1HZHH

Crystal structure of the intact human igg b12 with broad and potent activity against primary hiv-1 isolates: a template for hiv vaccine design
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
457
structure length
457
Chain Sequence
b'QVQLVQSGAEVKKPGASVKVSCQASGYRFSNFVIHWVRQAPGQRFEWMGWINPYNGNKEFSAKFQDRVTFTADTSANTAYMELRSLRSADTAVYYCARVGPYSWDDSPQDNYYMDVWGKGTTVIVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKAEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IMMUNOGLOBULIN HEAVY CHAIN
publication title Crystal structure of a neutralizing human IGG against HIV-1: a template for vaccine design.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 74
structure length 457
sequence length 457
chains with identical sequence K
ec nomenclature
pdb deposition date 2001-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1hzhH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1hzhH04
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1hzhH03
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1hzhH01
1QKZH 1ZHKB 1ZGLA 2KDGA 5DWUH 1QSZA 3ARDC 3GI8H 3D0VB 4OGYL 4LEOB 5SX5H 1T89C 3CSYB 1GC1C 2DQEH 2NCMA 3BGMB 3NVQA 4U1NB 1CU4L 4I4WB 4XCEB 1B88A 4QYOA 3GMNB 1DUZB 4TULH 1J0KA 3OTTA 4K8RD 4OCRL 5E2VL 3U9UA 4OD2B 1X5JA 5B8CC 3DUHA 2BVPB 5BW7C 4F7PA 2FB4L 1DEEB 5H35B 1LO3L 1L9MA 1N59B 2R9HD 3TNMB 2XTJD 3KXFD 1FNEB 3DYMA 4PJIA 4PRIA 1XR9B 3CMOL 3SOBH 4JLRB 4JN1H 1QSED 3MRCA 5JQ6L 2Q76B 2LVEA 4CMMB 4LSSL 4P2RD 3LEVL 3P30H 1NL0L 5IVXA 2W65A 2ZUQC 4AL8L 2DQJL 4DGYH 4LSVH 1OW0C 1YJDL 3FB7B 3HG1E 5EO1B 1VEOA 3NA9H 3CDYA 4XAKE 4NZTL 4P5TC 5ACZB 1P2CA 5GS1C 1IAOA 1FAIL 2A9ML 1KSRA 1EJ6A 1EFXB 2HFFA 4CDHA 2AJSL 3LKNB 1BREA 3QI9A 4NM8H 4ZSOB 2B1HH 3NA4A 4XCNA 4IM8A 4QY8A 4Y2DC 2XWBA 4L4VE 3IXTB 5D7IA 1U8MA 5LXGH 5K9QG 3NPSB 2D7PA 4BZ2H 4KZDL 3OAZK 4WNQB 3RPKA 4Q6YA 5F9JA 3SKMA 3TIEA 5HHVL 4FRWA 3HZVB 5DXWA 3QDHA 4GQ9L 1CF8H 5JDJA 3BEWB 5F89A 1XCQA 3A6BL 4Z5RA 2B8OT 2APBA 4BSWA 4U6YA 3DRQB 3I02A 1QACA 4UT7L 1LDPL 2ZOKA 4R0LB 4G6JL 5DJ2A 4ELMF 3OKMB 4XTRC 1BLNA 4X6DA 1IFHL 4I0PC 1ZA3A 4TUKH 2ORBH 3HI5L 1HQ4A 3N1GC 3N1PC 1TQCB 1H3PH 2VN4A 5EOCL 4G8GE 3HS0B 5TGBB 3LKRA 1EEZB 4OQTH 3UTTA 4XNMA 4RDQF 2EDYA 3HNVL 3FQRB 1ZGLP 5CZKA 4TVSa 2W60A 5JOPE 2ZCKL 4XPAH 2XKSA 1NCUA 3K3QA 5FUZL 5IBLC 4E42B 3FO2A 3SO3B 4P46B 1J86A 5BS0D 3R1GH 4JZJB 5I6XB 2J3SA 1YMMA 1DE4B 3X3GH 1Z3GL 2F58H 3CLFL 4OIBA 2JB6B 5ITFA 4ZPTA 1IEAB 4PIRF 4XZUA 4J12A 3GKZA 2HT2D 1ONQB 5IT2L 4NN5C 3KLHC 4KQ3L 5AZEH 4CW1A 4KJPD 3S37X 1ETZB 5D2NC 1X5GA 4IHOB 3BZFA 3HUJF 1UYWH 5HVFB 4U0QB 5FHAH 4AEIL 4FXGA 1F45A 4HC1L 5DJDA 4NKMA 5DJ6B 1F97A 1NCDH 3VDBA 4WFGD 5E8EA 2NNAB 1JGDA 3IJSB 4HIXH 3RUGB 2UWEE 5I2IA 3TJEH 4XC3H 3ZE0E 2OJEA 3H9HB 4WUUD 3O2VL 3ARVA 3TBYA 1EEYA 4JG0H 4KZEL 5ID1A 3MNVB 1AD9A 2EECA 1L6ZA 1NC2D 1T5WA 4PJXA 5HGBB 3OG4B 5D5MF 5EU5A 3T0ED 3LKOB 4EEEA 2IMMA 3MUY1 3AXLB 4J3OC 5F6HI 4UTAL 2QQKH 2VLLA 3L5WB 4HBQA 4GS7C 3VFOB 1W72H 4NN6C 4P3CL 5ESQA 4AH2A 1P7KB 1A3LL 3VXNB 4FFWC 3VXSB 4S1RH 3ZSTA 2X1OA 3V6FB 1GGIL 3MV9E 4V2CB 2Q3ZA 5CS7A 5ENWB 1RIUH 3ARUA 5HYEA 2IPUK 5T1LA 5FECB 5I8OL 1UM5L 4JPWL 4YHNB 5GHWH 3RNKB 3DVNB 4C56B 1AHWB 5FUCC 2V2WB 4U6XA 4U05A 5GRZA 4H0GA 3MJ8B 3GO1L 4GG8B 5CUSL 1JE6A 3C2SA 3LD8B 3BQUC 3EYUL 1ITCA 2CR3A 1G0DA 5E2UL 5F7DB 3R0MA 5KAQG 1KB5L 1NKRA 2CKBL 4X4ME 4OCYH 1XH3B 2BY3A 2LTQB 4ELMA 1T03H 5IWLA 2B0SH 5IF0B 4JFYA 1ZWIA 4KUZH 1M05A 2FBJL 4E41E 4QWWD 1UC6A 3TBSB 3V6OC 1OAKL 2W0PA 5ESVB 3CVHB 5EU6B 5C0GB 3N0PB 2GJ6E 5IJVB 3VWJD 4LVNC 4ZOAA 2AJXH 4NGHH 3C5ZD 4MXVF 4Z7UF 2ESVA 3MV11 2J4WL 1T0MA 3E0GA 2AJ3B 2OTUA 4P2QD 3H9SB 4QRRE 5A43C 2VLKB 2DJ4A 3VG0L 3BT2H 2BC4B 4OZFA 1FYTE 4KVCL 1H8NA 5A2IH 3IVKA 1VEPA 4MXQC 1ZHNA 3GMLB 1GAFL 1S7VB 2H32B 4PRPE 4RGNC 3TA3C 3MBXL 1XGQA 2ZUUA 1KPRB 4HKZA 2X70A 5HHQA 4HIEB 1VFAB 1JMXA 1T83A 3QIBD 4TNWK 1OAXH 1MREH 4RIRB 3KPTA 4NP4H 3PV6A 3VXUB 1P69B 4JB9H 2VLME 1R3LA 3MRKA 5IMKA 1YPZF 2D0HA 5GRVL 3VFNA 3NCJH 2V5SA 1B4JL 2JTDA 4PRHE 1JP5A 2VDKH 5IMOB 1KPVB 1INDL 4GAJL 1ZTXL 2KL6A 4JM4H 4WHCA 3HPLA 2WBJD 3RVXD 1JUFB 1E4JA 4IRSA 5IM7A 1PX3A 3FRUB 5CD5C 3HI1A 4MCYA 2J8HA 4N90E 3MXWL 1F42A 1JWSB 4OV6F 3U1SH 2PW1A 4QHKI 1IGYB 4IIQC 3U83A 4EUPG 3W39B 4L5FH 2XNAA 4JHBA 3BIBX 4MSWA 3ULVE 5JZ7D 1IGJB 3QQ9D 4C58B 4L8DA 3TWCH 4GRLB 2QADD 3HMXL 4IMLB 5BRZD 3FHAA 3GZKA 3KPOB 1G9NC 4JDZB 2EC8A 3IGAA 3RL1A 1KTDA 3UZQA 4JO2H 1A7QH 1WAAA 2OL3A 5EUOA 4C83A 3ZDZE 4XI5C 4L29B 5F6HJ 4X7TB 3BISA 5EUKB 5E2TL 2GSIA 4N0YL 5TE4L 4PFEA 5F1NA 4D8PB 1D6VL 4WUKH 4NKOA 2ATKA 3L6FB 2AEQL 2UVEA 2ARJB 3QUXD 2XOTA 2LFGA 4DN4L 1I7RA 1D5MA 3MRQA 1MRCL 2EYRA 4MAUL 5F9OL 3HFML 5TPWL 4BFGA 5LCVH 1UG9A 3VFTB 3MGOB 4XPGH 4WTZA 3ZKMD 4XMKH 4JPVL 3MACH 4QOKD 4Z95H 2BOCB 1AXSA 1PZ5A 2EYSA 3V4PL 3ARTA 1FFRA 3HC4L 1JNHB 2PYFA 3PJSB 5CILH 3GSXA 4G42B 4DGVL 5GIRB 1QOKA 3UO1H 3ULVL 4M62H 5C07D 4RAUB 3FFCD 2GJJA 3EIFA 2CRIA 2XY1A 2HJKB 2HWZL 3IJHA 1KC5L 5D1ZA 2XZZA 4NQCA 1AD0A 4I0CC 4X4XB 2VTFA 4LHUD 4PJDF 1TCRB 2XA8H 1RUKH 1UM4H 5JOFA 4D3CL 1E4KA 3WN5B 1DQTA 2YZ1A 2HJLB 5DURB 5D8JH 4WCYL 2F5AH 5FCSH 5DUMH 4N1CA 3RY5A 3UPCA 5I1LA 5IHZB 1BZ9A 4QTIL 2FHFA 2X4QA 5ADOH 3MTRA 5AYUH 1F2QA 4NO5A 4K7PH 3BSZL 4PJ5D 4MNHB 4G8IB 3TFKD 3GSQB 3MJ7A 4CN6A 1YA5A 1M7IA 3UZVB 4NCC1 1JWUA 1XF3A 3H3KA 3LV3A 4I48B 2FX9H 4KY1L 4X5WA 1AFVH 2NTSP 4HKBA 3GM0A 4ZG1A 1VFMA 4P23A 1EUUA 3L3DB 4LLUA 5E9DE 1G7LA 2F19L 3L3IA 1RZFL 4R90H 4YPJA 2DQGH 3NOIA 4OZGF 4KKLC 1PEZA 4RMTA 1BJ1H 1BQLH 4QHKJ 1A3RL 4O2EB 3RI5K 1EHLL 3CCHA 4H26A 3V5HA 3WIHL 3AS2A 1U8LA 3JVGC 1RZKC 2DKMA 1AGCA 2ZG1A 5FKPB 3OR7B 3PHSA 4PJBB 4HEPG 2A74A 4WGVB 3RU8L 4JM2C 5SX5K 1CDYA 2HTKD 4OD1H 4RWYH 5EOQL 4I2XB 4G43B 1P53A 3L5HA 4U6HA 1U8JA 5I8KL 3QPXH 2P8MB 4IOSD 1MUJA 1G7PB 3ARZA 3P0YL 4LVHC 1DLFL 4YHOL 1Y18B 1IAIM 3PF2A 4RFEA 5KANI 3T3PF 3ROOB 1XFPA 4QHLA 1Z5LA 3DUSB 1G84A 4FQ1L 2HRLA 4Z77B 1YEFL 4L9LC 4NQEB 4X4ZA 1A22B 4Y4FA 2A6KA 2R0ZL 4OCLC 1V7MH 1X44A 3IT8D 3NCYP 2GI7A 5TH2A 3KS0H 1P4LB 3CFJA 5I1GH 3QXWA 1S9YB 3QDGA 4D0BA 5DD1H 2FL5B 2ADGB 3IFLH 4LFHD 1A6WL 4NCDA 5BZDB 3EAKA 2YUWA 4X4YA 5KSAB 3HG1D 2JCCE 2GKIA 5GGTH 3G08A 4TSCL 2ZCHH 4XAKD 4YDIH 4GSDH 4GW1A 5KN5A 1FG2A 1TVBB 4EBQL 1ZGLB 1DSFL 1X5YA 1BFVL 1MVUB 1ZLUK 2KUTA 1A02N 1CVRA 4HX1A 3S34H 2H9GA 4POYA 1XCTB 4JY5H 4L4VD 5SWZE 2CKBA 3P4OB 5BV7L 4QYOB 4OF5A 5EB9A 2YBRB 3NCFB 4RCAA 4LPWA 2HMIC 2UWEA 1NGQH 1CS6A 2A38A 4NSKB 1HKLH 2B5IC 4WI2A 5B3JF 3MRIB 3NZHL 3WUWB 2Z35A 4HHAB 3MBEA 5I15H 3SDDD 6CGTA 1E6OL 2NYYC 4JANA 2ZJSH 1A14H 4UIKH 4XCFL 2DI9A 1AY1H 2BNUA 4KAQH 4PRIB 5I8EA 5F71A 3ZO0A 4NQDD 4FFZL 4G8FB 5C0IA 3QG7L 2R8SH 1QFWH 2JJWA 5IGXH 1GIGL 3P11H 2UUDH 3RWCA 5FV1L 3REVB 3W11D 4POZC 1M71B 3BDBA 3RGVA 1FAKT 4PP1D 4G8GD 2C1PB 3MRBB 1P84J 3NIDF 5I19L 1NFIB 2BHUA 3VMPA 32C2A 5EOCJ 1O7SA 4APQD 3MV9A 3O0RH 4OT1L 3IDJB 3ULSB 1T2XA 1KJ3L 4HGMA 3TBVA 3WIIH 4RAHA 3QI9B 3GMRA 1N7MH 4N8CH 1Y6NR 4G5ZH 4OUOA 5CHNA 4JY6A 3QAZB 4QY8B 4M93B 1LP9E 1B90A 5D7IB 5DJAA 4UIMA 1U41A 5T1KA 4UQ3A 4ZUUB 1GGBH 3PIQA 5F9JB 3LRSB 1MFAH 2IQAA 1A7OH 4IDJH 4IOFC 4PB0H 3TIEB 4Z8FH 4WUUB 4EI5C 4OLWH 2IQ9H 4YLQT 5DFVC 5E5MB 5F89B 5DJ8A 3DMMC 1XCQB 3DXAE 2NZIA 1Z9MA 1UKSA 4Y5YA 4Z5RB 2FH6A 3I6KA 2VL5A 1MCKA 5D1XA 1QR4A 4U6YB 3I02B 4XPFH 3T0EB 4BZ1L 3BZEA 1J0IA 5DJ2B 3V7AG 2Y6SC 4X6DB 2DLHA 1GC1L 5ID0A 3IKKA 3QPQD 1HQ4B 1FLTX 2AABH 3IDGA 2GK0A 1NC4D 3CLEH 2WAHA 1U6AH 4DEPC 1P6AB 1JHKL 1TZGL 3HE6B 1KTKE 4OCNC 4UT6L 3RVUC 3ZKNC 3BO8A 3LKRB 3HC0A 3UTTB 5ITBL 1J1XL 4XNMB 5ADPH 5L2KA 5DQ9B 4ETQA 3QFJE 4PTUA 2W60B 4WFFD 2F54A 5C71A 2VLJD 4LSTH 1U9KA 3DX6A 1FNLA 3FO2B 3RBGA 3BYYA 2VDNL 5L7XL 1XR8A 4LCWA 1QBMH 4FQHA 4M48H 3AREC 3NIFF 3TZVC 1JTTA 4R96A 5J0BA 5F9DC 2EXYC 1JPGA 2R4RL 5ITFB 1A7BA 4ZPTB 1NCWL 1BWMA 4XP5H 1PX4A 4ZPVA 1R3JA 3ARBA 4X6CB 4O51A 1ES0A 4LCUB 5I18L 1GPOL 2MNUA 3RPIA 1LEIA 4HMCA 5HHOE 1BFTA 2Z8RA 3BZFB 3NCYS 43CAA 3MOAH 1QUNA 1MRDL 4PP2B 1XIWA 4ALAL 3WL9A 4DUWA 4FXGB 1V3LA 4FQ2H 5D72H 3VXME 5DRZA 5IQ7H 1R3IH 2QSCL 1Q0YH 5J1TC 2NY4C 5CJXC 5L6YH 2MCPH 4NKMB 3BPLB 4HPYH 1GHFH 3C87A 2VDMH 5GXBB 3SHSA 3HAEG 1FDLL 3UTZA 4NQSB 1EVUA 4HH8A 3BPCA 1DQQA 1QLFA 2DWEB 4KMTL 3HR6A 3SY0A 4F3FB 4NRXB 5I2IB 4E0RA 1YQVH 4YXKH 4D94A 1SBBA 2OJEB 1C7SA 4F7EA 3PQYA 3MRMA 3G6JF 4P3WA 5D1QA 1U91A 3PWLA 4E41D 5CBEA 3RX8A 1WCBA 1EEYB 1U36A 1KCVL 3AB0C 5ID1B 1RZ7H 4KKAD 1TJIH 1AD9B 2GJ6D 2PTTA 2NY5C 4LIQE 1VGKA 5C0NC 1T5WB 4PJXB 3A6CH 1JTPA 2AK1L 3D1MC 5EU5B 1ZLVK 1WT5A 4TQEH 2F8XC 5ISZD 4KDTA 4G8EA 3FJTA 4LRIC 1OY3B 3E2HC 2I9LB 4QRRD 3LMJH 4HKJA 1FGNH 4MNGE 4UOW0 1I3RA 2IC2A 1I7UA 2H6PA 3UJIL 2VLLB 3S96A 1FYTD 3B2UC 4JHWH 4KV5E 1NGPH 2EIDA 5ESQB 3QWQB 4PRPD 4AH2B 1OP9A 3WKMH 1EO8H 4YUEH 5DZLA 1DBKH 3O9WD 2B39A 2BNRE 3WHE0 5F88B 2CDEA 4KK5C 3WFZA 2FZ3A 1DFBH 3QCUL 4JO3L 5T1LB 2VLMD 1R5WB 4UT9H 2FX8H 3HPJB 2O5ZH 2G9HB 4PRHD 4TPRH 2IPUG 4U6XB 3ZHDA 4GMTL 4ZUSA 3TPKA 3T4AA 4HUWA 5E1AA 4JRXD 2IANB 5JNYA 5IEKB 4LCCA 5FYJH 5J13C 3G04A 1SHMA 4O9HH 3TIDB 3VI4E 5I71B 1CT8B 3C60C 1PLGH 4JFYB 1ZWIB 4N90D 4A6YH 1R3KB 1M05B 5IHBA 3QUMA 3PWPE 1T0NA 4EDWL 4QGTA 1RURH 1F4XL 2AK4A 5FM5M 2VMFA 1E4XL 3T04D 4G7YL 1JCKA 4IRJC 3CZJA 1J18A 1KJVB 3S97C 1YUHB 3GMMB 4LIQL 1OP3H 3CXDL 4GKZA 3QUXB 5DI8B 1EAPA 5F7FA 1T0MB 1NLBH 3WS6A 5IMMB 3SDXE 1IT9H 2RIKA 5FUCE 5GS3A 3A6OA 2CMRH 4OZFB 4OCWL 1RUML 3KPMB 3NFNA 2ZSWA 4XBPA 3QFDB 1U95A 1ZHNB 4QXGL 4QGYA 4B50A 4M03A 2IGFL 5DK0A 1MFBL 5FO7A 1A6VL 1CFQA 5GPRA 5HHMD 3PABA 4HKZB 5FEBA 5HHQB 2NY1C 2NXZC 5C8JA 5GRXG 5JIHA 1QEWA 2CLZA 3MSPA 5E9DA 1DUYB 2XWJA 4XNYL 3VFMA 1LO2L 4MJ6A 1R3LB 3MRKB 5IMKB 4GQPH 2LU4A 3VFNB 3SDYL 1KLGB 2HT3C 4P2OC 1SQ2N 1I1RA 1OB1A 1HHJB 2R2CA 4HQQH 4J3VA 5C07B 3FQXA 4HLZH 3UYPA 4F37K 3HPLB 2D03L 3WD5L 1DBBL 4IRSB 4ORGA 2XPGA 4R2GB 4QT5B 3QEHB 2H26A 4MCYB 4RGNE 4DFIA 2O61B 1FFPA 3OQ3B 4HCRH 4QKXB 5IB2A 3ALXA 2P47B 4LSRH 1IAIL 4G6KL 4MSWB 1Q9LB 1N6UA 2X89A 3PP3K 3JZ7A 1FP5A 4NQTA 3VFUB 4QRTA 3LIZH 4G6AC 2PUQT 2VXUH 4PJAE 1BBDL 3RL1B 4U1JA 3V8CA 4DGIL 1KTDB 2WWMD 5JUEL 5EUOB 4P4KA 5HDBE 4ZD3L 1FFQA 3C9NA 4C83B 1T1ZA 1V8HA 3FO1B 3WFEL 3MODH 1JZ6A 3DETC 1G6RL 3KWWB 2L0DA 5E7FA 3QIUA 4JFFA 2KBGA 2VC2L 4PJCE 3ARGC 5C0DA 1MF2H 3RA7H 3T4YB 4MJ5A 5I8CA 1KIRA 1WEJH 4JAMB 2DM7A 3EO1B 4KK9D 1I7RB 4YDJB 4XNXL 5GS2H 3MRQB 4OLVH 3HE7D 7FABH 3RFZC 2EYRB 4YHIA 1YNKH 2NY3B 4F15C 4ODSH 1FVDA 4JR9H 12E8H 2JF1A 2FJFA 2X9WA 1LWRA 4Y1AE 1T4KB 1BFOB 1MCCA 5JMOC 3U0WH 1FZMA 2HKHH 2W38A 3ARWA 4GOSA 2HKFL 4PJEF 5LGJB 3TJHC 4ZUWA 2AEIT 1OP5K 2R69H 1G0YR 5CJ8A 4GRWE 4HUXA 5SWZA 5D7SH 4GLRI 4KRPC 4WW2F 5CCKL 2BDNL 1TFHA 3VDCA 4AMKH 4PGBA 4JFOA 1QSEA 3SE9H 3D69B 4I3RL 3PNWA 4ZQKB 3U36A 3ARQA 1VKXA 1GGCL 5MEOB 3IJHB 3JXAA 3O2WL 4OLYL 3BIAX 4RGOH 5D1ZB 4C54A 1SBSH 4A2MA 2JB5H 5I1HL 4JCLA 4KUCD 3STLB 4C57C 2A83A 2FLRT 3B6SB 4ZUVA 3H8NA 5IB4A 3O6MH 1VGEH 3PL6A 2RJMA 2DDQL 1D9KC 2ORBL 3GGWB 4QHUA 3TN0A 3BZDA 1ZV5A 4BQ6A 4HUUA 3I75A 4XVSL 1RY7B 3QULA 1Z0NA 4DQOL 1BZ9B 2X7LB 4O2FA 5HDQH 3QDMA 2EDKA 4CNIA 1UJ3C 2X4QB 5LAXB 1SY6H 4MAYD 3UTSE 5KOVC 1N8ZA 3NAAL 3HG1B 2J8UE 1CD8A 4X6EA 3MJ7B 5E2WH 4UBDC 1IL1A 1MCFA 2V9QA 1M7IB 3S3PA 1G9NL 5HGDA 5TQ0H 1G9EA 1L0XA 2BK8A 5HI3C 1JWUB 5L0QB 1N0LA 1XF3B 2XZAH 1QSFE 3MLSH 4K55A 4X5WB 2WSKA 4YWGH 4P23B 3LHPL 4OGXH 4LLUB 1E27A 1G7LB 3WHXA 3IRZA 4AIZA 1XEDA 2NY2D 2GT9A 3VH8A 3RWHA 5ALCL 3BRFA 3U2SA 2DJSA 3LB6C 2YSSA 2IADB 3RJDA 4X6CF 1P4BH 5TE6H 3HA0A 3CCHB 1CGVA 3BP6B 3V5HB 4ELKA 4R26L 5CJQH 4XVTL 2YMXH 4LNRB 2XQBH 1TENA 5T3XH 3TO4D 4HH9B 4Q97A 1F00I 4BYHA 1S5HA 4R97C 2A74B 3O6FC 1N6QH 1FSKC 4NZUL 3DVGB 4LVOB 3V5DB 1PGRB 1JNNL 1DBJH 3FFDA 3UTPE 1WF5A 4U6HB 4X80L 1N64H 1RK0B 3AS3A 1K4DB 1MUJB 4ESKA 5E24E 4RFEB 4WWID 5AWNL 3OKOA 1DEDA 1Z5LB 1DVFD 3GBLA 5DT1H 5LGHL 1EFQA 4APQB 3QWOA 1HSBA 1I8LA 3WDJA 5MEQA 4P9HH 5FHBL 1MHCA 5GS0L 3JWDL 3ULUD 2Q20A 3ARDD 3EDFA 4M4PA 2P5EE 5HI4C 1KCSL 2UUDK 3CFJB 2NQCA 4MD5A 4GAGH 1KFAL 2BSTB 5IB3A 3REWA 1X6LA 3MRFB 4YJZL 5JORA 1A2YB 2YUXA 4NKIH 4X9FA 3T0VA 1MEXH 4PG9B 1A6UL 5KN5B 1FG2B 3BKJL 4YAQA 4WI3A 3W0WE 5HHOA 4ETYA 5DD3L 3PWVA 5EU7C 3V0VA 1K8DA 3VXMA 4EQ2A 3EO0A 4TSAL 3K1DA 3V6ZA 3GSUA 4HX1B 4DW2L 4F57L 4RMSA 1KB5B 2CKBB 4JGMA 3B9EA 1OGAA 4KTDH 1RFDL 2NTFA 1A21A 2QSQA 3KG5A 3MNZA 2UWEB 3EDKA 4PBXA 2D7NA 3KLDA 4WI5A 4H1LA 2H32H 4P59H 1BECA 3DXAD 1U3HA 3MBEB 1CE1L 3MQIA 2CPCA 1ZT4B 1NBZA 4P5TD 2ATPA 4JANB 4FG6C 5DC0A 2B7DT 2Y07L 4JHAL 3MRPB 2YS4A 1RZKL 1X5XA 2H1PL 5I8EB 1ZHLA 5C3TA 5C0IB 2ADFL 3T2NH 1LDSA 2WUCH 2X4NB 4MNGA 2FIKA 4AG4H 4Y2DD 2B4CC 3RWCB 4Z6AT 4AIOA 2GY5A 4HWBH 3RGVB 3A0OA 4QXUL 2Q87A 5ILTL 1ADQA 1T22B 2AXFA 32C2B 1E4XI 4N9GA 4P4RB 3SQOL 1TQCC 3MV9B 2NMSA 3QFJD 3MYJB 4DK3A 3I3BA 5GRYA 3BE1H 4XXDA 3MCG1 3ZDYE 5CMAB 5FKAA 5CHNB 5I30L 4XTRD 4JY6B 4CVWA 2CUHA 1QFUH 4I0PD 3OJVC 5DJAB 4UIMB 1AI1H 4P46C 4UQ3B 4JKWA 5T1KB 1LO0L 2RCSL 2F15A 2QR0A 1IC1A 5I6XC 1PW3A 2J6EH 3U4BH 2IQAB 5SWSE 5CJBA 2RFXA 2X4RA 3RY4A 4L5FL 2W9DL 4E41B 5DJ8B 3BI9X 3RP1A 4UU9B 2ZWLT 1Q9WB 4Q6IA 3AM8A 3I6KB 5KVDH 2BNQA 2DJUA 5D1XB 5IBLD 1YYLL 3P0VH 1F4WH 1BIIA 2Q6WA 2AKRA 2Z31C 3MMEB 4CU8A 3BZEB 3SKNA 5I75C 3V0WL 4LARH 3RJQB 1IC4H 4NNYB 2FGWL 4G7VL 3KYKH 3QUZC 1CXHA 2P1YA 5DMIH 4MA8L 2MFNA 3IDGB 3CUPA 3KLHD 3P9MB 3PWNB 2KQMA 3LQAH 4PRPB 2FHCA 1G6RA 4H5SB 2QTEA 1V05A 1JGVH 2R2BB 2MQ0A 1IAII 1R5VA 4DVBA 3VFGH 1CFTB 4WJ5A 4KJYB 5FYLH 5A16A 3D3VE 2NX5D 4W4NA 4PTUB 3QZWB 2WUBL 3PG2A 2F54B 4L8SC 4U1IA 5F9WB 4Y4HA 4X98B 1X4ZA 3DX6B 2Z8WC 5EORL 1YECH 2K9UA 4LCWB 4PRHB 4L8BA 3G6DL 1EO7A 3QR2A 2Q86A 1KIQA 1CFBA 1BX2B 4R96B 2X10A 2YA1A 2R23B 1JPGB 5A40E 1NCAH 1VDGA 4ZPVB 1R3JB 4QTHA 2VXSH 1NSNL 5E03A 5JXAL 2FR4A 3GSNL 4WFEE 3QEQE 4O4YH 4RAVA 3TV3L 4O51B 1VCAA 3RPIB 1LEIB 4EI6A 5EOTA 3OHXA 4K2UH 43CAB 1DQLL 4AY0A 5ICZB 2G60H 1S8DA 1XIWB 2BOBA 3WL9B 1Q8MA 5TQ2L 2MQCA 4P9HC 4U31A 3B5HA 3BPNB 1ZMYA 4CMHC 5IFHH 3H7BA 5I16A 4NNXB 5IQ9A 2MHAA 4PJAA 4S0SD 3BJLA 3P2TA 4D2NA 3UTZB 1KEMH 3NTCL 3SY0B 1DQQB 1QLFB 5ALBH 1RUKL 4E0RB 1RHHB 5JW4R 4F7EB 1EHXA 3LD8C 5D1QB 1U91B 3PWLB 4FFWD 5CBEB 1LD9A 3A67L 1WCBB 3PWPD 4DVRH 1MHHA 4FQXA 1RZGB 1X7QA 2LTQC 5KVEH 1A5FH 3Q6FB 1MCBA 2FNBA 4M02A 4ODUB 1IM9D 1J8HD 3O4OC 4Z7QE 4MA7H 1NLDH 4JY4B 4HKJB 5JW3H 2DKUA 2AI0L 2CJUH 3P4NA 5ANME 1I3RB 1I7UB 1M7DA 2EO1A 4K8RH 1JHTA 1MPAH 5CZXC 3BQUD 3IU4L 5AUMB 2HA1A 1EAJA 5F7HA 4GXUM 4XH2A 1ZT7A 4ZODA 3QRGH 4Y1AA 4N1EA 5GGSY 2I9TA 5MENE 1OQXA 4X7CC 4BM7A 4Y16C 2CDEB 2MOVA 2FZ3B 3P40A 5E7BA 1BM3H 2ZNWA 3O4LE 1IC5H 3QRFM 3QEUB 5INDA 4HFWA 1RVFL 1RAMA 3PHOB 4PJ8A 2A6IB 2ZUYA 4ZTOH 3T4AB 1DDHA 5D71H 3FT2A 3BAEH 5JNYB 4LDLB 4R3SA 4NJ9L 3G04B 4FMKA 5DJXA 4HDIB 1MI5E 4RGND 3TA3D 3RL2A 4AEEA 1XT5A 3VMNA 4UTBH 3LH2L 5KVGL 4M6ML 5D7JA 1NCBH 1YEKL 1MCJA 5DF0A 1RSFA 4FZEL 4GKZB 4LL9A 5C9JA 3KPSA 4LPYA 5DC4B 3K0WA 5J3HC 2B1AL 3HE7B 2DIBA 3IXAA 3OF6D 1FNAA 4EIGB 3G5YA 2RB8A 2VITA 3NFNB 3SGKC 4XBPB 3S36X 1EGJH 1U95B 1GH7A 4JDVA 3RAJH 5DJZA 5CD5D 5FO7B 2V17H 3QQ3A 4HKXB 4QNPF 1T7WA 5IROC 2HTLC 5C8JB 3U7YL 1CBVL 1QEWB 4YR6A 1J05B 2CLZB 3GHEL 3HZKA 2JELL 5E9DB 2XWJB 4RQQA 3K46A 3VFMB 3ABZA 4MJ6B 5GGVL 2NY5L 3SBWC 3G9AB 4YDIL 3UX9B 3EW3B 2XXMB 1QA9B 5C2BH 2YPLA 2Y5TA 3FQXB 4XRCA 3OKKB 1CZ8L 1QG3A 3D2UD 1G9ML 2ZG2A 5C09D 1UZ6E 4ORGB 4QHMA 4XI5D 2WM0A 5INCA 1DN2A 1X3DA 1A9BA 2FD6L 5IB2B 4MLIA 3LQAC 3MLVH 4OD3H 4PJFE 1NGQL 1S5IH 2WANA 3G5XA 4DFHA 5I1DA 3UROR 1MLBA 2UYLA 3ZE0F 3DX9A 3GBML 3SKJH 4QRTB 4AM0A 1YQ2A 3C6LD 1CICA 5I1EH 4OUUB 4U1JB 5I9QB 5A2KH 4KK8C 3TYGL 4P4KB 1FNGA 4KDWA 5H2BA 2R1XA 1QBLH 1KN2H 3KPPA 3VU2A 4J3SA 1OAYL 4I18A 4HJJH 3QIUB 4ZFOL 2X4UA 4G80B 2XWTA 5C0DB 1G7HA 4ZXBA 4M7ZC 2PW2B 2ITCA 1PG7L 5I8CB 3HRZA 2NY2B 1U3JA 1KIRB 1JPSH 3OAUL 1EJOL 1H3WM 3UPAA 3UTSD 5D2LA 1MJJB 1I1CA 1ACYL 1MQ8A 4YHIB 4EUPA 1AP2A 5DZOA 3CDGA 1MCNA 3X17A 2QLVB 4Y5XB 1YN7B 1IKNC 3QBTB 5F96L 3MXVL 2FJFB 2E27H 4LHQB 1CCZA 4QEGA 3W0WA 5BMFH 3TO4B 5T3ZL 5JXEC 5D6CA 1QSFD 3QT2A 2Q8BL 2KZWA 5FOBA 2E7LC 4HUXB 4X99A 5SWZB 1KACB 1PG7W 2IPTH 1MH5B 1AGFB 4PGBB 2YD6A 3E6HA 4W81A 3EDJA 1WBZA 5F7LB 1B0RA 4OLWL 2YN5A 3QWRD 3B8YA 2IH3B 1LHZA 3IETB 1JYVA 5IB5A 3DTXA 2X4SA 3MR9A 1HZHH 4JPIA 3ZL4H 2CLRB 3O2DL 2Z91A 5JIKA 1DVFB 2EDFA 1JF1B 4NRZB 3LEXA 2A83B 1GOGA 1NGZA 5IB4B 5D9SA 1U8QA 3PL6B 2FH8A 2OTPA 3O3EA 4FHBD 3ARDB 1CDGA 3DLQR 1NBVL 4HG4J 2E7CA 5D6DC 2JIXB 4HUUB 3NH7H 3QULB 3VDAA 4OZHE 4KKLD 1P4IH 4O2FB 3H3PH 4C4KO 4RFOH 3B9KA 1D6EA 1LK3L 1N8ZB 5B8CB 1UA6L 1O0VA 3C8KB 4X6EB 1MCPH 5DZNA 5E8NB 1W8OA 3DYPA 4UQ2B 3QXDA 2E9JA 1IL1B 3RKDC 5HGDB 4RSVA 4GG6E 4M48L 2EXWC 3W9DB 5F7NC 5KS9E 3CFBA 1D5BB 2PR4L 3DSFH 2P5ED 5BO1L 4JM2D 3UBXI 5KW9L 2HN7B 1KULA 1QR1A 2A6JA 2GYSA 1WFOA 2GJZA 1CL7L 4JFZH 4Z7WA 4V1DE 4J1UA 2QQQA 3RWHB 1LP9B 3NN8A 3U2SB 2YSSB 1QLRB 4X7FC 3GSNA 1JWMB 2ADJA 4M6NH 3UJTL 3V7MA 1C5DB 2J5LB 1WWAX 4HS8L 1HXMA 3CXHK 2F74A 3RNQA 5A3IC 1NDGA 5IQ7L 1ZS8B 5I74C 1NC4A 4ZOBA 2DQDH 5KSAC 5DJYA 1S5HB 5GS1B 3SEPA 4WHTB 1HSAA 5FYJE 4F58L 4P5KB 5EWIH 2Y06L 4DAGH 4KDVA 3RWGB 4EIZC 1T04A 5KTEL 3LZFH 4Q9QH 2AERT 4D0CA 4KTEL 4X8XA 1G7IA 4BKLA 1AIFA 2AEPH 3OKOB 1KYOJ 5EZOL 2VABA 3UMTA 3KPNA 1I8MB 1FH5H 3MRNB 4KFZC 1W0VA 3IU3A 3Q1SL 2I25N 1Z9SA 3QFJB 2GY7B 5BZWA 1F90L 2VDRH 5TDNA 3WXVL 5HY9B 1ORQA 4KI1A 3CDCA 1EMTL 3CVIL 5CGYC 1NGPL 3C5SA 2Q8AL 4FFYL 3X12A 3RTQA 2F5BH 2HFTA 1A6PA 4MD5B 5IB3B 4G6ML 3REWB 4I0PB 2HMID 2EC9U 4LSUH 5JORB 3WFDL 4HBCL 1MHEB 2YPVL 3QO0A 5E8OB 1U8NB 3QEQA 3DROA 3AUVA 2EDOA 4UT9L 5DJ0B 5CJOH 1VACB 1F3DJ 5HHOB 3OZ9L 2NYYD 3PGFL 1NFDF 1AQKH 2AV7A 4MQ7A 3GM8A 1A6ZA 1K8DB 3VXMB 1QNZH 1U2HA 3GSUB 1KT2A 3VWKA 3T3MF 1B9ZA 2NTFB 1TJHL 3O6LL 1RQ5A 1A6AA 3OSKA 3QI9C 2CGRL 4WWKA 4OZFH 1X5LA 1K6QL 4ZAKA 4HWZA 1UT9A 2PO6A 3VGBA 4U1LB 1YNLH 1TETL 1T2QH 2CO7B 2MSPA 3MV8E 2HRPH 4PLNC 1U3HB 2QL1A 1NBZB 4LPTA 3MX0A 2ATPB 1XF5A 1IT9L 1CG9A 1C5BH 3BN9C 4OSUH 4JKPL 1FC2D 4OZ4B 2HLAA 1ZHLB 5EU7E 1QFHA 1TTUA 3K7UA 3O3BA 1MNUL 4RDQG 4RNRA 5KOMC 4MNGB 3O11A 3QEGL 4KKBC 3LEYH 2XKUA 5D4QA 3JWOH 1V7NH 1P7HL 1YEGL 3GB7A 2GITA 4ZNEE 4IOFD 5MENA 1LEKA 1JRHH 2OX5A 4OGYH 5CZVL 4EI5D 5DFVD 2QQNL 4URTB 3LCYA 1CGXA 4BH7B 2BNRB 4WO4A 3D3VD 3DMMD 4NHUB 4OV5B 5IIEA 3BDYL 3CIQA 3V9FA 5IKCB 1WCQA 4DKFL 3QHZL 5D7LE 4XXDB 3SDAA 4ZMAT 1FE8L 3KDMA 4OCRH 5E2VH 4YFEA 5FKAB 2EDWA 4NHCL 2G75A 5FDWA 2Y6SD 3F5WA 2FB4H 1PYWA 5IG7B 1LO3H 4CBPA 4N8VG 2QR0B 4GS7B 4KUCF 4WFED 4YE4L 1R5IA 4PJGE 1MI5A 3U0TA 4B41A 3RVUD 2X4RB 3ZKND 2GAZA 1JYNA 3AVEA 2VDPL 1KEGL 4S1DC 3PWPB 5JQ6H 5GGQL 1KIPA 5K9KA 1T3FA 1XF2B 4LSSH 1P5UA 4DOHB 2OZ4L 1HOCA 2P8PB 3LEVH 1NL0H 2VXUL 4M7LT 4UNTA 3P77B 2Q6WB 2AKRB 2WQRA 5C9KA 3VRJB 4AL8H 2DQJH 3ARED 2JJTA 3TZVD 1YJDH 2EXYD 2HH0H 1PSKL 3BQUB 4NZTH 1A8JH 5DHVB 1JZ2A 1CFVH 1FAIH 2A9MH 5EFIB 3MOQA 1I9JL 1G6RB 2XZQL 4JPKH 2AJSH 4C55A 1IAKA 1AKJD 2PKDA 4DJMA 3N06B 4WJ5B 5A16B 4U1IB 4B7LA 3SN6N 4OZIA 4Y4HB 4LVNB 4KZDH 4ODSL 3B5TA 1OPGL 4JHZA 4JGJA 2JCCF 2NY4D 3TO2A 1KIQB 3EYVA 4NOBA 4UDTB 4UDUA 3P4MA 4QRPD 4PYGA 5HHVH 5ICYA 2F8OA 4GQ9H 2V2XA 4M6OH 4XB7A 4F7TA 1BZ7A 3NABH 4QTHB 3A6BH 1G7QA 1L4IA 2B4CL 3LN4B 1DJSA 1P7QD 1ZLWH 3ARXA 2VIRA 2FR4B 2DF3A 4RAVB 2YC1A 2RGSA 4RGNB 1FO0A 5HDLA 5L8JB 4UT7H 1LDPH 4B7IA 3GRWL 4G6JH 3OJDA 5T1MA 5EOTB 4JZOA 1LO5A 5J1AA 2IAMA 2FEEL 4PJFA 3O4LD 1EDQA 4OFKA 1V3JA 3TH4T 5C0ND 1IFHH 1HQRA 4GAYA 4LLVB 3HI5H 3Q0HA 4KU1A 1AXIB 2E6PA 5D93C 1YY8B 5IQ9B 5EOCH 2JB5L 2MHAB 4PJAB 4PLJC 3O2DA 3QQNA 3B2UD 3HNVH 5I17B 4X8JA 3V52L 5EBGA 1S9KC 2ZCKH 5FUZH 1LD9B 1JPFA 4I3SL 3ULUF 3SJVE 2CDFA 4M1CD 4FQXB 1QRNA 4JFHD 4PJCB 5IWLC 5I71C 4ORZC 2XXCB 4KK5D 3O41A 4IIQB 5C0CE 1M1SA 5I1JL 1Z3GH 3LKQA 5T33L 3CLFH 4ISVA 1PQZA 3ZYJA 4YQXL 1R3HB 5E2WL 5IT2H 4OI8A 5DDHA 3P4NB 3OKNA 2MCG1 4KQ3H 2O5YL 3IAGC 1NMBL 2NW2B 2ZNXA 4AQ1B 4HD9A 3EOAA 3MNWA 2DLIA 4KQ4L 5K9OA 3FKUS 4Y1AB 3EYSL 4UOW1 3D2UB 4LLAA 4U49A 3SE3A 3C60D 4Z76A 1WV7T 4PJ9A 4AEIH 3NFSL 3HAEA 1H5BA 2M26A 3M1BA 1MCWM 4GRWB 1NAMA 1CGSH 4CDGC 3PGDA 3B5GA 1N5YL 4IRJD 5INDB 3S35L 5LQBL 3WYRA 1HCVA 1T83C 3SDCA 3VFRA 2VRAA 2ZG3A 2E7HA 4HUNB 3O2VH 1HDMA 3FT2B 3ILPA 4K9EL 1MIEL 1I1AA 4KZEH 4P3DA 3RWDA 4R7NA 5DJXB 4HLZG 2OJZL 4MAYA 4H25A 2H45A 4NKDB 1CL7I 1GZQA 3OB0K 3ARSA 3JWOC 1FIGL 3UTQA 5B38B 5C7XL 5FM4A 4FQLL 2NY1D 5T5NF 2EDNA 2NXZD 3HZMA 4IRSC 1BD2D 4R2GC 5D7JB 4UTAH 5BXFB 1AC0A 2FJGB 5F72S 2ZKHL 1FZKB 4OZHA 2EDXA 4UAOC 4M5YL 4P3CH 5HHPA 4Q58C 2YA2A 1QSVA 2E9WA 2HT3D 4P2OD 4X6FA 3MLZL 5CD3A 3UTSB 4Z9KB 4P9HL 5ACLA 1A3LH 2J8UB 3IXAB 5GJTL 2Y1VA 2EH7H 3G5YB 1ORSB 3BWAB 3UAJC 3AS0A 1GGIH 2AJYL 5JDSB 4JDVB 2P44B 5DJZB 5KS9A 5I8OH 1BZQK 1UM5H 4JPWH 1OWRM 4Z7OE 3HC3L 3QQ3B 4B0MM 1A1OA 2R1WB 4W6XB 2BVEA 4YR6B 3GO1H 3HZKB 2PYEA 5CUSH 4M8QB 3WDIA 2RBLA 3GSWA 2FEDC 3EYUH 5E2UH 5HPOA 1KB5H 1RZJC 2CKBH 1I1FA 2FX7L 1J8KA 1VADA 4LBEB 4NQVB 2BVUA 1MEXL 3F7YA 5CKAA 3CFDA 4MJID 1QLEL 4XMPL 1K4CB 1J1PL 2YPLB 2Y5TB 4G6AD 4WVRA 3JV5A 4XRCB 2DQFA 2FBJH 3CVHL 1N6VA 1OAKH 4QHMB 4EJ1C 3L1OL 2NY3C 4UNVA 1S7QA 2FCBA 2BXZA 3JUZA 3DETD 5CP3H 2R29L 4JRYD 5EPMB 1FL5B 2C1OB 2J4WH 2X42A 3J7HA 3ARGD 3OXRB 3RWJA 3RBSA 4M9PA 3G5XB 3OL2A 3VG0H 1MLBB 2YR3A 4YO0B 3WIFA 4KVCH 4NO3A 5AAMA 5F93C 1NMAL 1TZHA 3HNTL 4LAQL 2ITDB 4AM0B 1GAFH 2VE6A 1CICB 2Z4QA 3MBXH 1IJ9A 2VQUA 1C16A 3O45B 5HYIA 5HYJE 1U0QA 5F1SA 1FNGB 2R1XB 5FF6B 4I0KA 2X09A 4Q2ZA 3TJHD 3VXRA 4F8TA 4LKXA 4I18B 4M9OA 1IILE 5D1ZC 1B4JH 1KF9B 2P5EB 3MV7A 2X4UB 4I5BA 5LG1A 2XWTB 1INDH 1G7HB 4GAJH 4ZXBB 4U6TA 4XNQA 1ZTXH 4V2BA 2AGJL 4KRPD 3SGJA 3EKCA 1E4KC 4WENB 5FYLE 5D2LB 1XF1A 5DUPL 1U8OA 4EUPB 3ARFD 1MJUL 4HZLB 3WFHB 4Z7VA 3CDGB 2EDDA 4LVHB 3K4ZA 4BH8A 3MXWH 3W0WB 2ILLA 4HULB 2VLRA 4HS6A 5D6CB 1QFUL 3I6GA 1HXYB 4LHJB 4L3EE 3DYOA 1D9KD 5L8LB 4V1DD 5FOBB 3HMXH 3H2WA 2EZ0D 3BP7A 2V2TB 1MY5A 1DL7H 3E6HB 1WBZB 3NCBB 1AQDA 4U7KA 3K4DA 3IDNA 2CIIA 4P23C 5EO9A 4FQQA 1SYVA 4MCZA 4OCSL 1IGTB 2OR8A 3MR9B 5E2TH 3U82B 4N0YH 1SJHA 4UBDD 5TE4H 2C4FU 4FNLL 1D6VH 1HI6B 1NGZB 3ZTJH 5D9SB 5HI3D 2R0KL 2AEQH 4YDVB 5FYJD 3O3EB 2A77L 3SDXF 4DN4H 3UBXB 1MRCH 5C08E 5L2JA 2Q7NA 4MAUH 5F9OH 3HFMH 1LE9A 5TPWH 1HHKB 4HGWA 5F8RC 1A4KA 1WZLA 4FXKB 1FYHB 1JGVL 3D25A 3OPZL 1D6EB 4JPVH 1KBGL 4ZNEA 3SKOA 4HLJA 1ODAA 2B5IB 4XBEL 5HGHA 2VR9A 1XAUA 3QXDB 3QDJD 4YXHL 3V4PH 4QF1B 4YHPA 3HC4H 1E6JL 3H6JA 4OF7A 3CFBB 5FIEA 5CFHA 3O6FD 2ZSVA 3TPUA 4DGVH 1QR1B 1UVQB 3ULVH 4J1UB 5KSBA 3MJ9L 4Y4FC 3NN8B 4B53A 2HWZH 1KC5H 5DS8B 4PJBE 4PJ7F 3TEUA 4S0TD 4MJ4A 4HT1L 3TT1H 5A2JH 3GSNB 2B20A 1YC7A 1CLZL 1TVDA 3MROA 5SWSB 4X7DC 3ZHKA 3GRWA 3LN9A 2F74B 4OFYA 5DEZA 4D3CH 4F2MA 1BEYL 3DHJA 4KXZH 5DJYB 4HS3B 5C0RH 1U92B 1HYSC 1KPUB 4JQIL 4QTIH 1SEBA 4HSQA 5HI4D 4ZO8A 4LQFL 4LPXA 3TT3L 4NQEE 4O5LL 3BSZH 3WO3B 3QHTC 4CADA 4NBZB 2ZUVA 4D0CB 4NYLA 3GBNL 2FJHA 1LGVA 1Y6KR 1FZJA 4RRPG 1XGRA 2X4PA 5FV2A 2OQJB 2IJ0C 1KXQE 3MUGA 1OTTC 3IFOA 4BKLB 2FEEI 3RKPA 3MV8D 4O58L 2VABB 1NEZB 2R4SL 4KY1H 4PJCF 4QXTA 1UFUA 2BRRL 5J6HB 2KPNA 1W0VB 1P5VA 1S7TB 3BW9B 4K71C 5F1OB 3UJJL 3D3VB 4YPGA 2F19H 5BZWB 1RZFH 3QNXA 5TDNB 2PTVA 3RHWK 3D85A 1ORQB 3STBA 4D9LL 3MBEC 1KJMA 1A3RH 5J9PB 2P24A 2XN9E 2P7TB 3C5SB 1EHLH 5C86A 3RTQB 4PJHA 4WEMB 4IOIA 4N5EC 2VZTA 1D5ZA 1RULL 5DVMA 1JGUH 3WNPA 5J6GA 3QEQB 3DROB 1D5XB 2R0LL 3RU8H 1G6VK 4GRWF 3RGVC 5EOQH 4ZS6C 3FTGA 3TP4A 4FG6D 3GUTA 1X5FA 4MQ7B 5D7LD 1XF4B 1A6ZB 5I8KH 3G5ZA 1T5XA 2YD4A 2DQCL 3RVVC 1KT2B 3P0YH 2NXYB 1DLFH 4YHOH 2Y7QA 2H2PC 4MD0B 3LSOA 3PWUA 4PJIE 1A6AB 2C9AA 4FQ1H 4PRIE 4OF8A 4MDJA 4WWKB 3TH3T 4BSVB 1YEFH 4Q74A 2CLVB 4PGJA 4ZAKB 2XFXA 3HKFA 4AIXA 3TYFA 4YIQB 5DRNA 2R0ZH 3SJVA 5IVXE 5JR1L 2OSLB 2A6DA 2ADIA 2R56L 2YKLL 1CG9B 2HLAB 3KLAB 1A6WH 1RMFL 4Y5YC 1T21A 1FN4A 1NAKL 3K81A 2NY4B 3O11B 2J8UF 4HIIB 4WI8A 5ANMB 3GNML 4TSCH 3D0LA 5D1XC 5JHDA 4MS8C 4P46D 3KPRE 3QISA 4F9PA 3GB7B 3ME0A 1FFOA 3W82A 3V5KB 2GITB 1DSFH 1QVOA 3FCTB 1BFVH 5MENB 1M4KA 4XNZC 4W6WB 1UXWA 1Z9OA 5D7IE 1S7XA 5AEAA 3VI3E 4WO4B 5IIEB 3AB0B 4OM0L 5C2BL 5CP7B 3O4LB 3VXOA 4XX1G 2SEBA 3EOBB 2XICA 3BHBA 3KDMB 3O3AB 1CFSA 2Z31D 1S7WA 3BX7C 3FOLA 1ZAGA 2VYRE 3E2HB 1OTUC 1AGBA 3F5WB 3PDOB 3QUZD 3NZHH 1E4WL 3MGAA 5DD0L 4Q0XL 1P9MA 3DJ9A 1IZJA 1MCWW 5C2UB 1E6OH 1ZLWK 1NGXA 2YRPA 3FQNA 1R5IB 3B3IA 1MI5B 3U0TB 4XCFH 3R06A 4X6DE 2AW2A 2GAZB 4FFZH 3RDTA 3QG7H 5EA0L 1T1XB 3ARBC 3L5XL 3L5IA 4WGWB 1GIGH 4ENEC 5K9KB 3SPVA 5FGBA 1S3KL 2GTZA 5T3XD 3UTTE 2ED9A 1P84K 4G9FA 5FA4A 1Q0XL 4GLRH 4LK4A 2DQHL 1XIWC 5C0EB 5I19H 4OQTA 5DD5H 3E6FA 1FBIL 3ULVC 3BPNC 4OT1H 2MPAL 2DQTL 1T20B 1RJLA 2KQNA 6FABL 1KJ3H 2DB8A 5GGSA 1YMME 3C60B 4ZFOB 1IAKB 1MAJA 5DQJA 4JM2F 5FB8A 2CD0A 4EN3A 3KHOA 5C0CD 4HAGA 3S8WA 5D1QC 2FSEB 5IFJA 3VXSD 4IRJB 1IQDA 1B2WL 2D7QA 2YD2A 1HE7A 3TO2B 2E27L 3EYVB 5I66A 3OKEA 1WT5C 5SWQA 3QNZA 2V2XB 2ZPKL 1BZ7B 4KDTC 2EDJA 1PKQE 4JN2B 1GXEA 3WS3B 1G7QB 1J88A 1X4YA 3HR5B 4J2XA 4YDKL 2YC1B 3C6LA 2HVKA 3IKCA 4BZ1H 4LDOB 5T1MB 1LO5B 5J1AB 3L3JA 1VFUA 4PJFB 2NXZB 1LQSR 3JTTB 3FAXA 1HQRB 1TQBC 2Z93B 4TUOB 3VXPA 2R2EA 5GQBA 1C08A 2I24N 3ZL4L 3VGEA 1A7PL 1K3IA 3DV4B 3N9GL 4P2OB 1F3JA 3QXAA 1TZGH 1JHKH 3BUYB 2DYPA 4YXLL 4UT6H 5ITBH 5CZXD 1NUDA 1J1XH 3T1FA 4JREB 3U4EB 3JTSA 5HYJA 4PRNA 1UENA 4ODXA 3H9SD 3PHQA 4ACPA 5JMRA 1CTOA 2I07A 4WHYH 4LCCC 2CDFB 2VDNH 4P57A 3GK8L 5L7XH 1QRNB 1TDQA 4UINL 2MKWA 4Y16D 2JK5B 3O41B 5DJCA 3DUUA 4PUBL 4RFOL 2NLJA 2LAAA 4XWGL 1J11A 2FDBP 2OMNA 1NCWH 2I27N 2X4OA 1DN0A 3DX7B 5M7QA 4HJGA 5DO2C 5A2LH 4GRMB 1IARB 4LPVA 3VXUD 4Y4KA 4JKKA 4XPBL 3EOAB 3MNWB 2YUVA 4S2SA 5CEZE 5I18H 4O02L 1GPOH 3DSFL 3WS6C 4BELD 3S9DB 3W2DL 5DMGC 1MRDH 4YHYC 4WU7B 4ALAH 3ZDYF 3DVIA 4JZNB 4LRNL 4UMGA 5TE7L 2QSCH 4L3EA 4AENB 4R6UA 1BGXL 4NC1C 1JGEB 3PGDB 4ELME 4HWNA 3ARGB 3F12A 1FDLH 4KMTH 1IC7L 3SDCB 4HAFA 4WW1A 3AS1A 5CBAA 2O93L 3VFRB 5J3HD 5FCUL 1R24B 5KVMC 1HDMB 1HHIA 1MY7A 1UZ8B 2W0FA 3ILPB 3EGSA 5IVZB 4TRPL 4KTYA 1KCVH 4F15B 3ROLA 4P3DB 5EULV 3RWDB 3T2PA 2ESVE 5JA9A 1A9EB 1GZQB 1KCRL 2AK1H 3GIZL 1V3MA 3UTQB 3WUWG 5IK3A 5I0DA 4Q9QL 2HTLD 3ZKQD 4KHTL 1U8KA 5C08A 4JFQA 5IR1A 3IDMA 3UJIH 1F5WA 3QB7C 1CIDA 3VFVB 2E8ZA 4OZHB 4UUJA 2Z0BA 5HHPB 1AO7A 5CD3B 5TDOA 4XXCA 5I76A 4MHHI 1P6FA 3THML 4L4TA 5CEZL 4TNVF 4I8DA 1TVHB 2ICES 1F8TL 3QCUH 4JO3H 3IF1A 5KS9B 1F11A 3QO1B 4DTGL 3EDEA 1RIVL 4YGVB 1A1OB 4P4KC 4M7JL 4K7FA 4LLYB 3RIFF 1D9KB 4GMTH 3M17A 1IKFL 4XT1C 4OLEA 2NPLX 1I1FB 1RZ8A 2EEDA 1F58L 4CJ1A 1VADB 3QIUC 5FYLD 1CLYH 1RIHL 3CFDB 3MCLL 3HRPA 3X3FL 1OL0A 3IS0X 2VSDA 3I3DA 1ZEAL 3SCMA 3WFBH 2DQFB 3DURA 1AQKL 3DRTA 4KK8D 3X14A 1F4XH 3S37L 1E4XH 4G7YH 1S7QB 5HXMA 4IS6B 4LIQH 3KYMB 3CXDH 2J8OA 4N1HB 3ZDXE 5EUOE 3IJYB 5DGQA 1V5JA 3VFSA 4AT6A 1MOEA 4OCWH 3FO0L 3WIFB 1UCBL 4NO3B 1RUMH 2PXYA 2ICWA 1QRKA 4RMUA 5DURD 4QXGH 4EQ3A 1OAUL 2VE6B 2Z4QB 3S3JA 1MFBH 1A6VH 1C16B 4PGCA 1S7UA 3KJ4C 2C26A 1IGFL 1YEHL 1N4XL 1HN1A 1U8PA 5FO9A 3BJ91 3QA3A 4XNYH 5JXED 3LN5A 3CGTA 4GKNA 4Q2ZB 1LO2H 4Z7QF 4LKXB 1HH6A 3SDYH 1FSKB 3DARA 2XN9A 4XP9H 3OR6A 3PL6C 5F3BA 2ICWI 4YNYB 1JRHL 1HK6A 4J23A 4PR5A 3TN0C 2D03H 3WD5H 1U93A 3BXNA 1DBBH 2EO9A 1AXTL 1KCUL 3GIVB 1UWXH 4BH8B 4MNQE 2ZCLL 3S7GA 5J12C 4Y2OA 3BKML 2COQA 3ZHLA 1DTUA 2VLRB 4HS6B 1BBJB 4OB5L 5DRWA 1BAFL 1IAIH 3MO1B 4G6KH 3I6GB 4MX7A 1YMHA 1AGDA 4NQCE 2APWA 5KG9B 2OL3L 1BBDH 5IBUG 4DGIH 1FVCB 5JUEH 4PLOB 1AQDB 3IDNB 1OM3L 3RGHA 1DZBA 2CIIB 1UJTA 4ZD3H 1RZJL 5DHVH 1I85A 1KN4L 1SYVB 4TUJA 3WFEH 1G6RH 2GSGA 3MV8B 1SJHB 1ZT1A 2VC2H 3IFNL 3EUUA 3RKDD 2X4TA 4K3DH 5HVGB 3WEXA 2EXWD 3K4AA 2J5LC 4TVPE 5E4EB 5MP6L 1JTOA 1FL3B 1HWHB 5IESL 5E94A 1OT1A 2KH2B 2HH0L 1YPZE 4EVNA 1X5IA 4XNXH 4Z18A 4NQED 2VAAA 5L2JB 4WRLA 3S88L 1ZLSL 1CFVL 2R2HA 2NY6C 5EZLA 2J2ZA 5DVLA 4PRAA 2HFGL 2D9QB 1A4KB 4JPKL 4CUCA 4IRZL 3KPRA 1TMCB 3D25B 3KNBB 3T2QA 2HKFH 3SKOB 1NCNA 5DTFA 3EO9L 5A3ID 2WLZA 2H8PA 5KSAD 1ZA6B 4X7EC 2VDLL 4TTDC 5CCKH 2BDNH 1S9XA 5D7LB 5C0BA 2ZSVB 3QIWA 4M6OL 4I3RH 1I8LC 3MOBL 2X05A 1I8KA 3NABL 2PCPA 4ONHA 1Q9KA 2BSSA 3OX8A 2BXYA 1GGCH 3X13A 3VGAC 4YFLI 3O2WH 4OLYH 1H15B 3T0BA 4R8WL 1UZ6F 1Q94B 4WTXA 5B39B 5I1HH 4OKVA 3MROB 3CMGA 3QH3A 4PJGB 4NZJA 2CK0L 1WTLA 4W4OA 3TGXA 2DDQH 5GSVA 1CDHA 1CFNA 4UV7L 4U1KA 2OXHA 1D3CA 3BVNA 4U1HB 4XVSH 4OJFL 1UWGL 4DQOH 4TVPL 5EBMA 3RQ3A 4NPYA 2I26N 5CGYD 3VRIA 1IE5A 1OGTA 1I7TA 3NAAH 3L9RA 1PKOA 2G2RB 4M5ZL 2OP4L 4PRID 4CADB 1CN4A 4NYLB 3GHBH 5J56B 2X4PB 4WHDA 1B0GA 2Z9TA 4PGDA 1OCWL 1G9NH 1W0WA 3IFOB 1CQKA 4QRPA 5DR5L 5JTWA 3OGCA 1FRGH 4MQXC 4D9RE 1XGUA 2ICWJ 2V5RA 3QDGE 4L3AA 2J7LA 5IP4A 1SJEA 3W81A 3LHPH 4GRWH 4YPGB 5ALCH 3D85B 5KSUB 1JGLL 1CE6A 1D5IL 1U3HC 3CPLA 5GRWA 4OLUL 3MREA 2P24B 2Z31B 1VB9A 2EKSA 1YZZA 5I75B 4BZYA 1OARL 5F3HA 3WJLA 1I3VA 4R26H 2UY6A 2XI9A 4IOIB 4XVTH 4RX4A 1S78C 3QUZB 4O2CB 5A1AA 2WINA 1PKQA 3QI9D 2EIZA 1VESA 4K94C 2OS7A 5J6GB 3ALPA 1CGSL 3MA9L 3SKUD 3U9PH 4ZYKA 3GJFB 4NZUH 3IDXL 4P48A 2ED8A 1RUQL 2AJVL 4P2CG 1JNNH 2BMKA 3GUTB 3BN9D 4LHUG 4X80H 1L0QA 1BQUA 3G5ZB 4L8SB 3OV6A 3FOMA 1J87A 3SE8L 1KCLA 3L3HA 2LAGB 5GISL 1RUPL 2Y7QB 4ODWA 5AWNH 5IMLA 4KKBD 2OR7A 2ICCA 3PWUB 5LGHH 4MDJB 4NWTL 4NO2B 3GJEA 2XFXB 2D31A 1VFBB 5FHBH 3BD5A 3TYFB 5EN2A 5GS0H 3JWDH 3MJ6A 2BP3A 1A1NA 3SJVB 3WO4C 3DX8A 3W5MA 1EA9C 1AR1C 1KCSH 4U1SA 4PGEA 4PS4L 2VDOL 1W0YT 3HE6D 5C0CB 3I84A 3UTTD 1KFAH 3MRRA 5F7EL 3DO3A 2EH7L 4OZGE 1VA9A 2BVQA 3VRLE 4Q6IC 3AM8C 4RZCA 4CMHB 2GEEA 2OTWA 1HEZA 3D0LB 4U1MB 3RWEB 2LQRA 1A6UH 1PY4A 3BKJH 1FFOB 4GG6F 5B3NA 1YMMD 1YNTA 5DD3H 3FRPG 4ERSL 5EIIA 1S7SA 1S7XB 2I60L 5ICXA 4TSAH 4S1DD 5C0FA 4WTZG 1TCMA 4DW2H 4NZRL 4F57H 2ID5A 4J4PA 3NBNA 2XYCA 3VXOB 2YXFA 1RFDH 2SEBB 4BQ8A 3AAZA 3VD7A 1ULVA 2W9LA 3O4OB 1CFSB 1IGML 1UB6B 3BESR 2IFGA 5K33A 2E6QA 4Y4HC 3KVQA 2DQIL 3R8BB 2GFBA 1CE1H 1CQYA 1F02I 5HHXL 3FQNB 2VR4A 4YX2L 4JHAH 2Y07H 3R06B 1RZKH 2H1PH 3RDTB 3BZ4A 4NC0B 2ADFH 2VXVL 5DHYA 2OLDA 4Y16B 3SPVB 1A0QL 43C9A 2GTZB 5SV4A 5IEHA 3RX7A 1KB9J 1ERNA 5FA4B 4QXUH 5IW1A 2ED7A 5ILTH 4MB3A 3FN9A 5L2KE 4CN4A 3ECBA 2XG4A 2IF7A 1IVLA 3E6FB 5H37G 2F54E 4EUPH 3ZE1E 2X6MA 3SQOH 1F3DH 3VG9B 4LFHG 3HMWL 5E08L 3B9VA 3JUYA 4LCWE 1B6UA 1RJLB 2VISA 3HUJA 1IGCL 3D5OF 4WV1A 5DQJB 3WNKA 2QJDA 4MMZC 1JV5B 5FB8B 4EN3B 2IALA 5I30H 4PV8A 2FLBT 1WZKA 2E7MA 5IFJB 3U46A 4FQXC 1LO0H 2RCSH 1IQDB 5GSRA 1FLRL 5ESAA 3ZKMC 2L4OA 4U0RC 2AAVA 5T1LD 4P99A 3OKEB 3QNZB 2W9DH 4PLJD 2ERJB 5B3JE 4NIKB 2Z8VC 4ZS7L 2E9BA 2BVOA 4OF6A 3IDIB 3EFFA 5FYKE 2DIAA 1HILB 1YYLH 1QO3A 2IAND 4X0KA 3IKCB 3MCKB 3O8XA 5KANG 5D5MA 1EV2E 1DL7L 4UV4L 3V0WH 4HXBL 1BQHG 3RZCA 1JRHI 3L3JB 2CUMA 3PQYE 2FGWH 4G7VH 1AC6A 4KROC 4NQXB 3O3UN 3C09B 4MA8H 3QUKA 2BSED 2R2EB 2W92A 4XCYB 2M1KA 4KJQC 1C08B 1NJ9A 4XP6L 1F3JB 2YXMA 5EU3A 2DYPB 4ODHL 4GO6B 3T1FB 2ESVD 5HYJB 4UI2A 2VZOA 3LY6A 4PJ8C 2GIYA 3PHQB 4N0FB 2WUBH 3SGDI 3ARFA 4YBLC 3EOYG 3V8OA 5EORH 5JW5B 2GTWA 4P57B 2EDQA 1RK1A 2AV1A 3DIFB 3G6DH 4MZ2A 5DJCB 1S9VA 1ND0B 4YH6A 1KENL 4OCXL 3TFKC 4LLDA 5D7KD 1DN0B 1FL6B 5FA3A 1NSNH 5JXAH 4LVEA 1T1WA 2Y23A 5D7JC 3GSNH 2EYTA 3ESUF 1HHGA 2H2SC 3QJHA 4R4BA 1M7XA 1NGWA 4Y4KB 3TV3H 4S2SB 4MNQA 2VQ1A 1ZANL 2OR9L 3V0AC 3QG6A 1DQLH 1JFQL 4ZDHA 1KLUA 4NFCA 3DGGB 5FYKL 5TQ2H 2C3WA 3N1MC 1YEJL 1CD1B 4L3EB 1C1EL 2N4IA 1CIUA 4Z7UA 5EZIL 3EOTL 4IRSD 3TT1L 5GS0C 3R4DA 3JWDC 1SJXA 4R2GD 4NRYA 3F12B 4RMQA 5DD6A 5GGRA 3UPRA 4M7ZB 3NTCH 5GJSL 4WW1B 5CBAB 2QBWA 3SE4A 1NUFA 4PJGF 2DLFL 4JFDE 5FO8A 2AK4E 2AXGA 1HHIB 4J3WA 4GW4A 2CIKB 3A67H 5C0RL 1FV1A 3N50A 2A73A 4IMKA 4F7MA 2JLLA 4JE4B 5T5FL 1J10A 1MELA 3NCCB 4D9QD 2VZ1A 4S10A 3CFIC 4ZUTA 1ZSDA 1MCOL 1KG0A 5IK3B 3DGCR 1YPZA 3G5VB 1SM3L 2AI0H 3FB8A 1U8KB 5C08B 1FGVL 2W1NA 4NC1E 2FEDD 3IU4H 1XZ0A 2FYYA 3FO9B 4HMDA 4UUJB 2Q7YA 2W0LA 2Y9RT 3ILQD 2DTSA 4KWUA 4KHXL 2V7HA 2H3NA 2Z92A 1AO7B 4Y19E 1ZHKA 5JPNB 5I76B 3QHFL 2DQUL 4ZO7A 4LEOA 5IOPA 2OM5A 3DWTA 2VERN 1I9RL 4LLQB 4I4WA 4U1NA 3L3OA 4PBWD 1ZE3C 1BF8A 4XCEA 1CICC 2NY3D 3OWEA 3GMNA 1VEMA 1DUZA 1IEBA 1RVFH 4HK3J 4RGMC 4K7FB 4OD2A 2HAZA 5DHXB 3W9EB 2BVPA 4GBXA 2IFFL 1MAKA 1U8IA 2QQLL 1JGUL 3VE0B 1RZ8B 3VFPA 4I18C 2DI8A 1DEEA 5H35A 4NJ9H 3PWJA 2XV6B 1BVZA 3QUML 4ZXBC 3RY6A 1JZ3A 5BJTA 3KYNB 15C8L 3DURB 1XR9A 3TC9A 1PZUB 2DM2A 4KMQA 3RUGF 3NGBC 1FNSL 3LH2H 4JO1L 1QPPA 5KVGH 4CMMA 4M6MH 1YEKH 1CXKA 3LOWA 5JPMA 4UB0L 4B5EA 1WIOA 4FZEH 1URLA 3U79A 1L7IL 5B4MC 5D1ZD 4LLMB 4NQCD 2B2XL 2D0GA 3LS5L 5HDOA 4W6YB 2B1AH 3LRGA 1J5OL 3U4AA 3FB7A 2E9IA 2PN5A 4AT6B 4WU5A 2PXYB 2F53A 4FTVA 1NDMA 3MLRL 2ICWB 4JFFE 1VFOA 4YHLL 4DKAA 1DBML 3LAFA 1CDBA 4PGZA 1EFXA 4Q7DA 2J88L 4FZ8L 4PGCB 5DSCB 3NFPB 3EJZC 3LKNA 4KJWC 5FFLA 5FGRA 3U7YH 3MYZA 1U8PB 4NO0A 4ZSOA 1CBVH 1UQSA 3AC0A 3GHEH 4JG1L 2JELH 5I74B 3U0PB 4YZFE 2XY2A 3LN5B 5GGVH 1OQOA 1HH6B 2NY5H 1DBAL 3ZTJG 5CKGA 2XN9B 3QZWG 3MRJA 3OR6B 3VGHA 4YFDB 5EIVA 3S5LG 1CZ8H 4PR5B 3UYOD 1U93B 1G9MH 3BXNB 4P23D 1MCIA 2JJSA 2D7MA 5DMYA 2APXA 3MLXL 4Q9CA 2FATL 4PJDA 1KIUA 2FD6H 5LWYH 4R0LA 1MFNA 1QSEE 3U9UB 3B9KC 3OKMA 2VZ3A 1E0OB 1AGEA 4F7PB 2DM4A 4MX7B 1AGDB 3H0TA 4KKNA 1OAZL 3GBMH 5JA8B 5H94A 3HS0A 5E5UB 1UH2A 1NQBA 3WNNA 2Y5EA 1EEZA 3Q2CA 4PJIB 1VERA 2YPKA 2BY1A 3TYGH 3MRCB 3VD9A 3FQRA 4BSJA 2VB5A 3F62A 4E42A 1OAYH 2GSGB 5HYQA 5IVXB 2W65B 1ZT1B 2CKNA 3QDME 2MMXA 2X4TB 4JZJA 3WEXB 3X11A 5K59F 1PG7H 2AJUL 5DD5L 5LVEA 2JB6A 3OAUH 4BQCA 1EJOH 5E94B 4OZGA 4EVNB 1ONQA 1RD6A 1ACYH 1P2CB 4DZBA 1IAMA 1IAOB 2R2HB 3DI2B 5JOPD 4Y4FD 1O5DT 5J11C 5F96H 1ETZA 2HFFB 1TZIA 3MXVH 2FBOJ 3IYLW 4ODTL 3KPRB 4NOFA 4WEUD 4KI5C 4IHOA 4XCNB 3FMGL 5T3ZH 3CSBA 4Z7OF 4ZFZA 5T1DL 4HK3N 3QDGD 2XWBB 2Q8BH 3JSSA 1U8MB 1AJ7L 5DRXA 1CR9L 3SKMB 5E6YA 5C0BB 1HYSD 3IJSA 1K3ZA 3NMEA 1I8KB 1CGYA 2PCPB 1Q9KB 2BSSB 3H9HA 4XC1L 3OX8B 1BWWA 2APVA 1I3GL 4BSWB 4JVUA 2UZIL 2DLTA 3PDDA 3O2DH 2ZOKB 2YK1L 3DBXA 1OTTD 3GDBA 5C0AA 3RTQC 4R4FL 1BLNB 1EHAA 3QNYA 2M2DA 1QPXA 2AEWA 3C6SA 1ZA3B 4HG4K 3QCVH 1NBVH 5BS0E 5C6PB 3AXLA 3S98A 4S1QL 3L5WA 3MBED 5EBMB 4MJ2A 1JPTL 3B4NA 3MPCA 1LK3H 1OGTB 2ZUTA 1I7TB 4TOYL 1UA6H 5F7KC 4N5ED 2VJXA 3AROA 3V6FA 5E6IA 3I50L 4PGDB 3VWKC 1W0WB 2NXYC 3PGCA 4ZO6A 5FECA 3DHMA 1YMMB 3INUL 2PR4H 2X40A 3ARRA 5BO1H 5KW9H 4WWKC 4KRLB 3RGVD 4C56A 1FCGA 1AHWA 5IFAL 2V2WA 4XZUB 1CL7H 4ZAKC 3MJ8A 3QUYA 4ZS6D 1OVZA 7CGTA 4GG8A 2PO6C 4H8WC 3KHQA 2RHEA 4ZTPL 4CW1B 2KZ1B 1CE6B 3CPLB 4WFGE 3MV9D 3RVVD 3MREB 5AG8A 4E5XA 1HYRC 3UJTH 5F3HB 5IF0A 2H2PD 3CFCL 4HS8H 3QCTL 2WINB 4W68A 1PKQB 3ZE2E 2DL9A 5DJDB 5EU6A 5C0GA 3FN3A 5IJVA 3D39A 4KGJA 1OGAE 2CXGA 4F58H 5T1KD 5DFTA 2Y06H 5E8EB 1JGDB 5EH1A 4XVJL 4ZFGL 5KTEH 4C4KT 2VLKA 3TBWA 2Q1EA 3AY4A 3UXFA 2BC4A 5CEXA 4KTEH 3TBYB 4WO4C 3VGDA 1ZVSA 1MCQA 1T2JA 2ENYA 3GMLA 1WK0A 1S7VA 2H32A 5D1XD 2P5WA 4MS8D 5EZOH 3SDAC 1T7VA 5HHNA 1T66C 1VFAA 2VZUA 3GJEB 5CSZA 4L1HA 3Q1SH 1VENA 4PY7A 2D31B 1ZXQA 1F90H 3WXVH 5LGKA 1G9MC 3DX8B 4JFEA 4OLXH 1EMTH 1UKTA 3CVIH 1QD0A 3CX5J 5ELIA 3OAYH 3VA2C 1KPVA 1UKQA 2Q8AH 2NY7L 4FFYH 4U1SB 4YEEA 4PPTA 3DI3B 4Z0XA 3OBAA 3MRRB 3TVMA 3GFUA 4KXZI 1R0AL 1GOFA 4G6MH 2BVQB 1JUFA 3WFDH 4HBCH 5ACMA 2YPVH 2OTWB 2F54D 1OTUD 5D93B 3MLTA 2XKNA 5C6TL 4MA3A 1QP1A 1FZOA 4LCWD 5EC2A 3OZ9H 2JJTC 2AXHA 3PGFH 2HP4A 4AK1A 3W39A 1CGWA 4L8CA 3CZFA 5FK9A 5EIIB 3EZ8A 4OLZL 1S7SB 5ICXB 4CU7A 1IGJA 1CLYL 3PP4L 3ARBD 4ENED 4GRLA 4ELMB 4IMLA 4FS0A 4P2QE 1TJHH 3O6LH 4JDZA 4PJBF 4S1SL 4MZ3A 3WFBL 2CGRH 3P4LA 2J6EA 1K6QH 3MRHA 4JFDA 4YK4C 1XIWD 4FQCL 4DOHE 1TETH 2BNQE 4LU5L 1RUAL 3ULVD 4YHKL 2ESVB 4H0HB 4D8PA 2OTUB 1NBYA 4JKPH 2D7OA 3IRPX 2ARJA 4K94L 3BZ4B 1MNUH 3IVKB 1L9NA 3PQYD 1MFDL 5D1QD 2P46B 3QEGH 1YEEL 43C9B 1XGQB 1ADQL 2HT4C 1YEGH 2N56A 2IAMC 3LRHA 2X70B 1XGYL 4Y19A 2EC9T 5I73C 4JO4L 3EFDL 5CZVH 3PV6B 2QQNH 4LSDA 3BDYH 4DKFH 3PJSA 3QHZH 4XHJC 4WV1B 4XP9L 4JREC 4G42A 1FE8H 4KK9C 5GIRA 4NHCH 2IALB 4PV8B 4RAUA 3U46B 5IM7B 3HI1B 1I4FA 2HJKA 4HJ0D 4WEBL 2VXQL 5GSRB 5ESAB 4UAOB 4YE4H 2PW1B 4X4XA 1I9IL 3VA6A 1Q38A 1TCRA 4OFVA 3G6JA 2XNAB 3DECA 2VDPH 1KEGH 2BVOB 5GGQH 3WN5A 1RHFA 1KTRL 3KPQA 3EFFB 2HJLA 1G7JA 4L8DB 2OZ4H 1RU9L 2A9NL 4NNPL 2DBJA 4J6RL 2EE9A 4K23L 3O8XB 4H0IA 5D5MB 3IGAB 2OL3B 4LSPL 3SE3C 4PJ9C 4PJIF 1H5BC 3QUKB 1PSKH 3MLWL 3GSQA 4DN3H 1R6VA 4M6AA 5T5NG 2GSIB 2AK4D 5DK2A 1NJ9B 2HG5A 4JVWA 5F1NB 3NCMA 1I9JH 4NKOB 5EU3B 2XZQH 4K3DL 2ATKB 4QOKE 5IVXF 4I48A 3SDCC 3L3DA 5DMGD 3WJJA 1D5MB 2WZPD 5C6WH 4TNVK 4XNUL 1I1AC 1RK1B 1S9WA 1OPGH 2AV1B 2APTA 4MAYC 35C8L 4F80A 1S9VB 1H3UA 3CU7A 2EIBA 1SEQL 4WDIA 3RIFK 4GAFB 2E6JA 4LLDB 3BKYL 1PBYA 2B4CH 1AXSB 1BJ8A 1PZ5B 5BOPA 2EYSB 3CK0L 5E9DD 3KXFA 3OR7A 3QJHB 4R4BB 2PYFB 3CDFA 5D7IF 3VI3F 3N1QC 4MNQB 2EH8L 3GRWH 3GSXB 1HWGB 4KVNL 2K7PA 3B9AA 3M45A 4LGSB 1F4YL 4I2XA 4G43A 3UDWA 4M43L 1INEL 4GT7A 4P2RA 5GRJL 5F8QC 2MJWA 2P8MA 3S4SA 3PV7A 1RZIA 1G7PA 4NQCB 1AD0B 5E95B 1F4AA 4NRYB 5CLWA 5GGRB 3ROOA 3M8OL 4LPCA 4QO1A 5JOFB 5A2FA 2D0FA 3V52H 4X6DF 1LEGA 1YY9C 4GW4B 4Y8DC 4I3SH 1JIBA 1FPTL 1VSCA 2X89D 5IV2A 5I1LB 2Y36L 4F7MB 2LU3A 3KPSE 3HLAA 1P4LA 2P8LA 3D48R 2O5XL 4MWFA 4NO5B 5I1JH 5T33H 1ZSDB 1CLOL 4YQXH 2FL5A 1Y0LA 4P4KD 1YPZB 3GHBL 4M61A 3FB8B 1NCCL 2O5YH 1NMBH 1XZ0B 1FRGL 2Q7YB 4KQ4H 1EGJA 3QIUD 4JFFD 4FABH 4KMLB 3LV3B 4HKBB 2H3NB 2Z92B 2E8YA 3EYSH 4TTGA 2DBLH 4LASL 3NFSH 4XCCL 1MVUA 3L3IB 4G9DA 3BKCL 1K8IA 3ULUC 5SX4I 5IOPB 4I13B 3GJFH 1RJZA 1XCTA 3L3OB 1N5YH 3P4OA 4YHML 2YPLE 3S35H 2FIRT 5LQBH 2YBRA 4H26B 4OF0A 1IEBB 2WP3T 1U8LB 1WZ1L 1AGCB 1NCTA 4GBXB 4NSKA 3V4VL 3NCEB 3MZGB 1U8IB 1WFUA 3C08L 4K9EH 1CK0L 1MIEH 1MSPA 3MRIA 4MYWB 3VFPB 3U9PL 3WUWA 1UB5A 3C5JA 2DLEA 3PWJB 1Z2KA 4HHAA 5EIQA 2OJZH 3HZYA 1N2RA 5BJTB 5SWZD 4JFPA 4GH7B 2GK2A 5DQDL 3PXHA 3SGJC 3U6RA 4HWUA 4NC2B 5L88L 1FIGH 4LAJH 4W70A 4F8QA 5C7XH 1U8JB 4FQLH 4G8FA 1UACL 4CVZA 5BS0A 5JPMB 1JJUA 1A1MA 2ZKHH 5JHLL 1DQMH 1FJ1A 1AE6L 3REVA 4M5YH 4U7SA 2VR5A 1M71A 4QHLB 4LCIL 4JQVA 3D87B 3MLZH 2C1PA 3MRBA 2X9YA 4QCIA 1NFIA 4PJXF 3PL6D 5GJTH 4Y4FB 2A6KB 5I1KL 2BFVL 4WU5B 2F53B 4P9ML 4FTVB 2AJYH 3DSNA 1NDMB 3TN0D 1MWAL 3IDJA 3TBTA 4X7SL 3ULSA 5TH2B 2JIXD 3HC3H 1ZLUH 4PJEA 3QDGB 4JDTL 3QDMD 4D0BB 4NO0B 3HCVA 1QYGH 4XGZA 4D0DA 1UQSB 5D2LE 4X4YB 4HIHA 4N0UA 4YBQC 2R0WL 3G08B 3C2AL 3V79C 2FX7H 4WW2A 3BYTA 4G6FD 4ZUUA 2X5PA 1QLEH 4GW1B 4XMPH 1J1PH 5D96C 3MRJB 1X5AA 3LRSA 5K9JL 5E4EC 4WUUA 3CVHH 1HHHA 5E5MA 4IJ3C 2W9EL 3I9GL 1MCHA 2H9GB 3L1OH 1NC2A 4Z0BL 5HYSA 5BVPL 4PJDB 2R29H 3T0EA 3BMWA 3T0WA 3U7WL 3JWNC 4NQDE 1BP3B 4X5LA 5I1CL 4K71B 1AGEB 2EDRA 4XWOC 5E0QA 2EEAA 5L9DL 2BHYA 2ENSA 4WI9A 3H0TB 3JV4A 1NMAH 3HNTH 4LAQH 2WLYA 2Z35B 1H9VA 3BIKA 5H94B 1MFCL 1MAML 2NY6D 3HE6A 1WISA 2BNUB 3LKSA 2YPKB 2C3GA 1ROWA 2CSPA 3RX5A 1I9EA 5DQ9A 1GRWA 3B9DA 4N68A 5HYQB 3IAQA 4XP4H 4NWUL 4QNPE 3WNOA 1A4JA 2I5YH 1TITA 3X11B 2AGJH 4TTDD 1HH9A 4U3CA 4I9WE 1U8HA 4OZGB 2HFEA 2OK0L 5DUPH 4DZBB 4PB9L 3RHWF 4JKLA 1MJUH 3E8UL 4X6CA 5F7YC 4NDMA 3LPFA 3TBVB 2PETA 3W5NA 4LCUA 1FVEA 1TZIB 8CGTA 3GMRB 4UILL 5F7WC 2QHLA 4Z7WE 4PP2A 4ZFZB 1H8OA 1KGCE 3VWJA 3S36L 1A3QA 4NUGH 3M07A 3C5ZA 3PIQB 4P2QA 4WI6A 5DRXB 5BVJA 3IDUA 5LKNA 4RMRA 3ZT5A 3KR3L 4NQSA 2DWEA 4F3FA 3FB5A 4NRXA 5HHOD 1JI2A 1UH4A 1JPST 1SVZA 4OCSH 4Y5YB 1Z0MA 4DCQA 3VXMD 2VL5B 4FP8L 1ZVYA 3SGEI 2Y25A 4FNLH 3DBXB 3MLYL 3JV0A 2V5MA 3QIBA 4KI5E 3CSPA 5IB1A 5C0AB 5TFSL 1OGAD 2R0KH 4MQXD 4WFFE 2A77H 3QNYB 1UEYA 2VLJE 3C6SB 5ID0B 4XNZB 3CFKA 1WAAF 3UEZA 3EYOA 5EUOF 3ZDXF 3V2AR 4OTXL 5KBNC 4NBYB 2I9LA 5AG9A 2GK0B 4G3YL 4EKXA 1DQJA 5B38G 3BO8B 3HC0B 1U3HD 4CN1A 3ZYIA 3GKWL 2OI9C 3EYQC 4LGPB 3OPZH 2WBJA 5L2KB 5HVWA 4M00A 4ETQB 4PTTA 1KBGH 1CXIA 2YN3A 4XBEH 2XRAL 1S78D 1KELH 5E6IB 4YXHH 2P4AB 1XR8B 5F88A 4K9EC 1E6JH 4FQHB 5JW4Q 3PGCB 1R5WA 3LQMA 3HPJA 1GJIA 2G9HA 3P73A 3ZT7A 3OAYK 3QUYB 5DVKA 3CFEA 2FO1A 3K2UL 3MJ9H 5D70L 3ARBB 1J1OH 5BRZA 2JE8A 5C3LD 2IANA 5K9QI 5IEKA 1ES0B 4HT1H 1NEUA 2BNRD 4JVPA 1CLZH 3TIDA 4E5XB 1CT8A 1A7RL 1R3KA 2GHWB 3WLWC 5DRZB 4YBHA 1C12A 4CRPA 1BEYH 1WBXA 3KJ6L 4TN9A 2C4FT 2F9BT 1KJVA 3D39B 1YUHA 3GMMA 1ZLVH 2DRUA 4JQIH 4F9PC 3QUXA 5DI8A 5ISZE 5E70A 3BPCB 2V5YA 3T2OA 4LQFH 5IMMA 3TT3H 1AR1D 4O5LH 3PQYB 3MRMB 3TBWB 2JKXA 3VFWA 2XZCL 4DKEL 2VH5L 5HGAA 1I1YA 4PD4J 5CEXB 3GBNH 3KPMA 3N85L 1ZVSB 2VDQL 3QFDA 2PTTB 2W59A 1J0YA 2BNQD 2P5WB 1VGKB 3VD3A 2BY2A 4O58H 5HHNB 4QOKA 2R4SH 3T1WA 3LS4L 1OP3K 2BRQA 2BCKA 2BRRH 5CSZB 3HB3C 4G8EB 4LKCA 1SYSA 5HD8C 3EJYC 3D9AL 3QJFA 4PY7B 3UJJH 1DUYA 2H6PB 4BA8A 1P9MC 4JFEB 3S96B 5B22A 4D9LH 4Y89A 2XQYK 1KLGA 1MJ8L 1P1ZA 1H0DA 1HHJA 5FYJU 2C3VA 1N3NA 2DM3A 4Z0XB 5C07A 3FFCA 3TVMB 1QBBA 3RDTC 4JRXE 1TQBB 1GCFA 2YHGA 1RULH 3KYOA 3GMPA 3MV01 3I3EA 5FGBC 3MLTB 4M7LL 4QT5A 4Y4HD 3QEHA 2XKNB 4DZ8A 2R0LH 4LHUA 4MA3B 5ABDE 3H9ZA 2O61A 1FZOB 4LF3A 5EC2B 4L8CB 3CZFB 3JBG7 4ZUSB 5FK9B 8FABA 1CGUA 1Q9LA 4HUWB 5E1AB 1JNLL 3VG9C 2DQCH 4LCCB 1Q1JL 3QYCA 3VFUA 5HJ3A 5I0ZA 4MXQD 5AZ2L 3NIGE 5MERA 5DEGA 3HNSL 4PJ5A 3TH2T 1OAQL 3QUMB 4H8WL 4EN3C 4XMLL 4OM1L 1T0NB 3MRHB 5IW3A 4JFDB 2AK4B 3IB4A 4ONFL 3FO1A 4NN7B 3RVWC 3STZA 1L7TL 4OIIL 3L5JA 3KWWA 5HHME 5JR1H 1EAPB 2R56H 2X1QA 2YKLH 1NBYB 4JFXA 4YHYB 3T4YA 2ERJC 4XPTL 1RMFH 4JAMA 5F9AC 3EO1A 4YDJA 2ZSWB 1I75A 1NAKH 1PD6A 3GNMH 3C6LC 1OSPL 1EPFA 3MRGA 5DK0B 2DMKA 1I3UA 3FRPA 1CFQB 1MWAA 1NPUA 4FQXD 4YGAB 4AJ0A 3PABB 2IH1A 3UBXG 1INQA 3NACL 1C5CL 1T4KA 3BH8A 1BFOA 4Y19B 4OZIE 5LGJA 5F97E 3C09C 1JBJA 4OM0H 1OB1B 1NFDE 1H3GA 3OGOE 3H9YA 3PP3H 3D69A 4Y1AD 4ZQKA 5T3ZE 1DQDL 4GW5A 4RA3A 1LK2A 3UYRL 2XPGB 4KROD 3V7AE 3T3ME 1E4W