2ZTC A;  3STB D;  1HNW L;  3NEN A;  4APV A;  3I2Z A;  4P71 A;  4XTC S;  1FGU A;  2K5H A;  3KF8 B;  3HFZ B;  5ELO A;  2OCE A;  4L5T A;  5GAG C;  1I5F A;  4A3K H;  4AH6 A;  1C9O A;  1X3E A;  2K75 A;  3KOJ A;  1YNX A;  1HJP A;  5HGQ A;  3PUZ A;  2Z0S A;  4JI4 L;  1UE7 A;  2K5N A;  1CSQ A;  1SFO H;  4B3T L;  3PO2 H;  4R4O A;  1VQH A;  2HQL A;  1OXT A;  4HJA A;  2YU9 H;  2JJQ A;  3SGI A;  1WI5 A;  1SLJ A;  2KBN A;  4X66 L;  1CUK A;  3CCQ A;  1GO3 E;  4ALP A;  3PSI A;  4BBS G;  4DV3 Q;  3G4S A;  5H1S E;  3K80 C;  4LFC L;  1V9P A;  2NZO A;  1A63 A;  4P73 A;  4JI3 L;  4DR3 L;  1NBW A;  1AE2 A;  2UXD L;  1UE5 A;  2VUM G;  1X65 A;  1K3R A;  4JOI C;  2A1A A;  3U4Z A;  1Q86 C;  4A3F G;  4JBK A;  1CKN B;  4B3S Q;  4DV5 L;  4DK6 C;  3CCJ A;  3UDI A;  5LMN L;  1Q1E A;  2VQE Q;  4DR4 L;  1J6Q A;  1YHB A;  1YVC A;  4LUV A;  4DV0 L;  3RNU A;  1KC8 C;  2E5L L;  3BZC A;  4DV6 L;  1XNQ L;  3H3V H;  1IXR A;  3VDY A;  3PUX A;  1VQC A;  2V1C C;  2VS1 A;  3KF6 A;  1FJG Q;  4JI2 Q;  2K52 A;  3ULL A;  4JI7 L;  4JI1 L;  4GKJ L;  4LF5 Q;  4A3E H;  1SN8 A;  3HOU G;  1X56 A;  4A76 A;  1WJJ A;  2WP8 J;  4A3G H;  4DAM A;  5C4X H;  2C35 B;  2K4K A;  3PO3 G;  1HNW Q;  2KCM A;  3PGZ A;  5IYD G;  1D7Q A;  3HOZ G;  3U50 C;  1TWA H;  4OX9 L;  3WWV A;  4DR2 L;  2WB1 E;  2F4V L;  4OON A;  2D62 A;  3H15 A;  3G71 A;  3JAM c;  4JV5 Q;  3AFQ A;  1J5E L;  4JG2 A;  3MEF A;  2XGT A;  4RMF A;  2FXQ A;  1PH9 A;  4DV7 L;  3TRE A;  4B3T Q;  3CCR A;  4PZ7 A;  2WFW A;  3S1Q H;  1QVC A;  1VS0 A;  3HOW G;  2MNA A;  2RHQ B;  3G48 A;  3KF6 B;  2I5M X;  4C2M H;  1KQS A;  4LFC Q;  3CC7 A;  2R92 H;  1SRO A;  2HIV A;  2D0O A;  2MFI A;  5IYC H;  4DR1 Q;  4JI3 Q;  4LNQ A;  2IT1 A;  1NE3 A;  4JBW A;  4QY7 A;  1XPU A;  1UE6 A;  4POG A;  4LFB Q;  3KFU A;  3I4N H;  2YTY A;  2JA5 H;  1OXX K;  4DV5 Q;  5C4J H;  4UPA A;  1E1T A;  1VQE A;  1G51 A;  5LMN Q;  3PUY A;  1YIT A;  4LF9 L;  1K83 H;  2F3I A;  2JEB I;  2LXK A;  1V43 A;  1VQ4 A;  4B3M L;  4TQU S;  1TWH H;  3F2C A;  2JK8 A;  3CAM A;  5M3F G;  4DV6 Q;  1IBM Q;  2E5L Q;  2UUB L;  1XNQ Q;  4GNX A;  1BKB A;  1E1O A;  3I56 A;  3H0G G;  4DV2 L;  1PH2 A;  3I55 A;  4JYA Q;  3W1G A;  1Q81 C;  3STB C;  2F52 A;  3CW2 C;  1OXV A;  3NEL A;  3AQQ A;  1KAW A;  2NVY H;  1WYD A;  1EQR A;  4YCW A;  3HOV H;  3RLF A;  1VQB A;  1PH5 A;  3I7F A;  4MTN A;  4IPD A;  2GN5 A;  2N78 A;  3F1Z A;  1JJG A;  4DNI A;  4YWL A;  1VQ5 A;  4GN4 B;  4OX9 Q;  1S72 A;  4X64 L;  1RIP A;  4DR2 Q;  4KHP L;  2CWA A;  2MO0 A;  2AWO A;  2Z6K C;  2N3S A;  2PI2 A;  3J7Z C;  1QZG A;  1LUZ A;  1YHA A;  4R4I A;  3CCS A;  1J5E Q;  4Y52 H;  4A3C H;  2UUC L;  1PYB A;  4LF7 L;  3PIO A;  1Q12 A;  3RLN A;  4P74 A;  5GQO A;  4HJ8 A;  1HH2 P;  5C0X G;  1QVG A;  5JEA J;  3MXN B;  2R7D A;  2VL6 A;  3K81 C;  4A93 H;  1PHJ A;  3HKS A;  5FLM H;  4GNX B;  1HR0 L;  4A3L H;  5BR8 L;  3F2B A;  4PZ8 A;  2Y0S G;  3M4O H;  3E0E A;  4HIO A;  3BZK A;  3J81 c;  1MKH A;  4YHH Q;  1PH1 A;  1UEB A;  2Q2I A;  1PV4 A;  3S14 H;  2KCT A;  4GN3 B;  2MO1 A;  1E7Z A;  1N33 Q;  1HNX Q;  4OO1 I;  2R93 H;  4QL5 A;  3GD7 A;  3CQZ H;  1XMO L;  1JMC A;  3A5Z B;  3PCO B;  2IX1 A;  3K8A A;  4P72 A;  2UUB Q;  4QQB X;  3DM3 A;  4DV2 Q;  1WOC A;  4LF6 L;  4NXM Q;  1TWC H;  2ZTD A;  5ELN A;  3E9I A;  2R7Z H;  2YTV A;  4DR6 Q;  5JJI A;  4GN5 A;  4JI0 L;  4AYB G;  1WFQ A;  4OXP A;  5FLX c;  3A0J A;  1P16 A;  4YCV A;  4BBR H;  5C44 G;  3OTO L;  1UWV A;  5LMU Q;  4R4T A;  1XPO A;  1Q7Y C;  2UXB L;  3KJO A;  1G29 1;  3CC4 A;  3M3Y H;  3A74 A;  1X3F A;  3RN2 A;  4DR7 L;  2L15 A;  1VQF A;  2ALY B;  4JOI A;  4A3E G;  1EFW A;  4LUZ A;  4LF8 L;  1T9H A;  4GLA C;  4DUZ Q;  1AE3 A;  4A75 A;  1YJ9 A;  4X64 Q;  2BH8 A;  2Q2H A;  4A3G G;  5C4X G;  2UU9 L;  3TRZ A;  1YI2 A;  2AHO B;  1EWI A;  1KRT A;  4PZ6 A;  2VQF L;  2JA6 H;  1LYL A;  2JA8 H;  1PH6 A;  1PH8 A;  5M5Y H;  4Y7N H;  3M4P A;  4O0A A;  2RF4 A;  1SE8 A;  3EIV A;  3JC6 6;  3OYY A;  2K50 A;  4IO9 A;  4LWC A;  1N34 Q;  4BXX H;  4HJ7 A;  1YIJ A;  1N32 L;  1O7I A;  2ATW A;  1Y14 B;  5BR8 Q;  3CD6 A;  2BA1 A;  1M1K C;  4L5R C;  4L5Q A;  1UE1 A;  4A3D H;  5JJL A;  4B3R L;  1G6P A;  5GAE C;  3E9H A;  2K14 A;  2OQ0 A;  2YTX A;  3L2P A;  1U5K A;  3S17 H;  3HKZ G;  1IL2 A;  2NN6 I;  1EOV A;  3U58 A;  4A3B H;  5EAY A;  3RN5 A;  2I0Q A;  2VY3 A;  1WCM H;  4R4C A;  1L2F A;  1PH4 A;  2EXD A;  1VQN A;  3B6Y A;  5IYC G;  3KJP A;  3K7U C;  1VQ8 A;  1CSP A;  1MJE A;  1VQO A;  2JA5 G;  1VQG A;  1V1Q A;  4DR5 L;  2ES2 A;  5LMN W;  1XMO Q;  4L5S A;  4BA2 I;  4PMW A;  1L1O C;  1YEZ A;  3AFP A;  4DKA C;  4HJ5 A;  4JI6 L;  3J81 i;  2CQO A;  2DUD A;  2JA9 A;  5IP9 G;  4A3I H;  1VQM A;  4OWT B;  3OTO Q;  3CF5 A;  1YHQ A;  4OWW B;  1K73 C;  2B63 G;  1GKH A;  4BY7 H;  3CC2 A;  4JI4 Q;  2AKW B;  5FJ8 H;  2KHJ A;  1IZ6 A;  2KEN A;  4LF8 Q;  5C3E H;  1HNZ L;  4TVA B;  4C3H H;  1BBU A;  4X66 Q;  2IHF A;  2CFM A;  3A5U A;  4IJL A;  1VQK A;  2UU9 Q;  2JQO A;  1VQ6 A;  3K0X A;  3S1M H;  1RL2 A;  5GRO A;  3K7A H;  4HID A;  1VQL A;  2IY5 B;  2B29 A;  4MNO A;  4DR3 Q;  1KL9 A;  3CXC A;  1NY4 A;  2UXD Q;  2GVB A;  2DGY A;  3ULJ A;  3OW2 A;  2UXC L;  3F8T A;  1N32 Q;  3RLO A;  2ZTE A;  1Q1B A;  3S1N H;  4UY8 C;  3CCM A;  3GTL H;  4B3R Q;  4DR4 Q;  5FLM G;  4DV0 Q;  1X55 A;  1SMX A;  1VQ9 A;  4C3J H;  3NEM A;  1EYG A;  3S24 A;  4X62 L;  3CCL A;  1E3P A;  3LGJ A;  3FKI H;  1U0L A;  1EUJ A;  4LF4 L;  4JI7 Q;  4JI1 Q;  2ZJP A;  4GKJ Q;  2N8N A;  1N9W A;  1PH7 A;  3HOY H;  1VQJ A;  4IFD G;  4ME3 A;  2RHS B;  3W5O A;  2Q2T A;  1IBK L;  2R93 G;  1PFS A;  3W1B A;  1PH3 A;  1A8V A;  5JJK A;  4BY1 H;  1Z47 A;  1X9N A;  1JE5 A;  3DLL A;  2F4V Q;  4NPS A;  1X6O A;  3D31 A;  1ASY A;  5IE8 A;  4DUY L;  1SRU A;  1HZC A;  2R7Z G;  4RG1 A;  5J3B A;  1Y1W H;  2ZM6 L;  2ID0 A;  3S2D H;  4BBR G;  2JE6 I;  3I4O A;  5IY0 A;  4DV7 Q;  3CME A;  2QA4 A;  3ULP A;  2LXJ A;  1HNZ Q;  4A3K G;  3GTM H;  3HOX H;  4LFA L;  1D8L A;  1E24 A;  1JB7 A;  2JEA I;  4AIM A;  2ZJR A;  3PO2 G;  3HKZ E;  3Q8D A;  1PYS B;  3TQY A;  1B7Y B;  3T1Y L;  1TXY A;  3FP9 A;  2JA6 G;  3M85 A;  2GVA A;  2A8V A;  3ER0 A;  2UXC Q;  2JA8 G;  3CPW A;  1I94 L;  1XPR A;  1CKO A;  3M7N A;  4JI5 L;  3D0F A;  4DV3 L;  1N36 L;  1TWF H;  2N49 A;  4LF9 Q;  3IRB A;  2HHH L;  2PMZ E;  1TWG H;  2WB1 G;  4KI0 A;  1XMQ L;  4NXN L;  3GTJ H;  3J7A 5;  2QEX A;  3ERS X;  2CKZ B;  4B3M Q;  1XNR L;  3GTK H;  4GOP C;  1AH9 A;  5C0X J;  3RR5 A;  4X62 Q;  1NTG A;  2XTI A;  4DPG A;  1XJV A;  2OTL A;  2E8G A;  3S2H H;  3UDX A;  2PI2 E;  1K8G A;  1GVP A;  3PIP A;  4A3B G;  3GTQ H;  2CWP A;  2D0P A;  3L0O A;  3L7Z C;  4NB3 A;  4QGU A;  1WCM G;  2VQE L;  4A3J H;  1IBL L;  3UE1 A;  5IYB H;  5IWA L;  4HIM A;  2BH2 A;  3CMA A;  1H95 A;  1FJG L;  4A3M H;  4JI2 L;  4QIW E;  1Q46 A;  3S16 H;  4LF5 L;  4KHP Q;  4IPG A;  5IP7 H;  5M5W H;  4DUY Q;  3I4M H;  4YWM A;  3S1R H;  2KHI A;  4A3I G;  2UUC Q;  1S3O A;  1N8R C;  3M9B A;  1I6H H;  4X6A H;  4LF7 Q;  5E7N A;  5GAH C;  1Y1V H;  2QGQ A;  3ICE A;  4LFA Q;  4BY7 G;  1KHI A;  4KHZ A;  5M3M H;  3RZD H;  5FJ8 G;  1HR0 Q;  3I4N G;  4GKK L;  4JV5 L;  5C3E G;  4AQY L;  1ASZ A;  4LW1 A;  3KDF A;  4IPC A;  4R1J A;  5C0X I;  5IT9 c;  4UP9 A;  3T1Y Q;  2ASB A;  1L1O A;  2BA0 A;  4WJ3 M;  3AEV A;  3CPF A;  3U4V A;  2R92 G;  1BBW A;  1I94 Q;  1K8A C;  1JT8 A;  4BA1 I;  4GS3 A;  4YWK A;  2YYZ A;  1VQ7 A;  4JI5 Q;  1DGS A;  1N36 Q;  4K0K L;  2OTJ A;  5DLQ E;  2LSS A;  1S40 A;  2HHH Q;  1GM5 A;  2AMC B;  1YJW A;  3BJU A;  1XMQ Q;  2K5V A;  1W2B A;  1IYJ B;  4NXN Q;  2JA7 H;  1A62 A;  2MQH A;  1VQA A;  1VQI A;  2IX0 A;  4DR1 L;  1EIY B;  1QVF A;  1XNR Q;  2NVQ H;  3PF4 A;  3G6E A;  4LFB L;  1E22 A;  1I3Q H;  2WAQ G;  1HZ9 A;  4DAY B;  4LF6 Q;  1PA6 A;  1YJN A;  3GTO H;  2HT1 A;  4JI0 Q;  4C3I H;  2A19 A;  4LUO A;  1IBL Q;  2RCN A;  1C0A A;  3FKI G;  3J80 c;  2UXB Q;  3PUW A;  3UE0 A;  1IBM L;  5IWA Q;  3KDF B;  4YY3 L;  4DR7 Q;  4UP8 A;  5C44 H;  3H3V I;  1LTL A;  1M90 C;  4JCV E;  1KIX A;  3HOV G;  1L1O B;  2HIX A;  2R6G A;  4P75 A;  1VCI A;  2VW9 A;  4GLX A;  3HOY G;  2Y0S E;  4EQ5 A;  4O2D A;  4JBM A;  2VQF Q;  4BY1 G;  4DK3 C;  5AJ3 L;  4GLV B;  4JI8 L;  1X54 A;  4BBS H;  3T1H L;  3M4Q A;  4JC0 A;  3J81 j; 
#chains in the Genus database with same CATH topology
 3OOC A;  2EZV A;  3O13 A;  4QB4 A;  2CH4 A;  1Y1W G;  5ELE A;  1Q82 C;  2ICI A;  3L3O C;  2FMC A;  4A3L G;  3TP5 A;  2MPM A;  2YV5 A;  3PUV A;  1VQD A;  1LT3 D;  2EYP A;  3D4D A;  3TBI B;  1SEB D;  1HZB A;  4K8J A;  1AZQ A;  2DNC A;  2IWH A;  4DR5 Q;  2M9V A;  4OO1 G;  3SR1 A;  2K33 A;  2NB0 A;  2QW7 A;  4R4Q A;  3K58 A;  1HNX L;  1PRT D;  1ML0 D;  3NTH A;  1OXS C;  1EQQ A;  2BOS A;  5IYD H;  4X65 L;  4DV4 L;  1NR4 A;  3DWQ A;  4Q0F A;  5IP9 H;  2VNU D;  1NMF A;  2V4D A;  1CKM A;  1JR0 D;  4IUQ A;  1GUW A;  3DUZ A;  2A6H D;  3NQI A;  5L37 A;  1NMG A;  3TS0 A;  3I3C A;  5AJ3 Q;  1KD1 C;  4IFD J;  4YCU A;  5IP7 G;  3IFD A;  1ET9 A;  1STB A;  3EJI A;  3GDE A;  2EJF C;  3S1N B;  1PXU A;  2IJ0 A;  3GTL B;  1OTC A;  1KNE A;  4ZKC B;  2D2C C;  3RMH A;  4KLK A;  4K14 A;  4C3J B;  1BR9 A;  5FO7 B;  3FHW A;  2E2J H;  3OIQ A;  1C4Q A;  3RUZ A;  5K5P A;  4DV1 Q;  1CM9 A;  5IGB A;  4I7Z C;  2B8F A;  2NN6 G;  1QZH A;  1V1P B;  4DFA A;  4H7B A;  1PVO A;  4BY1 B;  3GO5 A;  4M1U B;  1MSG A;  5C4H A;  1KTK A;  3BU2 A;  1SR3 A;  4Q5V A;  4DAV A;  1DXM A;  4KY5 A;  1YBY A;  3EN2 A;  3GTM B;  3HOX B;  1B50 A;  2Z9H A;  2NTS A;  3ND8 A;  2NZH A;  2K6A A;  1HNW L;  1SE4 A;  4XTC S;  1A6X A;  1G6Z A;  1GUO A;  3J7A V;  1I6V C;  5C0X H;  4AH6 A;  1DD2 A;  1X3E A;  2K75 A;  1YNX A;  4JI4 L;  1UE7 A;  1TWF B;  4R4O A;  2HQL A;  3SGI A;  4X66 L;  4ALP A;  1AEX A;  3PSI A;  4DV3 Q;  3D4R A;  5CV8 A;  1F9S A;  5H1S E;  3K80 C;  4LFC L;  1WTX A;  1ICF B;  1TS4 A;  3S2H B;  4P73 A;  1BXT A;  2OXP A;  3NTK A;  1NBW A;  1AE2 A;  4K2L A;  1UE5 A;  3GTQ B;  2A1A A;  5E1F A;  3U4Z A;  3D3R A;  1CKN B;  4B3S Q;  4DK6 C;  1X32 A;  2A68 C;  3UDI A;  2F0L A;  1B2T A;  5LMN L;  4DR4 L;  4U68 A;  4A3M B;  1YVC A;  4LUV A;  3BZC A;  1WTP A;  1CI3 M;  2KJX A;  3PUX A;  2XRQ D;  2V1C C;  2VS1 A;  2O4X A;  4CKB A;  1RDP D;  3HRZ C;  4ID6 A;  4JI7 L;  1D6E C;  4V19 0;  1Y1V B;  4KN4 C;  1EFI D;  1MSH A;  1JOR A;  1L0X B;  4DAM A;  1Q90 A;  2KCM A;  5IYD G;  1PTO F;  4TSS A;  2MHV A;  4RCN A;  4DR2 L;  2RSN A;  4N8F A;  1RTO A;  1J5E L;  5CMD A;  3MFG A;  1EOT A;  1QVC A;  1VS0 A;  2M2L A;  1JQY D;  1CHQ D;  2I5M X;  2R92 H;  1BO0 A;  4LNQ A;  4DR1 Q;  3LWE A;  1NE3 A;  1XPU A;  5TSS A;  4FXD A;  1A3T A;  4DV5 Q;  5C4J H;  1EZ6 A;  1E1T A;  2LKV A;  1VQE A;  1G51 A;  3PUY A;  1CK1 A;  2B2V A;  2LXK A;  4TQU S;  1TWH H;  1O7Z A;  3F2C A;  3MXN A;  3M7G A;  5CYU A;  2K5D A;  3I56 A;  2F52 A;  3CW2 C;  3AQQ A;  4ABN A;  1KAW A;  2Z8L A;  4IN3 A;  1ILP A;  2NVY H;  1WYD A;  3RZD B;  4HMJ A;  1A2T A;  3TP6 A;  3HOV H;  2L5T A;  1SMY D;  5C5L A;  3I7F A;  1PH5 A;  5CBE E;  3I73 A;  4B9X A;  2RBM A;  2VUM B;  3F1Z A;  1TT2 A;  4KHP L;  2MO0 A;  2PI2 A;  1QNK A;  3J7Z C;  5DM7 3;  1LUZ A;  1YHA A;  1TR5 A;  3TSS A;  4A3C H;  1ILQ A;  1PYB A;  3GTG B;  3HKZ B;  1YNJ C;  1Q12 A;  3RLN A;  5GQO A;  1HH2 P;  5C0X G;  1QOH A;  5JEA J;  3GP7 A;  2B2W A;  1GXD C;  1QVG A;  3K81 C;  5F2D A;  2E2H B;  2K01 A;  5COR A;  5BR8 L;  5IGC A;  3Q23 A;  4PZ8 A;  2Y0S G;  3I8Z A;  3E0E A;  2BCO A;  2DJF C;  1BF4 A;  1MKH A;  1UUP A;  4YHH Q;  1PH1 A;  1R9T B;  4L8J A;  4OO1 I;  1AW7 A;  2IX1 A;  1CTM A;  3JAM E;  3DM3 A;  5EKK A;  1EY7 A;  4LF6 L;  3GQB A;  1TWC H;  2MUY A;  4JI0 L;  1H9J A;  3OTO L;  1UWV A;  5IGF A;  1XPO A;  3S15 B;  2UXB L;  1G29 1;  3OW7 A;  3M3Y H;  1L0Y B;  1Q3L A;  4DR7 L;  1VQF A;  5IGE A;  4K6L A;  2NVT B;  1WTH A;  4GLA C;  2LFN A;  2FIN B;  4DUZ Q;  4A75 A;  1YJ9 A;  2UU9 L;  3TRZ A;  2AHO B;  1KRT A;  2JA6 H;  3NHH A;  4IAL A;  2KCN A;  5KIX A;  4KKU A;  1N34 Q;  1WTR A;  3H0G B;  4HJ7 A;  5COY A;  1ESR A;  3CD6 A;  2BA1 A;  3SK5 A;  4L5R C;  4A3D H;  1G6P A;  5GAE C;  3L2P A;  1IHZ A;  2NN6 I;  1EOV A;  3U58 A;  1O80 A;  2VY3 A;  1II3 A;  2DY7 A;  2EXD A;  1VQN A;  3OHX C;  1MJE A;  2ES2 A;  5LMN W;  2K05 A;  4PMW A;  1YEZ A;  3AFP A;  4DKA C;  4JI6 L;  4HJ5 A;  3J81 i;  2CQO A;  2DUD A;  4XYQ A;  2JA9 A;  5FOB B;  4ODG A;  1VQM A;  4R9W A;  4OWT B;  1JWU D;  1XYI A;  2YU9 B;  2B63 G;  2A5H A;  2JXM B;  2R61 A;  3A8I E;  3VR3 A;  3NPP A;  4H13 C;  1G8Z D;  3J81 E;  4DK0 A;  2JQO A;  3MWY W;  5KEE A;  1IYV A;  4MNO A;  1ROD A;  1NNX A;  1NY4 A;  2F0Q A;  4X3U A;  1N32 Q;  5HGT A;  2ZTE A;  3S1N H;  1SJH D;  3GTL H;  4Z9C B;  4RGT A;  1EWC A;  1EY0 A;  1VQ9 A;  4KN7 C;  4C3J H;  3BYY B;  5I4D A;  1DJR D;  3KUP A;  2RCF A;  1U0L A;  4A3G B;  1I4R A;  1H9S B;  2ZJP A;  1F9P A;  3K0Y A;  2AQ2 B;  1D5Z C;  1N9W A;  2N8N A;  2WKC A;  1IBK L;  4BY1 H;  2Q8T A;  1PZK D;  1JE5 A;  5NUC A;  3W3A A;  3A7L A;  2F4V Q;  3A54 A;  5IE8 A;  4RG1 A;  2RQX A;  4G4K A;  2E2D C;  4IUU A;  3P20 A;  3BDO A;  4A3K G;  3HOX H;  3GTM H;  2IX3 A;  2RSO A;  4DK1 A;  2JEA I;  2IPK D;  2KEC A;  4AIM A;  3PO2 G;  3HKZ E;  1FNU A;  2JA5 B;  2I07 B;  1LAC A;  2O2L D;  1TXY A;  2JA6 G;  1JWS D;  1K83 B;  3CPW A;  3KLS X;  1TWF H;  4LF9 Q;  3J7A 5;  1W6K A;  3T13 A;  1W6J A;  3ERS X;  4B3M Q;  1XNR L;  2EYL A;  4HCE A;  2XTI A;  1XJV A;  3CRL C;  1LO5 D;  3S2H H;  2G5D A;  1QB5 D;  1GVP A;  3PIP A;  4DXG A;  3GTQ H;  4NB3 A;  2VQE L;  4XYO A;  3CU7 A;  2F0F A;  3UE1 A;  5IYB H;  5ISR A;  1STH A;  2B2W C;  4HTH A;  4G7O C;  1H95 A;  4RKL A;  4A3M H;  1FJG L;  2F3V A;  4WJW A;  3URY A;  4LF5 L;  1CZW A;  1PZI D;  2EY2 A;  4DAY A;  4X6A H;  5GAH C;  1Y1V H;  2AQ1 B;  3DWP A;  3R93 A;  4LFA Q;  3SK8 A;  5LL6 S;  3DWA A;  1KHI A;  4ZKB B;  4JV5 L;  1EEF D;  2F0W A;  4AQY L;  5I6W A;  3S14 B;  1MI2 A;  4R1J A;  5C0X I;  1L1O A;  3AEV A;  3CPF A;  1PYW D;  2XWJ B;  1JT8 A;  1I94 Q;  3DHQ A;  1VQ7 A;  2YYZ A;  2TSS A;  4K0K L;  1DGS A;  5DLQ E;  4RGN A;  2HHH Q;  1GM5 A;  2K7V A;  1IYJ B;  1U9R A;  3VYR A;  5I2X A;  1D7Q A;  3PF4 A;  2F4I A;  2F0E A;  3G6E A;  2NBF A;  2HT1 A;  2ICE C;  4C3J G;  2EDG A;  1S5B D;  4UHV A;  4XT1 B;  4WRD A;  1KLG D;  1PMR A;  4F8M A;  3PUW A;  1BNZ A;  1IBM L;  5JAV A;  3KDF B;  5CBA E;  4JYA L;  2JA8 B;  2R6G A;  2HIX A;  4GLX A;  1BCP F;  4NW2 A;  2DJG C;  2L55 A;  4BY1 G;  1IL8 A;  4DK3 C;  4GLV B;  3I70 A;  3RZD H;  4JC0 A;  3J81 j;  5E3F A;  4KKT A;  3KLW A;  4DXF A;  2VUM H;  4GKK Q;  2EYJ A;  3HOX G;  4G57 A;  4QF4 A;  1WD0 A;  4A93 G;  1QUQ A;  3KK7 A;  1TII D;  2EY6 A;  3H3V C;  2PCF B;  4OHJ A;  4QJF A;  4CGY B;  3GTG H;  4IOA A;  4H02 A;  3D8G A;  3FVQ A;  4J15 A;  5ELB A;  3UDG A;  3A8K E;  3CCE A;  2E2H H;  3UDF A;  2WAC A;  2A68 D;  5CR3 A;  5HY6 A;  1EU3 A;  1N33 L;  4BY7 B;  1Q8K A;  4P2C B;  3TEH B;  3NBH B;  3C1F A;  5EPJ A;  4FF1 A;  1NSN S;  5FO8 B;  5C3E B;  2PW7 A;  1R9T H;  1J9O A;  2X6L A;  4YY3 Q;  4NXM L;  5KNB A;  4EGV A;  3BVM A;  3BVZ A;  4DR6 L;  5IYB G;  4BS9 A;  1MJC A;  1PFB A;  2SNS A;  4A3M G;  1OXU A;  4IJH A;  4OEM B;  4JI8 Q;  1HZA A;  4WFN 3;  1V1O A;  4GOP A;  3S15 H;  1ONL A;  2ZJQ A;  1MIU A;  3TP7 A;  3E3X A;  1KRS A;  4IUR A;  1B8A A;  1Y1V G;  2NVT H;  2HD3 A;  1G2S A;  3CCV A;  1QG7 A;  3KBG A;  2B3G A;  3HOY B;  1E0B A;  4IPH A;  4LF4 Q;  2CCZ A;  4MN3 A;  3H0G H;  3KYH C;  5DNF A;  3NWT A;  2EPB A;  3OIP A;  2DN8 A;  4ZK9 B;  2MGS A;  4IFD H;  3DXJ C;  4MIU A;  2EIF A;  4X65 Q;  4DV4 Q;  2OQK A;  4S3S A;  5GAD C;  2ZM6 Q;  1E2Z A;  3D6W A;  1SE3 A;  4XDX A;  1FGU A;  2KED A;  3K5M A;  5JPM C;  3FDT A;  4L5T A;  5GAG C;  3KLS A;  3KBX A;  1QWY A;  1HJP A;  1JIC A;  2K5N A;  5EKI A;  2EXZ A;  4B3T L;  4DAP A;  1OXT A;  5CGK A;  2YU9 H;  2WKD A;  2G9H D;  1YNJ D;  1A63 A;  4DR3 L;  3EVQ A;  2VUM G;  1K3R A;  4A3J B;  1Q1E A;  1K3B C;  1MD2 D;  1UEA B;  3J7A F;  3A56 A;  2E5L L;  4DV6 L;  3H94 A;  1XNQ L;  4FF4 A;  3S16 B;  1IXR A;  5M5W B;  1EZ8 A;  1B1Z A;  3I4M B;  2B2U C;  4IQZ A;  3KF6 A;  3S1R B;  1A15 A;  4PNY A;  3ULL A;  4JI1 L;  3HEJ A;  1I6H B;  4CJ1 B;  2QIL A;  3JAM L;  2WP8 J;  1S5D D;  4A3G H;  2C35 B;  2K4K A;  1HNW Q;  3C1E A;  1J8I A;  1M8A A;  2HCI A;  1BQQ T;  3E5S A;  3H15 A;  1FR3 A;  3JAM c;  1HQR D;  3AFQ A;  2E74 C;  2LS0 1;  1ENA A;  2XGT A;  1PH9 A;  4DV7 L;  2JYO A;  3MXU A;  3PQI A;  1Q8I A;  2VXW A;  2JA7 B;  2WFW A;  1LTA D;  1I3Q B;  4LFC Q;  3CC7 A;  5KGU A;  2LMC B;  4NDX A;  3CHB D;  2B39 A;  1S5C D;  3BZD B;  4JBW A;  4C3I B;  4K2K A;  1UE6 A;  1O78 A;  2JA5 H;  1OXX K;  5LMN Q;  1K83 H;  2LY7 A;  5C44 B;  1V43 A;  4ZAI A;  5IIF A;  2UUB L;  2QEJ C;  4GNX A;  3H0G G;  5LHY 1;  5J39 A;  1Q81 C;  5HUR A;  2KEE A;  1OXV A;  2F0S A;  2QF7 A;  4BBS B;  2D5D A;  1VQB A;  2N78 A;  3HGB A;  1JJG A;  1PTO B;  1LT4 D;  3RZO B;  1SNC A;  1S72 A;  4DR2 Q;  1HFN A;  4JPB W;  2CWA A;  4J1M A;  1V8Q A;  3TZU A;  4RKB A;  3MA2 B;  1J5E Q;  3CCS A;  1I4P A;  3X3N A;  4LF7 L;  3PIO A;  1SE2 A;  3C46 A;  3TME A;  2DNE A;  3MXN B;  2VL6 A;  4RGM A;  4N9P A;  1PHJ A;  5FLM H;  1HR0 L;  4B9W A;  1T5E A;  3HOU B;  3KLR A;  3BZK A;  2ENB A;  3J81 c;  1UEB A;  2PMZ B;  3PO3 B;  3S14 H;  5C3W A;  4GN3 B;  1SND A;  5BN4 A;  1GJX A;  3MZ5 A;  4LAA A;  5M5X B;  4PMC A;  3V96 A;  1XMO L;  5BN3 A;  4O1N A;  4KD3 A;  3OMC A;  2F0H A;  1PRT F;  2ZTD A;  4OL7 A;  3E9I A;  5JJI A;  4GN5 A;  3HOW B;  4TKO B;  4UDU C;  1VQ6 A;  3K57 A;  5LMU Q;  5JEA H;  1Q7Y C;  4X3S A;  1Y8N B;  2PNR C;  3A74 A;  3QB3 A;  4JOI A;  1EFW A;  4LF8 L;  4LUZ A;  2M00 A;  1AE3 A;  1HA5 A;  2J4X A;  4A3G G;  4DA2 A;  1CQF A;  3PMF A;  1YI2 A;  1EWI A;  2VQF L;  1JB3 A;  2NVX B;  1NUC A;  2JA8 H;  1PH6 A;  1SNP A;  1EY5 A;  2K03 A;  5M3F B;  2RF4 A;  1GUN A;  2K50 A;  3C2P A;  5BR8 Q;  2Z1C A;  2CW0 C;  1KDA A;  1UE1 A;  5JJL A;  4B3R L;  4QMG A;  1U5K A;  2AUK A;  1EYD A;  4RWS C;  2I0Q A;  1PH4 A;  3EQL C;  3K7U C;  5T1I A;  1VQ8 A;  1JOQ A;  1CT1 D;  1VQO A;  2JA5 G;  4DR5 L;  2K5Q A;  3TN2 A;  2Z6B A;  1QCB D;  3OSO A;  5EPK A;  3ZYY X;  3FMC A;  5IP9 G;  3OTO Q;  2EVB A;  3CF5 A;  4B08 A;  2X6G A;  3S9W A;  4BY7 H;  3CC2 A;  2AKW B;  2KHJ A;  5G3L D;  5C3E H;  3NSW A;  3T53 B;  3PIO 3;  3DM1 A;  4TVA B;  1BBU A;  5FK9 C;  4H44 C;  2CFM A;  3VR2 A;  3A5U A;  2UU9 Q;  1SSO A;  4DGZ A;  1LTS D;  2KVM A;  1RL2 A;  5GRO A;  4HID A;  1I4X A;  5I2Y A;  2B29 A;  2UXD Q;  1KL9 A;  2GVB A;  3OW2 A;  2UXC L;  3F8T A;  4AYB B;  1Q1B A;  4UY8 C;  2F0V A;  1NCV A;  5FLM G;  4ZRZ A;  4DV0 Q;  2F0K A;  5FLX E;  1SMX A;  1EYG A;  3S24 A;  4X62 L;  4XT3 B;  3CCL A;  1SYD A;  3R3O A;  5C4X B;  2PZW A;  3LWU A;  1U4P A;  4GKJ Q;  1SYE A;  5EBC A;  4CDE C;  4F7X A;  1TWA B;  1PH7 A;  3HOY H;  3IFT A;  2Q2T A;  2I46 A;  1A8V A;  3ERQ A;  2JSO A;  1HA6 A;  3NQT A;  1TKW B;  4NPS A;  3D31 A;  1SRU A;  5J3B A;  1S5E D;  2ID0 A;  3S1Q B;  3T56 B;  2JE6 I;  2L0C A;  3I4O A;  3CME A;  2QA4 A;  2LXJ A;  4C2M B;  4K5X A;  1D2B A;  1D8L A;  1E24 A;  1EL0 A;  2N55 A;  1VDZ A;  1B7Y B;  2OEO A;  3I4N B;  2WAQ B;  2JA8 G;  1XPR A;  4JI5 L;  4DV3 L;  5I9O A;  2N49 A;  3IRB A;  2PMZ E;  1XMQ L;  4KI0 A;  1ZXT A;  5EGT A;  2CKZ B;  3OPO A;  5A35 A;  1AH9 A;  2XN9 C;  5C0X J;  1EQT A;  1NTG A;  4DPG A;  2E8G A;  3T4A C;  2PI2 E;  1Y8O B;  2CWP A;  2D0P A;  5E4X A;  4QGU A;  1IBL L;  4A3J H;  1TQO A;  3K5N A;  3U9S A;  2BH2 A;  2O5I C;  3S16 H;  4IPG A;  5M5W H;  3I4M H;  3S1R H;  3QOJ A;  2Z4H A;  2UUC Q;  1I6H H;  1O7Y A;  2SEB D;  2NTT A;  4C56 C;  3ICE A;  4BY7 G;  3M4O B;  1RJT A;  1XX8 A;  5M3M H;  3AB9 A;  3MHB A;  5C3E G;  2NWG A;  1ASZ A;  3SDZ A;  5DEH A;  4HMI A;  2R92 G;  1K8A C;  5J22 A;  4GS3 A;  3BDC A;  2Q8I B;  2K5V A;  2JA7 H;  3IKJ A;  2IX0 A;  4TRD A;  4DR1 L;  1EIY B;  1QVF A;  1XNR Q;  1KDC A;  4BBR B;  1E22 A;  1I3Q H;  4DAY B;  1PA6 A;  2PPB C;  2F0G A;  4C3I H;  2B2T A;  1AZP A;  1JC7 A;  4J8Q A;  5KNC A;  4CDF C;  3IAY A;  3VYS A;  5C44 H;  1XTC D;  5I9P A;  5A2Q E;  3HOV G;  4JCV E;  1L1O B;  3HOY G;  3M7N A;  1VCI A;  5M5Y B;  1E2W A;  4Y7N B;  4RHR A;  4JBM A;  1GUG A;  3P75 A;  3D6C A;  4BBS H;  3T1H L;  3M4Q A;  2EYH A;  4PG3 A;  4CKC A;  4A3C G;  2K32 A;  1QIL A;  3S17 B;  1B9M A;  3DEP A;  1PTO H;  1YZ6 A;  4AQY Q;  3RZO H;  1K0R A;  4A3B B;  3TZD A;  1B4O A;  1W3S A;  4FNF A;  1SYC A;  1SNQ A;  3ITP A;  4AYB E;  1PFM A;  2PQA A;  1U4R A;  1KXL A;  1X3G A;  4A4I A;  4K0K Q;  1L0W A;  1IKL A;  4HIK A;  1M4V A;  2Z6K A;  2H4O A;  1ET6 A;  4POF A;  3T51 B;  4YHH L;  3CP0 A;  2UUA L;  2IL8 A;  3HOU H;  5CV9 A;  5ELC A;  1EY8 A;  4ULL A;  3IL8 A;  4FDB A;  4H0L C;  3PO3 H;  2OWO A;  1PTO C;  2L4N A;  4V0B A;  5E4W C;  5M5X H;  4A3J G;  2R7F A;  2VZA A;  4K5W A;  4FYD A;  1QUQ B;  4HED A;  2Q2U A;  3K7A B;  1Z9F A;  4I65 A;  1BCP B;  1U4L A;  3LNN A;  1FD7 D;  3N52 A;  2B2V C;  4EQO A;  2H5X A;  2EYM A;  4UP7 A;  1ZYR C;  1P8L A;  3J80 i;  3HOW H;  3I4M G;  3TS2 A;  4DUZ L;  1A0I A;  4K8I A;  3AYH B;  4MZ9 A;  2QDB A;  1RKN A;  4WOR A;  1FNW A;  2WAQ E;  3E0J A;  2BE5 C;  5M3M G;  3J7Y W;  3KF8 A;  2NVX H;  1FVI A;  4A3D G;  1N34 L;  1LLR D;  2EQS A;  2HDL A;  3J80 E;  3PF5 A;  3VR4 A;  4XQN A;  5M3F H;  1PLF A;  1B3A A;  1XXG A;  4CDC C;  3VR5 A;  4NKL A;  2WIN B;  1RF2 D;  5KRU A;  3BG3 A;  4RAU C;  3HS0 C;  2JA7 G;  1RCV D;  2G9D A;  2IHE A;  4GOP B;  3S2D B;  3CCU A;  2F0O A;  3QOL A;  2DY8 A;  2RKS A;  2ZTC A;  4C3I G;  3SVM A;  3NEN A;  4APV A;  4P71 A;  1WD1 A;  3BDL A;  4UAI A;  3MFY A;  5ELO A;  3DEO A;  2L1B A;  2OCE A;  1I5F A;  3KOJ A;  1QNU A;  4KKS A;  4HJA A;  3F2U A;  3GTJ B;  1CUK A;  1GO3 E;  4BBS G;  3GTK B;  5D65 A;  1EIH A;  4ZCK A;  2NZO A;  4KY7 A;  4JI3 L;  1X65 A;  1Q86 C;  4HCS A;  4FF2 A;  3CCJ A;  5EPL A;  2EY5 A;  4DN4 M;  3H3V H;  3VDY A;  1VQC A;  5IGD A;  1EQV A;  2N88 A;  3WOF A;  4JI2 Q;  1K0S A;  2H1E A;  1TS5 A;  1SN8 A;  3HOU G;  4IUP A;  1X56 A;  4A76 A;  1WJJ A;  1UAP A;  5C4X H;  3Q22 A;  1I4G A;  3PO3 G;  2PYK A;  3AU7 A;  3U50 C;  1TWA H;  4OX9 L;  3WWV A;  2F4V L;  2A6E C;  3G71 A;  2FJ2 A;  4FO2 A;  2F0I A;  1K8O A;  3G6J B;  4QUF A;  1NR2 A;  3TRE A;  4B3T Q;  4ME5 A;  3CCR A;  4PZ7 A;  1XWE A;  3S1Q H;  3HOW G;  4HN7 A;  4RFB A;  2RHQ B;  3KF6 B;  4C2M H;  3N6R A;  3PIP 3;  1KQS A;  2HCC A;  4KV6 A;  2HIV A;  4RCO A;  2D0O A;  4J6H A;  4LFB Q;  3KFU A;  3I4N H;  2YTY A;  2CW0 D;  4ZUJ A;  4UPA A;  1MBY A;  4KJO A;  1VF5 C;  5DM6 3;  4LF9 L;  5I6Y A;  1VQ4 A;  4B3M L;  1S4Z A;  2E5L Q;  2JK8 A;  5M3F G;  1H9R A;  4DV6 Q;  1XNQ Q;  3MVV A;  1BKB A;  4DV2 L;  4KD4 A;  1PH2 A;  3I55 A;  3W1G A;  4DNT B;  3STB C;  5JJZ A;  3A7A B;  4YCW A;  3VA7 A;  3RLF A;  1DOK A;  3EFX D;  4IPD A;  2GN5 A;  1B53 A;  4DNI A;  5IOD A;  1HFG A;  1VQ5 A;  4A3F B;  4GN4 B;  4KHV A;  4X64 L;  1RIP A;  3A55 A;  2E2I B;  1NAP A;  2Z6K C;  4R4I A;  2XNA C;  4P74 A;  4HJ8 A;  1R4P B;  2R7D A;  1TY0 A;  4ZYS A;  4GNX B;  4A3L H;  2GA4 B;  3NE5 B;  3F2B A;  3GTP B;  3M4O H;  1Z7T A;  2TMP A;  2Q2I A;  2KCT A;  2J0T D;  1EY6 A;  2NZ1 D;  3HOZ B;  4OO1 H;  1HNX Q;  1EEI D;  2F03 A;  3MC0 B;  3Q6S A;  5FLX L;  2B63 B;  1I50 B;  3GD7 A;  3FPU B;  4R8N A;  1JMC A;  3A5Z B;  4LJZ C;  2UUB Q;  3GV6 A;  5C4Z A;  4QQB X;  1DOL A;  1WOC A;  4OIJ A;  5BN5 A;  1JE4 A;  5EKL A;  1WFQ A;  4AYB G;  4HSV A;  3A0J A;  1P16 A;  5CV4 A;  4YCV A;  4BBR H;  5FLX c;  3KJO A;  2QDL A;  3RN2 A;  2L15 A;  2ALY B;  4PV1 C;  4MTK A;  2BH8 A;  2Q2H A;  5C4X G;  3VYT A;  4PZ6 A;  3TDQ A;  1LYL A;  4HR7 B;  5M5Y H;  4Y7N H;  1DCZ A;  1SE8 A;  3OYY A;  3JC6 6;  1O7L A;  4IO9 A;  4LWC A;  4BXX H;  3MXG A;  1Y14 B;  3C3L A;  1M1K C;  1SNM A;  3E9H A;  2K14 A;  1B9N A;  2OQ0 A;  2Z4I A;  3S17 H;  3HKZ G;  4A3B H;  2A69 C;  5EAY A;  1L2F A;  3B6Y A;  1CA5 A;  2F0T A;  1LT6 D;  1BUV T;  1CSP A;  4IZ8 A;  5D3I B;  1GUS A;  3ONA B;  1XMO Q;  1WTW A;  4L5S A;  1L1O C;  2SOB A;  3WOE A;  1PRT B;  4A3K B;  3P7J A;  1JOO A;  1KAB A;  1SFO B;  4OWW B;  1D1I A;  3PO2 B;  3ND9 A;  1GKH A;  3U9O A;  4JI4 Q;  4LF8 Q;  1HNZ L;  5C3X A;  1AN8 A;  4X66 Q;  2IHF A;  1VQK A;  1ENC A;  2PO4 A;  3K7A H;  3RD4 A;  1VQL A;  3CXC A;  4IUN A;  2DGY A;  3HP3 A;  3QO2 A;  1IW7 C;  2A74 C;  3V05 A;  3CCM A;  4B3R Q;  4DR4 Q;  3NEM A;  4A3E B;  1E3P A;  3LGJ A;  4LF4 L;  4JI7 Q;  4CJ2 C;  2B2Y A;  1JOK A;  1ENF A;  1VQJ A;  4IFD G;  4ME3 A;  1BCP C;  3NXW A;  1Z47 A;  1X6O A;  3NTI A;  1ASY A;  4DUY L;  2XSC A;  4ZQ3 A;  1HZC A;  5A2Q L;  2ZM6 L;  3S2D H;  4BBR G;  5KND A;  5IY0 A;  4DNR B;  3J81 L;  1IKM A;  1A2U A;  2SDF A;  1HUN A;  1CZG A;  2ZJR A;  3Q8D A;  3TQY A;  1SXT A;  4YIJ A;  1SYB A;  2P5Z X;  3T1Y L;  2KCC A;  3FP9 A;  1ZEQ X;  1WTQ A;  2UXC Q;  2D9U A;  1CKO A;  4C1N K;  3D0F A;  1EYC A;  5C6A A;  1N36 L;  1TVX A;  4BXX G;  4NXN L;  3GTJ H;  2K04 A;  2QEX A;  3GTK H;  4GOP C;  3RR5 A;  4X62 Q;  2OTL A;  1X3Q A;  4N9T A;  2F0M A;  2PQE A;  4L6T B;  5DAU A;  4A3B G;  1STN A;  2KHS A;  1SDF A;  4G7Z C;  5IWA L;  4HIM A;  2PW5 A;  2C9O A;  5J1Z A;  1BOS A;  3CMA A;  1STA A;  2CQA A;  5K36 H;  2SNM A;  2K5W A;  3Q0A A;  5LL6 X;  1Q46 A;  1PTO D;  4KHP Q;  3BS1 A;  4YWM A;  4A93 B;  4KY6 A;  1S3O A;  1K8M A;  3M9B A;  1N8R C;  2KQ3 A;  1EYA A;  2QGQ A;  5EQ0 A;  3SK4 A;  3OWE B;  2RA4 A;  1Z6H A;  1ZYR D;  4LW1 A;  4CJ0 B;  1CA6 A;  2HDM A;  4IPC A;  4UP9 A;  1C48 A;  1WTV A;  1KNA A;  2ASB A;  1F9Q A;  4WJ3 M;  3U4V A;  5JOB A;  2R93 B;  1BBW A;  4KTA A;  4BA1 I;  3CQZ B;  2BE5 D;  3SHL A;  4JI5 Q;  2C5C A;  5CV6 A;  1FYC A;  1SYG A;  2OTJ A;  2O5J C;  2AMC B;  1YJW A;  3BJU A;  3FEW X;  1XMQ Q;  1W2B A;  2R7Z B;  2MQH A;  2EJM A;  1LT5 D;  3J80 L;  1TY2 A;  4LF6 Q;  4EVO A;  1YJN A;  4JI0 Q;  1D5X C;  2FFK B;  3SE0 A;  4LUO A;  1IBL Q;  2AQ3 B;  1C0A A;  1D1K A;  3J80 c;  2Q8R E;  2UXB Q;  3UE0 A;  4DR7 Q;  3H3V I;  1M90 C;  4PQX A;  1KIX A;  3I4L A;  4IUT A;  5AJ3 L;  2WB1 B;  1X54 A;  3NP8 A;  3HG9 A;  1LTR D;  2QCP X;  1CHP D;  1DM0 B;  4EQP A;  4A3F H;  4OGQ C;  5CC4 A;  1WCM B;  2E2I H;  3F2D A;  2EYO A;  4JK1 C;  4OWX B;  4F88 A;  1YNN C;  2KOL A;  4DV1 L;  2PNH A;  1C7Y A;  1VMP A;  3ZJY C;  4EX5 A;  1VQP A;  1C8C A;  1JJ2 A;  4XIG S;  4A3I B;  1NJI C;  4JI6 Q;  3GTP H;  1RD9 D;  4LK1 C;  3R2T A;  4RA8 A;  5JVG 3;  4U67 3;  2XVS A;  4C3H B;  3HOZ H;  1G2T A;  1BVS A;  2OF1 A;  2ZXP A;  3P1H A;  3BVG A;  3S1M B;  1V1P A;  5JEA G;  2EE1 A;  2B63 H;  1I50 H;  5IT9 E;  2I5H A;  2K28 A;  2PQA B;  5LMU L;  2RVL A;  3NBI A;  5K36 G;  5G3L F;  5ELD A;  2X69 A;  3NK9 A;  1FGB D;  4RHS A;  3T1H Q;  4GNX C;  2A6E D;  3VA5 A;  1JJC B;  4NP5 A;  4CBV A;  4WJ4 A;  4JBJ A;  1B70 B;  2B2Y C;  2KUM A;  1AP0 A;  3K5O A;  1HR0 W;  2AWN A;  3FKI B;  4HJ9 A;  1GD7 A;  1K9M C;  1G91 A;  4IUV A;  1FL0 A;  1FNV A;  4B3S L;  1DYQ A;  2F0N A;  3PV0 A;  3JAM i;  3K5L A;  2XRS D;  1LM0 A;  1IBK Q;  5IGG A;  2F3W A;  4IOC A;  5M9O A;  2UUA Q;  1XTD A;  1Y1W B;  2I5L X;  4IFD I;  3EA6 A;  1EIF A;  3EBE A;  1CKN A;  3STB D;  1LTG D;  1F2Y A;  2J7Z A;  3I2Z A;  1WTO A;  2K5H A;  2RDH A;  3KF8 B;  3HFZ B;  2JN4 A;  3FRP B;  3WDN A;  3QG1 A;  4A3K H;  3GV3 A;  1C9O A;  1RTN A;  5HGQ A;  1SBB B;  3PUZ A;  2Z0S A;  1SFO H;  1CSQ A;  4OIK A;  3PO2 H;  1ESF A;  3TP8 A;  1VQH A;  1ICW A;  1H9K A;  1TWG B;  2JJQ A;  1WI5 A;  1SLJ A;  2KBN A;  3CCQ A;  1KAA A;  4LMQ D;  3G4S A;  3D4W A;  1DOM A;  1V9P A;  2NYZ D;  4CKE A;  1F2L A;  2UXD L;  2MP1 A;  4JOI C;  4A3F G;  4JBK A;  3QWN A;  4DV5 L;  1VMC A;  2RDG A;  2EJG C;  2VQE Q;  1J6Q A;  1OO9 B;  4FP5 D;  1YHB A;  3RNU A;  1KC8 C;  1PRT C;  4DV0 L;  2KA7 A;  2WV6 D;  3E6Z X;  4NMZ A;  1H9M A;  4KMU C;  4QUC A;  1FJG Q;  5JVH 3;  2K1B A;  4CDD C;  2K52 A;  2A6H C;  4GKJ L;  4LF5 Q;  4OEL B;  4A3E H;  3CRK C;  4XXE A;  1STY A;  3W2D A;  4EQN A;  2VB3 X;  3PGZ A;  3HOZ G;  1DZ1 A;  2WB1 E;  4CHT B;  1PZJ D;  4OON A;  1STE A;  2D62 A;  4JV5 Q;  3I72 A;  4JG2 A;  3MEF A;  1S5F D;  3NUC A;  4RMF A;  2FXQ A;  3ERO A;  3QJY A;  1Y69 U;  4RGO S;  2NVQ B;  5KYI A;  3LX0 A;  2MNA A;  4E6I A;  3G48 A;  1SRO A;  1Y8P B;  2MFI A;  2L9H A;  5IYC H;  4JI3 Q;  3GTO B;  3VR6 A;  3BYT B;  2IT1 A;  4QY7 A;  4POG A;  2ZXO A;  1YIT A;  1LTT D;  1UNS A;  2F3I A;  2JEB I;  4X3K A;  2A69 D;  1EIG A;  1IYU A;  4KK7 A;  3CAM A;  1IBM Q;  3H6M A;  3L9A X;  1GUT A;  1E1O A;  3VYU A;  4JYA Q;  2IW3 A;  2HQE A;  2EOT A;  3NEL A;  2EYF A;  1EQR A;  2CVR A;  4FXK C;  4MTN A;  4YWL A;  4I7A A;  4OX9 Q;  1HTL D;  4GZY C;  2N3S A;  2AWO A;  1PDQ A;  1QZG A;  2A73 B;  1KDB A;  4Y52 H;  2UUC L;  4DF7 A;  1SYF A;  3AMU A;  4ILW A;  5C5M A;  4G7H C;  5EBD A;  4F87 A;  5IOC A;  4A93 H;  3HKS A;  3H09 A;  4HIO A;  1QJO A;  1EY9 A;  1IW7 D;  1PV4 A;  1U4M A;  2MO1 A;  1E7Z A;  1N33 Q;  2F0D A;  2R93 H;  1PFN A;  2WII B;  4QL5 A;  1TS3 A;  2RDF A;  4X3T A;  3CQZ H;  3PCO B;  1BBX C;  3K8A A;  4P72 A;  5JPN C;  4DV2 Q;  4NXM Q;  5CV5 A;  5ELN A;  3V2T A;  1F77 A;  2YTV A;  2R7Z H;  4DR6 Q;  4OXP A;  5C44 G;  4R4T A;  1BCP D;  1MHW C;  2VB2 X;  4QIW B;  3CC4 A;  1X3F A;  2F0P A;  4A3E G;  2ZXR A;  1T9H A;  5AFW A;  4X64 Q;  3SK6 A;  2E2J B;  1HQM C;  3I91 A;  3H91 A;  2XWB B;  1PH8 A;  1DON A;  2MJ8 A;  4FF3 A;  3M4P A;  4O0A A;  1LAB A;  3EIV A;  2B2U A;  1HHV A;  1N32 L;  1YIJ A;  3R8B A;  1O7I A;  2ATW A;  5KYL A;  3OWF A;  5FO9 B;  3DMU A;  1T5X D;  2B8G A;  4L5Q A;  5T1G A;  3CKI B;  3SXH A;  1X3P A;  2YTX A;  1EU4 A;  2FMM A;  1A3U A;  1STG A;  1SAP A;  1IL2 A;  3X3M A;  3RN5 A;  1WCM H;  4R4C A;  5ELF A;  3KJP A;  5IYC G;  2JP1 A;  3MTS A;  1VF7 A;  1VQG A;  1R4Q B;  1V1Q A;  1SJE D;  4BA2 I;  1SMY C;  4QCL A;  1BDO A;  4A3I H;  1YHQ A;  1K73 C;  3HZX A;  4RH6 A;  2HUG A;  2Y0S B;  1JWM D;  4L63 B;  5FJ8 H;  1IZ6 A;  2KEN A;  1H9S A;  4C3H H;  1LTB D;  5EJW A;  4IJL A;  2B2T C;  3K0X A;  3S1M H;  2IY5 B;  4DR3 Q;  1LV9 A;  3ULJ A;  4JW0 A;  2EY1 A;  3RLO A;  1EY4 A;  3MAQ A;  1D5M C;  1X55 A;  4ZUI A;  1K28 A;  1AFP A;  2F1M A;  1TU2 B;  3NWS A;  3A8J E;  2XIW A;  3FKI H;  1EUJ A;  1B3Q A;  4JI1 Q;  3OMG A;  4O42 A;  4ZLT F;  2R3Z A;  1B44 D;  3I90 A;  2RHS B;  3W5O A;  4BWG B;  2R93 G;  1PFS A;  3W1B A;  1PH3 A;  5JJK A;  1X9N A;  4C1N I;  3QR8 A;  3DLL A;  2AUJ D;  2PZT A;  2R7Z G;  2BDO A;  1Y1W H;  3R2I A;  2L12 A;  4DV7 Q;  3ULP A;  3FPP A;  1HNZ Q;  3T16 A;  2R92 B;  4LFA L;  4HAE A;  1JB7 A;  1KLU D;  1JCK B;  1PYS B;  2CHB D;  1GHK A;  1TS2 A;  5C4J B;  1A3V A;  1HUM A;  3M85 A;  2GVA A;  2A8V A;  3ER0 A;  2ZT9 C;  1I94 L;  4XQQ A;  1TWH B;  1EWH A;  1GHJ A;  2HHH L;  1TWG H;  2PZU A;  2WB1 G;  2L11 A;  1YNN D;  2E75 C;  1F2M A;  2NVY B;  4PMB A;  3HOV B;  1F2Z A;  3UDX A;  1K8G A;  3M4Y A;  5FKA C;  3L0O A;  3L7Z C;  1WCM G;  1CQV A;  3MXP A;  3QIA A;  2CH4 W;  4JI2 L;  1HXY D;  4K5V A;  4QIW E;  2NUC A;  5IP7 H;  4DUY Q;  4FVM A;  1HRJ A;  1E2V A;  2KHI A;  4A3I G;  2E76 C;  4DU9 A;  5IT9 L;  4LF7 Q;  5E7N A;  1QE6 A;  1CFM A;  3K6O A;  4KHZ A;  5FJ8 G;  1HTP A;  1HR0 Q;  3Q24 A;  4GKK L;  2FHT A;  4MHE A;  4C3H G;  3KDF A;  4FXG C;  1F9R A;  2F0U A;  5D14 A;  5IT9 c;  2OT2 A;  3T1Y Q;  2NN6 H;  2BA0 A;  4HSP A;  4R8I A;  1LTI D;  4YWK A;  2QKI C;  1N36 Q;  1I4H A;  2LSS A;  1HPC A;  3SEB A;  3K59 A;  1S40 A;  4JVZ A;  3I4N G;  1TWC B;  4NXN Q;  1A62 A;  1VQA A;  1VQI A;  2NVQ H;  1HCZ A;  2WAQ G;  4LFB L;  1HZ9 A;  3MEH A;  3GTO H;  3M3Y B;  4M8A A;  2A19 A;  2RCN A;  3FKI G;  5CV7 A;  1ZKO A;  1MGS A;  2BDN A;  5IWA Q;  2F0J A;  4YY3 L;  1I4Q A;  4UP8 A;  2JA6 B;  1LTL A;  5D3D A;  4P75 A;  2VW9 A;  1RHP A;  2Y0S E;  4EQ5 A;  4O2D A;  2VQF Q;  4XQJ A;  3G7L A;  4JI8 L;  5M3M B;  4KJN A;  1GOZ A;  1WVL A;  4K6D A;  4N8X 1;  1SNO A;  3UI2 A;  3NBH A;  4A3D B; 
#chains in the Genus database with same CATH homology
 4PG3 A;  3KLW A;  1Y1W G;  4A3C G;  1Q82 C;  2VUM H;  4GKK Q;  4AQY Q;  1YZ6 A;  3RZO H;  1K0R A;  3HOX G;  4A3F H;  4JYA L;  2E2I H;  3F2D A;  1W3S A;  1QUQ A;  4A93 G;  4A3L G;  4OWX B;  4AYB E;  2PQA A;  2YV5 A;  4BXX G;  3PUV A;  4DV1 L;  1VQD A;  1KXL A;  1X3G A;  2PNH A;  4QJF A;  4A4I A;  3GTG H;  4K0K Q;  1L0W A;  4HIK A;  4H02 A;  1C7Y A;  3ZJY C;  4IOA A;  4EX5 A;  1HZB A;  2Z6K A;  1VQP A;  4J15 A;  1JJ2 A;  4XIG S;  3UDG A;  4DR5 Q;  3CCE A;  2E2H H;  4OO1 G;  4POF A;  4YHH L;  3UDF A;  1NJI C;  3CP0 A;  4JI6 Q;  3GTP H;  2UUA L;  5HY6 A;  4R4Q A;  1N33 L;  3HOU H;  1HNX L;  1Q8K A;  3TEH B;  3NBH B;  4FDB A;  1OXS C;  1EQQ A;  3PO3 H;  5IYD H;  4X65 L;  4DV4 L;  2OWO A;  1R9T H;  3HOZ H;  2VNU D;  5IP9 H;  1NMF A;  1BVS A;  1CKM A;  4YY3 Q;  5M5X H;  4A3J G;  4NXM L;  2R7F A;  2VZA A;  5JEA G;  1QUQ B;  2B63 H;  1I50 H;  2Q2U A;  4DR6 L;  1Z9F A;  5IYB G;  1NMG A;  2I5H A;  2PQA B;  5LMU L;  3TS0 A;  1MJC A;  5K36 G;  4A3M G;  5AJ3 Q;  1OXU A;  2H5X A;  4IJH A;  1KD1 C;  4JI8 Q;  1HZA A;  4UP7 A;  4IFD J;  4YCU A;  1P8L A;  3J80 i;  3HOW H;  5IP7 G;  3T1H Q;  4GNX C;  4GOP A;  3GDE A;  3I4M G;  3S15 H;  1JJC B;  4DUZ L;  3TS2 A;  1A0I A;  2ZJQ A;  1MIU A;  3AYH B;  4MZ9 A;  1OTC A;  4JBJ A;  4WJ4 A;  1KRS A;  1B70 B;  4KLK A;  1B8A A;  1Y1V G;  2NVT H;  2WAQ E;  3CCV A;  1HR0 W;  2AWN A;  5M3M G;  3FHW A;  2B3G A;  4HJ9 A;  2E2J H;  1GD7 A;  1K9M C;  2NVX H;  1FVI A;  4A3D G;  1FL0 A;  1N34 L;  4DV1 Q;  2EQS A;  4B3S L;  3PF5 A;  2NN6 G;  1QZH A;  5M3F H;  4IPH A;  4LF4 Q;  2CCZ A;  3PV0 A;  3JAM i;  1PVO A;  3H0G H;  3KYH C;  3GO5 A;  1LM0 A;  3BU2 A;  1IBK Q;  4IOC A;  1SR3 A;  2UUA Q;  2JA7 G;  1XTD A;  2IHE A;  4GOP B;  2I5L X;  3CCU A;  4IFD I;  1YBY A;  3EN2 A;  2EIF A;  4X65 Q;  1EIF A;  4DV4 Q;  2OQK A;  3EBE A;  2NZH A;  1CKN A;  5GAD C;  2ZM6 Q;  2ZTC A;  3STB D;  1HNW L;  3NEN A;  4APV A;  3I2Z A;  4P71 A;  4XTC S;  1FGU A;  2K5H A;  3KF8 B;  3HFZ B;  5ELO A;  2OCE A;  4L5T A;  5GAG C;  1I5F A;  4A3K H;  4AH6 A;  1C9O A;  1X3E A;  2K75 A;  3KOJ A;  1YNX A;  1HJP A;  5HGQ A;  3PUZ A;  2Z0S A;  4JI4 L;  1UE7 A;  2K5N A;  1CSQ A;  1SFO H;  4B3T L;  3PO2 H;  4R4O A;  1VQH A;  2HQL A;  1OXT A;  4HJA A;  2YU9 H;  2JJQ A;  3SGI A;  1WI5 A;  1SLJ A;  2KBN A;  4X66 L;  1CUK A;  3CCQ A;  1GO3 E;  4ALP A;  3PSI A;  4BBS G;  4DV3 Q;  3G4S A;  5H1S E;  3K80 C;  4LFC L;  1V9P A;  2NZO A;  1A63 A;  4P73 A;  4JI3 L;  4DR3 L;  1NBW A;  1AE2 A;  2UXD L;  1UE5 A;  2VUM G;  1X65 A;  1K3R A;  4JOI C;  2A1A A;  3U4Z A;  1Q86 C;  4A3F G;  4JBK A;  1CKN B;  4B3S Q;  4DV5 L;  4DK6 C;  3CCJ A;  3UDI A;  5LMN L;  1Q1E A;  2VQE Q;  4DR4 L;  1J6Q A;  1YHB A;  1YVC A;  4LUV A;  4DV0 L;  3RNU A;  1KC8 C;  2E5L L;  3BZC A;  4DV6 L;  1XNQ L;  3H3V H;  1IXR A;  3VDY A;  3PUX A;  1VQC A;  2V1C C;  2VS1 A;  3KF6 A;  1FJG Q;  4JI2 Q;  2K52 A;  3ULL A;  4JI7 L;  4JI1 L;  4GKJ L;  4LF5 Q;  4A3E H;  1SN8 A;  3HOU G;  1X56 A;  4A76 A;  1WJJ A;  2WP8 J;  4A3G H;  4DAM A;  5C4X H;  2C35 B;  2K4K A;  3PO3 G;  1HNW Q;  2KCM A;  3PGZ A;  5IYD G;  1D7Q A;  3HOZ G;  3U50 C;  1TWA H;  4OX9 L;  3WWV A;  4DR2 L;  2WB1 E;  2F4V L;  4OON A;  2D62 A;  3H15 A;  3G71 A;  3JAM c;  4JV5 Q;  3AFQ A;  1J5E L;  4JG2 A;  3MEF A;  2XGT A;  4RMF A;  2FXQ A;  1PH9 A;  4DV7 L;  3TRE A;  4B3T Q;  3CCR A;  4PZ7 A;  2WFW A;  3S1Q H;  1QVC A;  1VS0 A;  3HOW G;  2MNA A;  2RHQ B;  3G48 A;  3KF6 B;  2I5M X;  4C2M H;  1KQS A;  4LFC Q;  3CC7 A;  2R92 H;  1SRO A;  2HIV A;  2D0O A;  2MFI A;  5IYC H;  4DR1 Q;  4JI3 Q;  4LNQ A;  2IT1 A;  1NE3 A;  4JBW A;  4QY7 A;  1XPU A;  1UE6 A;  4POG A;  4LFB Q;  3KFU A;  3I4N H;  2YTY A;  2JA5 H;  1OXX K;  4DV5 Q;  5C4J H;  4UPA A;  1E1T A;  1VQE A;  1G51 A;  5LMN Q;  3PUY A;  1YIT A;  4LF9 L;  1K83 H;  2F3I A;  2JEB I;  2LXK A;  1V43 A;  1VQ4 A;  4B3M L;  4TQU S;  1TWH H;  3F2C A;  2JK8 A;  3CAM A;  5M3F G;  4DV6 Q;  1IBM Q;  2E5L Q;  2UUB L;  1XNQ Q;  4GNX A;  1BKB A;  1E1O A;  3I56 A;  3H0G G;  4DV2 L;  1PH2 A;  3I55 A;  4JYA Q;  3W1G A;  1Q81 C;  3STB C;  2F52 A;  3CW2 C;  1OXV A;  3NEL A;  3AQQ A;  1KAW A;  2NVY H;  1WYD A;  1EQR A;  4YCW A;  3HOV H;  3RLF A;  1VQB A;  1PH5 A;  3I7F A;  4MTN A;  4IPD A;  2GN5 A;  2N78 A;  3F1Z A;  1JJG A;  4DNI A;  4YWL A;  1VQ5 A;  4GN4 B;  4OX9 Q;  1S72 A;  4X64 L;  1RIP A;  4DR2 Q;  4KHP L;  2CWA A;  2MO0 A;  2AWO A;  2Z6K C;  2N3S A;  2PI2 A;  3J7Z C;  1QZG A;  1LUZ A;  1YHA A;  4R4I A;  3CCS A;  1J5E Q;  4Y52 H;  4A3C H;  2UUC L;  1PYB A;  4LF7 L;  3PIO A;  1Q12 A;  3RLN A;  4P74 A;  5GQO A;  4HJ8 A;  1HH2 P;  5C0X G;  1QVG A;  5JEA J;  3MXN B;  2R7D A;  2VL6 A;  3K81 C;  4A93 H;  1PHJ A;  3HKS A;  5FLM H;  4GNX B;  1HR0 L;  4A3L H;  5BR8 L;  3F2B A;  4PZ8 A;  2Y0S G;  3M4O H;  3E0E A;  4HIO A;  3BZK A;  3J81 c;  1MKH A;  4YHH Q;  1PH1 A;  1UEB A;  2Q2I A;  1PV4 A;  3S14 H;  2KCT A;  4GN3 B;  2MO1 A;  1E7Z A;  1N33 Q;  1HNX Q;  4OO1 I;  2R93 H;  4QL5 A;  3GD7 A;  3CQZ H;  1XMO L;  1JMC A;  3A5Z B;  3PCO B;  2IX1 A;  3K8A A;  4P72 A;  2UUB Q;  4QQB X;  3DM3 A;  4DV2 Q;  1WOC A;  4LF6 L;  4NXM Q;  1TWC H;  2ZTD A;  5ELN A;  3E9I A;  2R7Z H;  2YTV A;  4DR6 Q;  5JJI A;  4GN5 A;  4JI0 L;  4AYB G;  1WFQ A;  4OXP A;  5FLX c;  3A0J A;  1P16 A;  4YCV A;  4BBR H;  5C44 G;  3OTO L;  1UWV A;  5LMU Q;  4R4T A;  1XPO A;  1Q7Y C;  2UXB L;  3KJO A;  1G29 1;  3CC4 A;  3M3Y H;  3A74 A;  1X3F A;  3RN2 A;  4DR7 L;  2L15 A;  1VQF A;  2ALY B;  4JOI A;  4A3E G;  1EFW A;  4LUZ A;  4LF8 L;  1T9H A;  4GLA C;  4DUZ Q;  1AE3 A;  4A75 A;  1YJ9 A;  4X64 Q;  2BH8 A;  2Q2H A;  4A3G G;  5C4X G;  2UU9 L;  3TRZ A;  1YI2 A;  2AHO B;  1EWI A;  1KRT A;  4PZ6 A;  2VQF L;  2JA6 H;  1LYL A;  2JA8 H;  1PH6 A;  1PH8 A;  5M5Y H;  4Y7N H;  3M4P A;  4O0A A;  2RF4 A;  1SE8 A;  3EIV A;  3JC6 6;  3OYY A;  2K50 A;  4IO9 A;  4LWC A;  1N34 Q;  4BXX H;  4HJ7 A;  1YIJ A;  1N32 L;  1O7I A;  2ATW A;  1Y14 B;  5BR8 Q;  3CD6 A;  2BA1 A;  1M1K C;  4L5R C;  4L5Q A;  1UE1 A;  4A3D H;  5JJL A;  4B3R L;  1G6P A;  5GAE C;  3E9H A;  2K14 A;  2OQ0 A;  2YTX A;  3L2P A;  1U5K A;  3S17 H;  3HKZ G;  1IL2 A;  2NN6 I;  1EOV A;  3U58 A;  4A3B H;  5EAY A;  3RN5 A;  2I0Q A;  2VY3 A;  1WCM H;  4R4C A;  1L2F A;  1PH4 A;  2EXD A;  1VQN A;  3B6Y A;  5IYC G;  3KJP A;  3K7U C;  1VQ8 A;  1CSP A;  1MJE A;  1VQO A;  2JA5 G;  1VQG A;  1V1Q A;  4DR5 L;  2ES2 A;  5LMN W;  1XMO Q;  4L5S A;  4BA2 I;  4PMW A;  1L1O C;  1YEZ A;  3AFP A;  4DKA C;  4HJ5 A;  4JI6 L;  3J81 i;  2CQO A;  2DUD A;  2JA9 A;  5IP9 G;  4A3I H;  1VQM A;  4OWT B;  3OTO Q;  3CF5 A;  1YHQ A;  4OWW B;  1K73 C;  2B63 G;  1GKH A;  4BY7 H;  3CC2 A;  4JI4 Q;  2AKW B;  5FJ8 H;  2KHJ A;  1IZ6 A;  2KEN A;  4LF8 Q;  5C3E H;  1HNZ L;  4TVA B;  4C3H H;  1BBU A;  4X66 Q;  2IHF A;  2CFM A;  3A5U A;  4IJL A;  1VQK A;  2UU9 Q;  2JQO A;  1VQ6 A;  3K0X A;  3S1M H;  1RL2 A;  5GRO A;  3K7A H;  4HID A;  1VQL A;  2IY5 B;  2B29 A;  4MNO A;  4DR3 Q;  1KL9 A;  3CXC A;  1NY4 A;  2UXD Q;  2GVB A;  2DGY A;  3ULJ A;  3OW2 A;  2UXC L;  3F8T A;  1N32 Q;  3RLO A;  2ZTE A;  1Q1B A;  3S1N H;  4UY8 C;  3CCM A;  3GTL H;  4B3R Q;  4DR4 Q;  5FLM G;  4DV0 Q;  1X55 A;  1SMX A;  1VQ9 A;  4C3J H;  3NEM A;  1EYG A;  3S24 A;  4X62 L;  3CCL A;  1E3P A;  3LGJ A;  3FKI H;  1U0L A;  1EUJ A;  4LF4 L;  4JI7 Q;  4JI1 Q;  2ZJP A;  4GKJ Q;  2N8N A;  1N9W A;  1PH7 A;  3HOY H;  1VQJ A;  4IFD G;  4ME3 A;  2RHS B;  3W5O A;  2Q2T A;  1IBK L;  2R93 G;  1PFS A;  3W1B A;  1PH3 A;  1A8V A;  5JJK A;  4BY1 H;  1Z47 A;  1X9N A;  1JE5 A;  3DLL A;  2F4V Q;  4NPS A;  1X6O A;  3D31 A;  1ASY A;  5IE8 A;  4DUY L;  1SRU A;  1HZC A;  2R7Z G;  4RG1 A;  5J3B A;  1Y1W H;  2ZM6 L;  2ID0 A;  3S2D H;  4BBR G;  2JE6 I;  3I4O A;  5IY0 A;  4DV7 Q;  3CME A;  2QA4 A;  3ULP A;  2LXJ A;  1HNZ Q;  4A3K G;  3GTM H;  3HOX H;  4LFA L;  1D8L A;  1E24 A;  1JB7 A;  2JEA I;  4AIM A;  2ZJR A;  3PO2 G;  3HKZ E;  3Q8D A;  1PYS B;  3TQY A;  1B7Y B;  3T1Y L;  1TXY A;  3FP9 A;  2JA6 G;  3M85 A;  2GVA A;  2A8V A;  3ER0 A;  2UXC Q;  2JA8 G;  3CPW A;  1I94 L;  1XPR A;  1CKO A;  3M7N A;  4JI5 L;  3D0F A;  4DV3 L;  1N36 L;  1TWF H;  2N49 A;  4LF9 Q;  3IRB A;  2HHH L;  2PMZ E;  1TWG H;  2WB1 G;  4KI0 A;  1XMQ L;  4NXN L;  3GTJ H;  3J7A 5;  2QEX A;  3ERS X;  2CKZ B;  4B3M Q;  1XNR L;  3GTK H;  4GOP C;  1AH9 A;  5C0X J;  3RR5 A;  4X62 Q;  1NTG A;  2XTI A;  4DPG A;  1XJV A;  2OTL A;  2E8G A;  3S2H H;  3UDX A;  2PI2 E;  1K8G A;  1GVP A;  3PIP A;  4A3B G;  3GTQ H;  2CWP A;  2D0P A;  3L0O A;  3L7Z C;  4NB3 A;  4QGU A;  1WCM G;  2VQE L;  4A3J H;  1IBL L;  3UE1 A;  5IYB H;  5IWA L;  4HIM A;  2BH2 A;  3CMA A;  1H95 A;  1FJG L;  4A3M H;  4JI2 L;  4QIW E;  1Q46 A;  3S16 H;  4LF5 L;  4KHP Q;  4IPG A;  5IP7 H;  5M5W H;  4DUY Q;  3I4M H;  4YWM A;  3S1R H;  2KHI A;  4A3I G;  2UUC Q;  1S3O A;  1N8R C;  3M9B A;  1I6H H;  4X6A H;  4LF7 Q;  5E7N A;  5GAH C;  1Y1V H;  2QGQ A;  3ICE A;  4LFA Q;  4BY7 G;  1KHI A;  4KHZ A;  5M3M H;  3RZD H;  5FJ8 G;  1HR0 Q;  3I4N G;  4GKK L;  4JV5 L;  5C3E G;  4AQY L;  1ASZ A;  4LW1 A;  3KDF A;  4IPC A;  4R1J A;  5C0X I;  5IT9 c;  4UP9 A;  3T1Y Q;  2ASB A;  1L1O A;  2BA0 A;  4WJ3 M;  3AEV A;  3CPF A;  3U4V A;  2R92 G;  1BBW A;  1I94 Q;  1K8A C;  1JT8 A;  4BA1 I;  4GS3 A;  4YWK A;  2YYZ A;  1VQ7 A;  4JI5 Q;  1DGS A;  1N36 Q;  4K0K L;  2OTJ A;  5DLQ E;  2LSS A;  1S40 A;  2HHH Q;  1GM5 A;  2AMC B;  1YJW A;  3BJU A;  1XMQ Q;  2K5V A;  1W2B A;  1IYJ B;  4NXN Q;  2JA7 H;  1A62 A;  2MQH A;  1VQA A;  1VQI A;  2IX0 A;  4DR1 L;  1EIY B;  1QVF A;  1XNR Q;  2NVQ H;  3PF4 A;  3G6E A;  4LFB L;  1E22 A;  1I3Q H;  2WAQ G;  1HZ9 A;  4DAY B;  4LF6 Q;  1PA6 A;  1YJN A;  3GTO H;  2HT1 A;  4JI0 Q;  4C3I H;  2A19 A;  4LUO A;  1IBL Q;  2RCN A;  1C0A A;  3FKI G;  3J80 c;  2UXB Q;  3PUW A;  3UE0 A;  1IBM L;  5IWA Q;  3KDF B;  4YY3 L;  4DR7 Q;  4UP8 A;  5C44 H;  3H3V I;  1LTL A;  1M90 C;  4JCV E;  1KIX A;  3HOV G;  1L1O B;  2HIX A;  2R6G A;  4P75 A;  1VCI A;  2VW9 A;  4GLX A;  3HOY G;  2Y0S E;  4EQ5 A;  4O2D A;  4JBM A;  2VQF Q;  4BY1 G;  4DK3 C;  5AJ3 L;  4GLV B;  4JI8 L;  1X54 A;  4BBS H;  3T1H L;  3M4Q A;  4JC0 A;  3J81 j; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...