1I00A

Crystal structure of human thymidylate synthase, ternary complex with dump and tomudex
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
278
structure length
278
Chain Sequence
SELQYLGQIQHILRCGVRKDDRTGTGTLSVFGMQARYSLRDEFPLLTTKRVFWKGVLEELLWFIKGSTNAKELSSKGVKIWDANGSRDFLDSLGFSTREEGDLGPVYGFQWRHFGAEYRDMESDYSGQGVDQLQRVIDTIKTNPDDRRIIMCAWNPRDLPLMALPPCHALCQFYVVNSELSCQLYQRSGDMGLGVPFNIASYALLTYMIAHITGLKPGDFIHTLGDAHIYLNHIEPLKIQLQREPRPFPKLRILRKVEKIDDFKAEDFQIEGYNPHPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a deletion mutant of human thymidylate synthase Delta (7-29) and its ternary complex with Tomudex and dUMP.
pubmed doi rcsb
molecule keywords THYMIDYLATE SYNTHASE
molecule tags Transferase
source organism Homo sapiens
total genus 92
structure length 278
sequence length 278
chains with identical sequence B
ec nomenclature ec 2.1.1.45: Thymidylate synthase.
pdb deposition date 2001-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00303 Thymidylat_synt Thymidylate synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.572.10 Alpha Beta 2-Layer Sandwich Thymidylate Synthase; Chain A Thymidylate synthase/dCMP hydroxymethylase domain 1i00A00
3C0AA 1TDAA 1J3IC 1YPVA 3BGXA 3BYXA 3EHIX 3KJRA 3N5EA 3NRRA 1NJDA 1NJBA 1F4CA 3HJ3A 1HW4A 1KZIA 1BP6A 3BHRA 3KJSA 3CLBA 1F28A 3BZ0A 1TVWA 4IRRA 1TDBA 1EVGA 1JMFA 1VZBA 4EILA 4E5OA 1B5DA 3GH0A 4H0UA 1TSXA 1FFLA 1NJCA 1F4FA 3C06A 1J3KC 3IROA 1EV8A 1KZJA 3EF9A 3QJ7A 2RD8B 1SEJA 1DDUA 1VZEA 2H2QA 2OIPA 1JMIA 3B9HA 3EJLA 4O1UA 3CL9A 1J3JC 2RD8A 4Q0DA 3UWLA 2ONBA 1HZWA 4XSCA 2FTQA 4XSEA 1NJEA 5H38A 4FOGA 4G2OX 1NJAA 1KCEA 4PSGA 1BJGA 4KY8A 1RTSA 5WRNA 2FTOX 1AOBA 1F4BA 2TDDA 2KCEA 3UM8A 1B02A 1I00A 4FOAA 4DPHA 1TYSA 1BSFA 1JUTA 1AJMA 2VF0A 1TVVA 4ISWA 4H0RA 4EINA 3QGTA 1F4DA 3HB8A 3K2HA 1DNAA 1TLSA 2A9WA 1TSDA 2G8XA 3DGAC 3ED7A 4IQBA 2FTNA 5HS3A 4JEFA 1TDCA 1TSLA 4EZ8A 1TVUA 2TSRA 1SYNA 1VZDA 3IX6A 4EB4A 1THYA 1TJSA 4F2VA 1JUJA 4GYHA 3QG2A 1BSPA 1BDUA 3DG8C 3DL6A 3INVA 2AAZA 4G6WX 3UM5A 1JMGA 2TDMA 3JSUA 1TSVA 1EVFA 1LCEA 3IK1A 1TSMA 1B5EA 4ECKA 1BO8A 1BQ1A 1AXWA 1TISA 3HBBA 2TSCA 4ISKA 4KPWA 1BQ2A 5H3AA 3I3RA 5FCTA 5BY6A 1BKPA 1TRGA 1B49A 1JMHA 3N5GA 1TSYA 1BO7A 1HVYA 3GH2X 4FOXA 1TSNA 4H1IA 4O7UA 2G8AA 1ZPRA 4Q0EA 1NCEA 1BKOA 1BPJA 4TMSA 4DPDA 4IQQA 2RDAA 4GEVA 1JTUA 1TDUA 3UM6A 1FWMA 1TLCA 4KYAA 1QZFA 1LCBA 1CI7A 1BP0A 1LCAA 2G8DA 3BFIA 1F4GA 2VETA 3BNZA 4FQSA 3OB7A 3BHLA 3IHIA 1F4EA 3TMSA 4LRRA 3EAWX 4DP3A 3EBUA 3IK0A 3V8HA 4KNZA 2BBQA 1VZAA 3IRNA 1EV5A 2G89A 3EGYX 4GD7A 3EDWX 1TSZA 4O1XA 1JG0A 3DL5A 3GG5A 3H9KA 4KY4A 1BIDA 1VZCA 3KGBA 1QQQA 3IRMA 4O1XD 3UWLB 1HW3A 4E28A 1TSWA 1AN5A 2G86A 3B5BA 4FGTA 4XSDA 1JTQA 3IJZA 5H39A 1JU6A 5J7WA 3N5EB 4UP1A 1AIQA 4DQ1A
chains in the Genus database with same CATH superfamily
3C0AA 1TDAA 1J3IC 1YPVA 3BGXA 3BYXA 3EHIX 3KJRA 3N5EA 3NRRA 1NJDA 1NJBA 1F4CA 3HJ3A 1HW4A 1KZIA 1BP6A 3BHRA 3KJSA 3CLBA 1F28A 3BZ0A 1TVWA 4IRRA 1TDBA 1EVGA 1JMFA 1VZBA 4EILA 4E5OA 1B5DA 3GH0A 4H0UA 1TSXA 1FFLA 1NJCA 1F4FA 3C06A 1J3KC 3IROA 1EV8A 1KZJA 3EF9A 3QJ7A 2RD8B 1SEJA 1DDUA 1VZEA 2H2QA 2OIPA 1JMIA 3B9HA 3EJLA 4O1UA 3CL9A 1J3JC 2RD8A 4Q0DA 3UWLA 2ONBA 1HZWA 4XSCA 2FTQA 4XSEA 1NJEA 5H38A 4FOGA 4G2OX 1NJAA 1KCEA 4PSGA 1BJGA 4KY8A 1RTSA 5WRNA 2FTOX 1AOBA 1F4BA 2TDDA 2KCEA 3UM8A 1B02A 1I00A 4FOAA 4DPHA 1TYSA 1BSFA 1JUTA 1AJMA 2VF0A 1TVVA 4ISWA 4H0RA 4EINA 3QGTA 1F4DA 3HB8A 3K2HA 1DNAA 1TLSA 2A9WA 1TSDA 2G8XA 3DGAC 3ED7A 4IQBA 2FTNA 5HS3A 4JEFA 1TDCA 1TSLA 4EZ8A 1TVUA 2TSRA 1SYNA 1VZDA 3IX6A 4EB4A 1THYA 1TJSA 4F2VA 1JUJA 4GYHA 3QG2A 1BSPA 1BDUA 3DG8C 3DL6A 3INVA 2AAZA 4G6WX 3UM5A 1JMGA 2TDMA 3JSUA 1TSVA 1EVFA 1LCEA 3IK1A 1TSMA 1B5EA 4ECKA 1BO8A 1BQ1A 1AXWA 1TISA 3HBBA 2TSCA 4ISKA 4KPWA 1BQ2A 5H3AA 3I3RA 5FCTA 5BY6A 1BKPA 1TRGA 1B49A 1JMHA 3N5GA 1TSYA 1BO7A 1HVYA 3GH2X 4FOXA 1TSNA 4H1IA 4O7UA 2G8AA 1ZPRA 4Q0EA 1NCEA 1BKOA 1BPJA 4TMSA 4DPDA 4IQQA 2RDAA 4GEVA 1JTUA 1TDUA 3UM6A 1FWMA 1TLCA 4KYAA 1QZFA 1LCBA 1CI7A 1BP0A 1LCAA 2G8DA 3BFIA 1F4GA 2VETA 3BNZA 4FQSA 3OB7A 3BHLA 3IHIA 1F4EA 3TMSA 4LRRA 3EAWX 4DP3A 3EBUA 3IK0A 3V8HA 4KNZA 2BBQA 1VZAA 3IRNA 1EV5A 2G89A 3EGYX 4GD7A 3EDWX 1TSZA 4O1XA 1JG0A 3DL5A 3GG5A 3H9KA 4KY4A 1BIDA 1VZCA 3KGBA 1QQQA 3IRMA 4O1XD 3UWLB 1HW3A 4E28A 1TSWA 1AN5A 2G86A 3B5BA 4FGTA 4XSDA 1JTQA 3IJZA 5H39A 1JU6A 5J7WA 3N5EB 4UP1A 1AIQA 4DQ1A
chains in the Genus database with same CATH topology
3C0AA 1TDAA 1J3IC 1YPVA 3BGXA 3BYXA 3EHIX 3KJRA 3N5EA 3NRRA 1NJDA 1NJBA 1F4CA 3HJ3A 1HW4A 1KZIA 1BP6A 3BHRA 3KJSA 3CLBA 1F28A 3BZ0A 1TVWA 4IRRA 1TDBA 1EVGA 1JMFA 1VZBA 4EILA 4E5OA 1B5DA 3GH0A 4H0UA 1TSXA 1FFLA 1NJCA 1F4FA 3C06A 1J3KC 3IROA 1EV8A 1KZJA 3EF9A 3QJ7A 2RD8B 1SEJA 1DDUA 1VZEA 2H2QA 2OIPA 1JMIA 3B9HA 3EJLA 4O1UA 3CL9A 1J3JC 2RD8A 4Q0DA 3UWLA 2ONBA 1HZWA 4XSCA 2FTQA 4XSEA 1NJEA 5H38A 4FOGA 4G2OX 1NJAA 1KCEA 4PSGA 1BJGA 4KY8A 1RTSA 5WRNA 2FTOX 1AOBA 1F4BA 2TDDA 2KCEA 3UM8A 1B02A 1I00A 4FOAA 4DPHA 1TYSA 1BSFA 1JUTA 1AJMA 2VF0A 1TVVA 4ISWA 4H0RA 4EINA 3QGTA 1F4DA 3HB8A 3K2HA 1DNAA 1TLSA 2A9WA 1TSDA 2G8XA 3DGAC 3ED7A 4IQBA 2FTNA 5HS3A 4JEFA 1TDCA 1TSLA 4EZ8A 1TVUA 2TSRA 1SYNA 1VZDA 3IX6A 4EB4A 1THYA 1TJSA 4F2VA 1JUJA 4GYHA 3QG2A 1BSPA 1BDUA 3DG8C 3DL6A 3INVA 2AAZA 4G6WX 3UM5A 1JMGA 2TDMA 3JSUA 1TSVA 1EVFA 1LCEA 3IK1A 1TSMA 1B5EA 4ECKA 1BO8A 1BQ1A 1AXWA 1TISA 3HBBA 2TSCA 4ISKA 4KPWA 1BQ2A 5H3AA 3I3RA 5FCTA 5BY6A 1BKPA 1TRGA 1B49A 1JMHA 3N5GA 1TSYA 1BO7A 1HVYA 3GH2X 4FOXA 1TSNA 4H1IA 4O7UA 2G8AA 1ZPRA 4Q0EA 1NCEA 1BKOA 1BPJA 4TMSA 4DPDA 4IQQA 2RDAA 4GEVA 1JTUA 1TDUA 3UM6A 1FWMA 1TLCA 4KYAA 1QZFA 1LCBA 1CI7A 1BP0A 1LCAA 2G8DA 3BFIA 1F4GA 2VETA 3BNZA 4FQSA 3OB7A 3BHLA 3IHIA 1F4EA 3TMSA 4LRRA 3EAWX 4DP3A 3EBUA 3IK0A 3V8HA 4KNZA 2BBQA 1VZAA 3IRNA 1EV5A 2G89A 3EGYX 4GD7A 3EDWX 1TSZA 4O1XA 1JG0A 3DL5A 3GG5A 3H9KA 4KY4A 1BIDA 1VZCA 3KGBA 1QQQA 3IRMA 4O1XD 3UWLB 1HW3A 4E28A 1TSWA 1AN5A 2G86A 3B5BA 4FGTA 4XSDA 1JTQA 3IJZA 5H39A 1JU6A 5J7WA 3N5EB 4UP1A 1AIQA 4DQ1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C0A A;  1TDA A;  1J3I C;  1YPV A;  3BGX A;  3BYX A;  3EHI X;  3KJR A;  3N5E A;  3NRR A;  1NJD A;  1NJB A;  1F4C A;  3HJ3 A;  1HW4 A;  1KZI A;  1BP6 A;  3BHR A;  3KJS A;  3CLB A;  1F28 A;  3BZ0 A;  1TVW A;  4IRR A;  1TDB A;  1EVG A;  1JMF A;  1VZB A;  4EIL A;  4E5O A;  1B5D A;  3GH0 A;  4H0U A;  1TSX A;  1FFL A;  1NJC A;  1F4F A;  3C06 A;  1J3K C;  3IRO A;  1EV8 A;  1KZJ A;  3EF9 A;  3QJ7 A;  2RD8 B;  1SEJ A;  1DDU A;  1VZE A;  2H2Q A;  2OIP A;  1JMI A;  3B9H A;  3EJL A;  4O1U A;  3CL9 A;  1J3J C;  2RD8 A;  4Q0D A;  3UWL A;  2ONB A;  1HZW A;  4XSC A;  2FTQ A;  4XSE A;  1NJE A;  5H38 A;  4FOG A;  4G2O X;  1NJA A;  1KCE A;  4PSG A;  1BJG A;  4KY8 A;  1RTS A;  5WRN A;  2FTO X;  1AOB A;  1F4B A;  2TDD A;  2KCE A;  3UM8 A;  1B02 A;  1I00 A;  4FOA A;  4DPH A;  1TYS A;  1BSF A;  1JUT A;  1AJM A;  2VF0 A;  1TVV A;  4ISW A;  4H0R A;  4EIN A;  3QGT A;  1F4D A;  3HB8 A;  3K2H A;  1DNA A;  1TLS A;  2A9W A;  1TSD A;  2G8X A;  3DGA C;  3ED7 A;  4IQB A;  2FTN A;  5HS3 A;  4JEF A;  1TDC A;  1TSL A;  4EZ8 A;  1TVU A;  2TSR A;  1SYN A;  1VZD A;  3IX6 A;  4EB4 A;  1THY A;  1TJS A;  4F2V A;  1JUJ A;  4GYH A;  3QG2 A;  1BSP A;  1BDU A;  3DG8 C;  3DL6 A;  3INV A;  2AAZ A;  4G6W X;  3UM5 A;  1JMG A;  2TDM A;  3JSU A;  1TSV A;  1EVF A;  1LCE A;  3IK1 A;  1TSM A;  1B5E A;  4ECK A;  1BO8 A;  1BQ1 A;  1AXW A;  1TIS A;  3HBB A;  2TSC A;  4ISK A;  4KPW A;  1BQ2 A;  5H3A A;  3I3R A;  5FCT A;  5BY6 A;  1BKP A;  1TRG A;  1B49 A;  1JMH A;  3N5G A;  1TSY A;  1BO7 A;  1HVY A;  3GH2 X;  4FOX A;  1TSN A;  4H1I A;  4O7U A;  2G8A A;  1ZPR A;  4Q0E A;  1NCE A;  1BKO A;  1BPJ A;  4TMS A;  4DPD A;  4IQQ A;  2RDA A;  4GEV A;  1JTU A;  1TDU A;  3UM6 A;  1FWM A;  1TLC A;  4KYA A;  1QZF A;  1LCB A;  1CI7 A;  1BP0 A;  1LCA A;  2G8D A;  3BFI A;  1F4G A;  2VET A;  3BNZ A;  4FQS A;  3OB7 A;  3BHL A;  3IHI A;  1F4E A;  3TMS A;  4LRR A;  3EAW X;  4DP3 A;  3EBU A;  3IK0 A;  3V8H A;  4KNZ A;  2BBQ A;  1VZA A;  3IRN A;  1EV5 A;  2G89 A;  3EGY X;  4GD7 A;  3EDW X;  1TSZ A;  4O1X A;  1JG0 A;  3DL5 A;  3GG5 A;  3H9K A;  4KY4 A;  1BID A;  1VZC A;  3KGB A;  1QQQ A;  3IRM A;  4O1X D;  3UWL B;  1HW3 A;  4E28 A;  1TSW A;  1AN5 A;  2G86 A;  3B5B A;  4FGT A;  4XSD A;  1JTQ A;  3IJZ A;  5H39 A;  1JU6 A;  5J7W A;  3N5E B;  4UP1 A;  1AIQ A;  4DQ1 A; 
#chains in the Genus database with same CATH topology
 3C0A A;  1TDA A;  1J3I C;  1YPV A;  3BGX A;  3BYX A;  3EHI X;  3KJR A;  3N5E A;  3NRR A;  1NJD A;  1NJB A;  1F4C A;  3HJ3 A;  1HW4 A;  1KZI A;  1BP6 A;  3BHR A;  3KJS A;  3CLB A;  1F28 A;  3BZ0 A;  1TVW A;  4IRR A;  1TDB A;  1EVG A;  1JMF A;  1VZB A;  4EIL A;  4E5O A;  1B5D A;  3GH0 A;  4H0U A;  1TSX A;  1FFL A;  1NJC A;  1F4F A;  3C06 A;  1J3K C;  3IRO A;  1EV8 A;  1KZJ A;  3EF9 A;  3QJ7 A;  2RD8 B;  1SEJ A;  1DDU A;  1VZE A;  2H2Q A;  2OIP A;  1JMI A;  3B9H A;  3EJL A;  4O1U A;  3CL9 A;  1J3J C;  2RD8 A;  4Q0D A;  3UWL A;  2ONB A;  1HZW A;  4XSC A;  2FTQ A;  4XSE A;  1NJE A;  5H38 A;  4FOG A;  4G2O X;  1NJA A;  1KCE A;  4PSG A;  1BJG A;  4KY8 A;  1RTS A;  5WRN A;  2FTO X;  1AOB A;  1F4B A;  2TDD A;  2KCE A;  3UM8 A;  1B02 A;  1I00 A;  4FOA A;  4DPH A;  1TYS A;  1BSF A;  1JUT A;  1AJM A;  2VF0 A;  1TVV A;  4ISW A;  4H0R A;  4EIN A;  3QGT A;  1F4D A;  3HB8 A;  3K2H A;  1DNA A;  1TLS A;  2A9W A;  1TSD A;  2G8X A;  3DGA C;  3ED7 A;  4IQB A;  2FTN A;  5HS3 A;  4JEF A;  1TDC A;  1TSL A;  4EZ8 A;  1TVU A;  2TSR A;  1SYN A;  1VZD A;  3IX6 A;  4EB4 A;  1THY A;  1TJS A;  4F2V A;  1JUJ A;  4GYH A;  3QG2 A;  1BSP A;  1BDU A;  3DG8 C;  3DL6 A;  3INV A;  2AAZ A;  4G6W X;  3UM5 A;  1JMG A;  2TDM A;  3JSU A;  1TSV A;  1EVF A;  1LCE A;  3IK1 A;  1TSM A;  1B5E A;  4ECK A;  1BO8 A;  1BQ1 A;  1AXW A;  1TIS A;  3HBB A;  2TSC A;  4ISK A;  4KPW A;  1BQ2 A;  5H3A A;  3I3R A;  5FCT A;  5BY6 A;  1BKP A;  1TRG A;  1B49 A;  1JMH A;  3N5G A;  1TSY A;  1BO7 A;  1HVY A;  3GH2 X;  4FOX A;  1TSN A;  4H1I A;  4O7U A;  2G8A A;  1ZPR A;  4Q0E A;  1NCE A;  1BKO A;  1BPJ A;  4TMS A;  4DPD A;  4IQQ A;  2RDA A;  4GEV A;  1JTU A;  1TDU A;  3UM6 A;  1FWM A;  1TLC A;  4KYA A;  1QZF A;  1LCB A;  1CI7 A;  1BP0 A;  1LCA A;  2G8D A;  3BFI A;  1F4G A;  2VET A;  3BNZ A;  4FQS A;  3OB7 A;  3BHL A;  3IHI A;  1F4E A;  3TMS A;  4LRR A;  3EAW X;  4DP3 A;  3EBU A;  3IK0 A;  3V8H A;  4KNZ A;  2BBQ A;  1VZA A;  3IRN A;  1EV5 A;  2G89 A;  3EGY X;  4GD7 A;  3EDW X;  1TSZ A;  4O1X A;  1JG0 A;  3DL5 A;  3GG5 A;  3H9K A;  4KY4 A;  1BID A;  1VZC A;  3KGB A;  1QQQ A;  3IRM A;  4O1X D;  3UWL B;  1HW3 A;  4E28 A;  1TSW A;  1AN5 A;  2G86 A;  3B5B A;  4FGT A;  4XSD A;  1JTQ A;  3IJZ A;  5H39 A;  1JU6 A;  5J7W A;  3N5E B;  4UP1 A;  1AIQ A;  4DQ1 A; 
#chains in the Genus database with same CATH homology
 3C0A A;  1TDA A;  1J3I C;  1YPV A;  3BGX A;  3BYX A;  3EHI X;  3KJR A;  3N5E A;  3NRR A;  1NJD A;  1NJB A;  1F4C A;  3HJ3 A;  1HW4 A;  1KZI A;  1BP6 A;  3BHR A;  3KJS A;  3CLB A;  1F28 A;  3BZ0 A;  1TVW A;  4IRR A;  1TDB A;  1EVG A;  1JMF A;  1VZB A;  4EIL A;  4E5O A;  1B5D A;  3GH0 A;  4H0U A;  1TSX A;  1FFL A;  1NJC A;  1F4F A;  3C06 A;  1J3K C;  3IRO A;  1EV8 A;  1KZJ A;  3EF9 A;  3QJ7 A;  2RD8 B;  1SEJ A;  1DDU A;  1VZE A;  2H2Q A;  2OIP A;  1JMI A;  3B9H A;  3EJL A;  4O1U A;  3CL9 A;  1J3J C;  2RD8 A;  4Q0D A;  3UWL A;  2ONB A;  1HZW A;  4XSC A;  2FTQ A;  4XSE A;  1NJE A;  5H38 A;  4FOG A;  4G2O X;  1NJA A;  1KCE A;  4PSG A;  1BJG A;  4KY8 A;  1RTS A;  5WRN A;  2FTO X;  1AOB A;  1F4B A;  2TDD A;  2KCE A;  3UM8 A;  1B02 A;  1I00 A;  4FOA A;  4DPH A;  1TYS A;  1BSF A;  1JUT A;  1AJM A;  2VF0 A;  1TVV A;  4ISW A;  4H0R A;  4EIN A;  3QGT A;  1F4D A;  3HB8 A;  3K2H A;  1DNA A;  1TLS A;  2A9W A;  1TSD A;  2G8X A;  3DGA C;  3ED7 A;  4IQB A;  2FTN A;  5HS3 A;  4JEF A;  1TDC A;  1TSL A;  4EZ8 A;  1TVU A;  2TSR A;  1SYN A;  1VZD A;  3IX6 A;  4EB4 A;  1THY A;  1TJS A;  4F2V A;  1JUJ A;  4GYH A;  3QG2 A;  1BSP A;  1BDU A;  3DG8 C;  3DL6 A;  3INV A;  2AAZ A;  4G6W X;  3UM5 A;  1JMG A;  2TDM A;  3JSU A;  1TSV A;  1EVF A;  1LCE A;  3IK1 A;  1TSM A;  1B5E A;  4ECK A;  1BO8 A;  1BQ1 A;  1AXW A;  1TIS A;  3HBB A;  2TSC A;  4ISK A;  4KPW A;  1BQ2 A;  5H3A A;  3I3R A;  5FCT A;  5BY6 A;  1BKP A;  1TRG A;  1B49 A;  1JMH A;  3N5G A;  1TSY A;  1BO7 A;  1HVY A;  3GH2 X;  4FOX A;  1TSN A;  4H1I A;  4O7U A;  2G8A A;  1ZPR A;  4Q0E A;  1NCE A;  1BKO A;  1BPJ A;  4TMS A;  4DPD A;  4IQQ A;  2RDA A;  4GEV A;  1JTU A;  1TDU A;  3UM6 A;  1FWM A;  1TLC A;  4KYA A;  1QZF A;  1LCB A;  1CI7 A;  1BP0 A;  1LCA A;  2G8D A;  3BFI A;  1F4G A;  2VET A;  3BNZ A;  4FQS A;  3OB7 A;  3BHL A;  3IHI A;  1F4E A;  3TMS A;  4LRR A;  3EAW X;  4DP3 A;  3EBU A;  3IK0 A;  3V8H A;  4KNZ A;  2BBQ A;  1VZA A;  3IRN A;  1EV5 A;  2G89 A;  3EGY X;  4GD7 A;  3EDW X;  1TSZ A;  4O1X A;  1JG0 A;  3DL5 A;  3GG5 A;  3H9K A;  4KY4 A;  1BID A;  1VZC A;  3KGB A;  1QQQ A;  3IRM A;  4O1X D;  3UWL B;  1HW3 A;  4E28 A;  1TSW A;  1AN5 A;  2G86 A;  3B5B A;  4FGT A;  4XSD A;  1JTQ A;  3IJZ A;  5H39 A;  1JU6 A;  5J7W A;  3N5E B;  4UP1 A;  1AIQ A;  4DQ1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...