1I04A

Crystal structure of mouse major urinary protein-i from mouse liver
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
159
structure length
159
Chain Sequence
b'EEASSTGRNFNVEKINGEWHTIILASDKREKIEDNGNFRLFLEQIHVLENSLVLKFHTVRDEECSELSMVADKTEKAGEYSVTYDGFNTFTIPKTDYDNFLMAHLINEKDGETFQLMGLYGREPDLSSDIKERFAQLCEEHGILRENIIDLSNANRCLQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MAJOR URINARY PROTEIN I
publication title Structural basis of pheromone binding to mouse major urinary protein (MUP-I)
pubmed doi rcsb
molecule tags Transport protein
total genus 46
structure length 159
sequence length 159
ec nomenclature
pdb deposition date 2001-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00061 Lipocalin Lipocalin / cytosolic fatty-acid binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 1i04A00
2E4JA 1DZJA 1I04A 2MM3A 1IFCA 2OFMX 5F1EA 1X89A 4ORXA 4IB9A 1QFTA 3BDRA 1OEJA 1A18A 1XKIA 1ACDA 1HMRA 3JSQA 3STNA 1FEMA 1SY1A 3WJDA 3WVMA 1KGLA 4ZHCA 1ML7A 4I9RA 2NP1A 2GC9A 4UU3A 1G85A 4IMOA 2W2FA 5EPQA 2YG2A 2O62A 3NQ9A 1GXAA 1I4UA 4Y0RA 1U17A 4GRJA 3ZQ3A 5IO7A 1X8NA 3U0DA 4M6SA 2IFBA 1HN2A 3C77X 3DTQA 1BSYA 4D6BA 2L9CA 2BLGA 1DC9A 5B27A 1DV9A 4QGXA 1GGLA 5HA1A 1B4MA 2KT4B 2GTFX 1XCAA 3PH6A 4TKJA 4EFGA 1JBHA 1B8EA 4WBKA 3BX8A 3MVFA 5HZ5A 1FENA 3B2HA 5HBSA 4QAEA 2X46A 4YGGA 2FS7A 3CMPA 1HBQA 2FR2A 3BRNA 1JJXA 1GX8A 4O9SA 2PY1A 3F8AA 4IBAA 2QM9A 4ALOA 2A0AA 2R73A 4WFUA 3WJCA 4UU2A 1EW3A 1DZPA 4OMWA 3I17A 1I05A 3WBGA 4RUNA 3NPOA 3NQ3A 4GKCA 3D95A 3FA9A 2MO5A 2ACOA 3F9DA 2WUTA 1VYGA 3BY0A 1OBPA 3APXA 1OBQA 4ZFXA 2HLVA 3BS2A 3VG2A 1TOUA 4NLJA 4GETA 4YGHA 5HCCC 3KFHA 1TXLA 1OPAA 4I3DA 2WQAE 4YBUA 4ALBA 1LIBA 3TZSA 1JJJA 1TOWA 4EEJA 3NR3A 2WEWA 3B2JA 4DQ4A 4Y0SA 4PSQA 2A13A 1KZWA 2Q9SA 1BSQA 3BU9A 3P6HA 5LJDA 3K3LA 5LKFA 5IO5A 1DZMA 5H9NA 3L4RA 2CZTA 4HPCA 4K19A 2MJIA 4MVKA 3B2LA 2GJ5A 1ZNHA 1T68X 1B56A 3EYCA 1LIFA 3D97A 3FMZA 4BVMA 1BLRA 1GT1A 1KQXA 1SXXA 4XMEA 3IFBA 1QG5A 4BOEA 4QGVA 3PECA 1SY2A 4ORYA 2Q39A 1SXWA 1EUOA 2JU8A 1KOIA 1FE3A 4AZQA 1QY1A 1QQSA 1A57A 1R0UA 4XMDA 1YWDA 2EU7X 2G79A 3KQ0A 3HK1A 1EIIA 1BBPA 5FFHA 4MVIA 3TF6A 2LKKA 2OVEA 1JZUA 3MBTA 1E06A 5HAEA 1BM5A 1SY0A 1BEBA 1G7NA 1A3YA 5LJGA 4A1YA 4AZPA 4R0BA 5HCEC 5HTEA 1KT6A 3O22A 1IKJA 3P6GA 3UEWA 1ZRYA 3VG5A 4EXZA 1VYFA 1LF7A 4HFOA 3Q6LA 1MX7A 3FR2A 3FELA 3P6CA 1YWAA 1ZNKA 2ANSA 4GNYA 2LBVA 5KICA 1KT3A 2P8GA 5AQ6A 1EXSA 2RCQA 5C0NA 5KHPA 1SXUA 1FDQA 5DPQA 1QABE 2HZQA 4TJZA 1LICA 3BX7A 3APVA 1OEEA 3ELXA 3EMMA 4RUUA 2AT5X 1LPJA 4EDEA 1GKAB 3VG7A 3PPTA 2WWPA 4YCEA 2WSJA 3UEVA 2FLJA 5LKEA 1IFBA 1ICMA 3VG6A 3O19A 2LB6A 1GT4A 4IAXA 2JU7A 2AMMX 1KXOA 1LNMA 3FLLA 5LJBA 4YFPA 1VPRA 4ZGUA 3NX2A 1QY0A 3AKMA 1ALBA 1UZ2X 1S44A 1IW2A 2WEXA 5LJCA 3EBWA 2POAA 4M7MA 5DG4A 1LIDA 3SAOA 1N0SA 3G7XA 2G7BA 4GH7A 3B2KA 2ASNX 1X71A 2F73A 3FEKA 4YDBA 2QOSC 4QZTA 4NYRA 1NP4A 4ORUA 3U03A 4HPAA 4QZUA 3P6FA 2FR3A 2HNXA 3RSWA 5BVSA 1YP7A 4ES7A 2A2UA 3ZUOA 4LZUA 1S7DA 5L8IA 3VG3A 3WXQA 5EDCA 5HZ6A 3WJFA 4YCHA 3T1DA 2A3FX 1KZXA 1GX9A 1YWBA 2FT9A 2N93A 5LJKA 2QO4A 4NLIA 5CE4A 3HWGA 2L68A 3CQRA 1ZNEA 2FWVA 1SXYA 1U0XA 4QYNA 4D6AA 1OPBA 1D2UA 4OS0A 1H91A 1X8QA 2L5PA 5HWZA 5JR8A 1E00A 5D8JA 4BQUA 3KZAA 3P6EA 1GM6A 5B29A 2LBAA 1HMSA 5KIDA 3KFGA 4AZOA 2CM9A 5LJHA 4ARHA 5F6ZA 2AL0X 2Q4NA 5HZ8A 3AKNA 3FW4A 4IAWA 2RD7C 4AW8A 1O8VA 3WJGA 4QGWA 4KIIA 3APUA 5EEEA 3U9PC 2AT6X 4ZJ0A 5HZ9A 1PBOA 4LZVA 3DSZA 2Q2PA 4IB7A 2W2BA 3BSZE 1G74A 1T8VA 1QWDA 4ZH9A 4IB8A 2JN3A 3C78X 4N7CA 3UEXA 3KFFA 1CBRA 1B0OA 1CBIA 3FIQA 3FR4A 1CBSA 2NNEA 3CBCA 3TGAA 1D3SA 1NP1A 5F6BA 1ERXA 5EEDA 1RBPA 3BU1A 3CR6A 1LIEA 1ZNGA 3FR5A 2FRSA 4NP1A 2Q2MA 1T0VA 4QYPA 1JYDA 5EZ2A 3FEPA 2CBRA 3CWKA 1MX8A 5HA0A 5IO6A 5FENA 1KQWA 4OS8A 2AH7X 1ICNA 3C76X 2KTDA 4AZNA 4TKBA 4XMHA 2HYSA 1O1UA 3CBSA 1CRBA 2XKLA 1BWYA 4MVLA 3ZUIA 3EBKA 5L8OA 3S26A 2X45A 2DM5A 4TKHA 3HWEA 5H9LA 1QY2A 4TLJA 4DQ3A 3FW5A 1TW4A 3TGBA 1EQDA 1IKEA 3FA8A 1X8PA 4YBPA 4A8ZA 4N7DA 2XSTA 1ERBA 3FENA 1E02A 2WQ9A 1CBQA 1BRQA 2HMBA 3I0AA 3IA8A 5H9AA 1PEEA 2HZRA 2RQ0A 5D4AA 2OVDA 2CZUA 3HWDA 4ZHFA 4NYQA 4XMGA 4Y0QA 3KFIA 3CQNA 4NNSA 1HQPA 1YWCA 1LKEA 5BVTA 5HCDC 1AB0A 2NNQA 1HBPA 3PP6A 1O1VA 1GT5A 3RZYA 2OZQA 1YIVA 1L6MA 1S2PA 1AVGI 4YGZA 1EIOA 3APWA 1X8OA 1EPAA 4ORRA 1DFVA 1PM1X 1EPBA 1P6PA 1PMPA 5F58A 2AT0X 3HWFA 1KT4A 2RCTA 4YKOA 2JU3A 2JOZA 2LFOA 4ZHDA 2FTBA 4AZMA 3O2YA 1U18A 3VG4A 3UEUA 4I3CA 2K62A 2ACPX 1FELA 4GE1A 1E5PA 3EM0A 1SA8A 1SY3A 2G78A 2OVAA 3BLGA 5LJEA 1ZNDA 5L8NA 2AT3X 3WJBA 1A2DA 1ADLA 1JV4A 2RA6A 4A1HA 2CBSA 4I3BA 4YFQA 1BJ7A 2FS6A 3PH5A 3FA7A 1YUPA 1Z24A 2K23A 4CK4A 5HTDA 4ZHGA 1CJ5A 4YH0A 1HMTA 3B2IA 3STKA 3NP1A 3ELZA 4YDAA 5H8TA 1MDCA 4HPDA 4ZCBA 5K06A 2ALLX 2NNDA 3STMX 1RLBE 1GKAA 5D48A 1DZKA 3NX1A 1G5WA 3D96A 4XMFA 3WJEA 2A2GA 4TNNA 1OBUA 1ZNLA 2QO6A 4IB6A 1NGLA 2WR6A 4WFVA 1EALA 1MUPA 1YP6A 3FA6A 3NADA 3PEDA 3QKGA 4ORSA 4LKPA 3OJYC 2AKQA 1X8UA 4YFRA 1BSOA 1AQBA 4ORWA 1FTPA 2R74A 4A60A 1TVQA 1JYJA 5H9KA 4NNTA 5EDBA 4YKMA 1DF3A 1KT5A 1KT7A 2AT8X 3JS1A 4TQ2A 2W2AA 5F7GA 4OMXA 1BRPA 1IIUA 5D47A 1I06A 1QFVA 4I9SA 5BVQA 4AZRA 1OEKA 2QO5A 4OS3A 4XMCA 4LKTA 1MVGA 4GNWA 2L67A 1UREA 5FAZA 1GT3A 4AYHA 5D45A 4YMYA 1AELA 2OFRX 2CM4A 4Y0PA 4ZR2A 3TGCA 4ODDA 2R56A 5HZQA 4ZH6A 1LFOA 3GAQA 3P6DA 4HPBA 4IMNA 4ZHHA
chains in the Genus database with same CATH superfamily
2E4JA 1DZJA 1I04A 2MM3A 1IFCA 2OFMX 5F1EA 4Y5DA 1X89A 4ORXA 4IB9A 1QFTA 3BDRA 1OEJA 1A18A 1XKIA 1ACDA 1HMRA 3JSQA 3STNA 1FEMA 1SY1A 3WJDA 1VWOB 3WVMA 1STRB 4BCSA 1KGLA 2OY8A 4ZHCA 1ML7A 4I9RA 4C5PA 2NP1A 5IRUA 4KH8A 2GC9A 1WBIA 4FQBB 4OELA 1G85A 4UU3A 1Y52X 4IMOA 2W2FA 3ZI8A 3JQOA 5EPQA 2YG2A 2O62A 3NQ9A 1GXAA 1I4UA 1SRJA 1U17A 2IZHB 4GRJA 4Y0RA 1X8NA 3ZQ3A 4M6SA 2IFBA 5IO7A 1HN2A 1STPA 3C77X 3DTQA 1BSYA 1AVDA 4D6BA 1SWQA 2L9CA 2BLGA 1DC9A 1LCZA 5B27A 4O4UA 1DV9A 1JJUA 1GGLA 4QGXA 5HA1A 1B4MA 2KT4B 2GTFX 1XCAA 1NQMA 1VWIB 2RTIB 3PH6A 4TKJA 1B8EA 4EFGA 4WBKA 3PDFA 1JBHA 4ID2A 3BX8A 1NQNA 1SMPI 3MVFA 4CPIA 5HZ5A 3SZHA 3E3CA 1MEPA 2A8GA 1FENA 1SWHA 3B2HA 2RTDB 5HBSA 4KC8A 4QAEA 2X46A 3VE2A 4YGGA 2FS7A 3CMPA 3LTWA 4GJSA 4B55A 1HBQA 4MISA 2FR2A 3BRNA 1JJXA 1GX8A 2BS5A 4O9SA 2PY1A 4LQZA 3F8AA 1N43A 4IBAA 2QM9A 3VHIA 2A0AA 2R73A 3PQSA 4WFUA 3WJCA 4UU2A 1W5RA 4O3WA 4ALOA 1EW3A 1DZPA 4OMWA 5B10O 1VWBB 4BGFA 3I17A 1I05A 2BHVA 4RUNA 3NPOA 3WBGA 3NQ3A 4GKCA 3D95A 3FA9A 2MO5A 2ACOA 3F9DA 2WUTA 1VYGA 3BY0A 2RTNB 5AJCA 2VDFA 1OBPA 1Y9TA 3APXA 1OBQA 4YVBA 4ZFXA 2HLVA 3BS2A 3VG2A 1LDOA 1TOUA 4NLJA 4GETA 4YGHA 5HCCC 3KFHA 4MIRA 5CSEA 4CPFA 3WZQA 5B5GA 1TXLA 1OPAA 4I3DA 2WQAE 4YBUA 3WYQA 4U8UM 4ALBA 2RTGB 1LIBA 4CSBA 4EQAC 3TZSA 1SRGA 1JJJA 2GH7A 3RE5A 2FGSA 4U8UN 3V8UA 3ZW0A 1TOWA 4EEJA 3NR3A 5JD2A 2WEWA 4BX7B 3WZNA 2AVIA 3ZW1A 3B2JA 4DQ4A 4Y0SA 1GX3A 1SLFB 2RTHB 4GDAA 3P02A 4PSQA 3HPEA 2A13A 1KZWA 1VWCB 2Q9SA 1BSQA 3BU9A 3P6HA 5LJDA 3SLJA 2OFAA 3K3LA 5LKFA 4Y59A 1DZMA 5IO5A 2RTFB 5H9NA 4QRLA 4CPEA 3L4RA 2CZTA 4HPCA 4K19A 3WZPA 2MJIA 1VWKB 1STSB 3TGCA 4O4OA 2G8CO 4MVKA 3B2LA 2GJ5A 1ZNHA 1T68X 4O3XB 1B56A 3EYCA 1LIFA 1I9HA 2DJFA 3LHNA 3D97A 3FMZA 3MX7A 4BVMA 1BLRA 2A5CA 2X8SA 1JIWI 1GT1A 1KQXA 4U3QA 1SXXA 4XMEA 2RTOB 1QG5A 3IFBA 2RTBB 4BOEA 4QGVA 3PECA 1SY2A 4ORYA 2Q39A 1SXWA 4ML7B 4O3ZA 1EUOA 2JU8A 1KOIA 1FE3A 3OBLA 1QY1A 1QQSA 4AZQA 1R0UA 2Z4HA 4INNA 3VU1A 4I60A 4XMDA 2MF6A 1YWDA 2EU7X 2G79A 3KQ0A 3HK1A 3SOTA 4FGIB 2IZGB 5FQ6E 1EIIA 1BBPA 5FFHA 1LDQA 2OY5O 4MVIA 3TF6A 2LKKA 2OVEA 4Z28A 1JZUA 3MBTA 4MEEA 1E06A 2AF5A 5HAEA 2RTAA 1BM5A 1SY0A 1BEBA 1VWGB 1G7NA 4PJ2A 2IZLB 1A3YA 5LJGA 4A1YA 4AZPA 2OYBO 4R0BA 5HCEC 3QQ2A 1KT6A 1VWMB 3MG5A 5HTEA 3O22A 1SWTA 1IKJA 3P6GA 3UEWA 2X8TA 1ZRYA 1VWHB 1I78A 2RTCB 4HWMA 2X32A 1HXZA 3VG5A 4EXZA 1SLDB 1PTSA 1VYFA 1LF7A 4HFOA 3Q6LA 1MX7A 3FR2A 3FELA 1NDJA 2X8FA 1YWAA 3P6CA 1ZNKA 2ANSA 4GNYA 2LBVA 4CDCA 5KICA 3D9WA 1KT3A 2P8GA 4FBRA 5AQ6A 2RTKA 1EXSA 2RCQA 5C0NA 4CV7A 2IZBA 2ZAGA 5KHPA 1SXUA 2VFCA 1Y9LA 4WHIA 4U46A 1FDQA 2RTRB 4IABA 5CYBA 4GK9A 5DPQA 1QABE 2HZQA 4TJZA 3T2XA 1LICA 2KD2A 4JNJA 3BX7A 3APVA 3CKGA 1OEEA 3ELXA 3EMMA 4RUUA 1SREA 1Y53X 2AT5X 3X00A 1LPJA 5IRWA 4EDEA 5BYPA 1GKAB 1Y55X 2IZJA 3PPTA 3VG7A 4BX6A 4GU8A 2OL8O 2WWPA 1HQQA 4YCEA 2WSJA 3UEVA 2FLJA 4U8UO 5LKEA 1IFBA 1ICMA 1EI5A 1SWKA 3VG6A 3O19A 2M4LA 2LB6A 1GT4A 4OEMA 4IAXA 2JU7A 2AMMX 2IZDB 4O3YA 4ZH6A 1RAVA 1KXOA 1LNMA 2I5ZO 3FLLA 1A57A 1HY2A 5LJBA 4YFPA 1VPRA 4ZGUA 3N91A 2F01A 3NX2A 1N4JA 1QY0A 1ALBA 3AKMA 1UZ2X 5K67A 3FIDA 1S44A 1IW2A 5B5FA 2WEXA 5LJCA 3EBWA 2POAA 4M7MA 5DG4A 1LIDA 3SAOA 1N0SA 3G7XA 2G7BA 3RE6A 2Y32A 2MWHA 1SRFA 3B2KA 4GH7A 4GGTA 1K24A 2ASNX 1X71A 2YMSA 1SWCA 1UYOX 2F73A 3FEKA 2QCBA 4YDBA 2QOSC 4QZTA 4NYRA 5L3YA 3GE2A 1NP4A 4GUZA 4ORUA 3RY2A 2IZKA 3U03A 3F6ZB 4HPAA 3HTYA 1VWQB 4QZUA 3P6FA 2FR3A 2HNXA 3RSWA 5BVSA 1YP7A 4ES7A 4I95A 4CPHA 2C1QA 1SWRA 2LA7A 2A2UA 3ZUOA 4LZUA 1S7DA 5L8IA 3VG3A 3WXQA 5FQ7E 1SLGB 5EDCA 4BBOA 5HZ6A 3WJFA 4FBOA 3S60A 4YCHA 3T1DA 2A3FX 3RDOA 3VE1A 2OFBA 4ON1A 4CDDA 1GX9A 1YWBA 1KZXA 2FT9A 1UYNX 1SWGA 4I6SA 2N93A 4NW4A 2QO4A 5LJKA 4NLIA 5CE4A 2BS6A 1LUQA 2L68A 3CQRA 3EC5A 3HWGA 1ZNEA 4BX5A 4Z2VA 2FWVA 1SWAA 1SXYA 1U0XA 4QYNA 4D6AA 3EW1A 1OPBA 2C1SA 1D2UA 4OS0A 1H91A 1X8QA 2L5PA 2IZAA 5HWZA 1Y0GA 3RKGA 4CDFA 2JMBA 5JR8A 1E00A 5D8JA 4BQUA 3KZAA 3P6EA 1GM6A 5B29A 1RXKA 2LBAA 3H3IA 5B3MO 1HMSA 1PBYA 5KIDA 3KFGA 4AZOA 3WOVA 2CM9A 5LJHA 1RXHA 3HOLA 4KT5A 4ARHA 4O49A 5F6ZA 2AL0X 2Q4NA 3P24A 1SWFA 1VWFB 4O4XA 3AKNA 3FW4A 4IAWA 4EKVA 5HZ8A 2RD7C 3CKFA 1O8VA 4AW8A 3WJGA 4QGWA 3NBXX 4JGLA 4OKAA 4KIIA 3APUA 5EEEA 4GZVA 2PI3O 1W6FA 1JMZA 2AT6X 2OY1O 2X55A 3EW2A 3U9PC 4BJ8A 4ZJ0A 1SRHA 5HZ9A 3SZIA 1N7YA 1PBOA 4LZVA 3DSZA 2Q2PA 1VWAB 2OL6O 4IB7A 2W2BA 5B2AO 3BSZE 1G74A 2BT9A 2GTLM 1T8VA 1QWDA 2RTMA 3RDUA 4ZH9A 4IB8A 2JN3A 2X4MA 3C78X 2MHDA 2GTLN 4N7CA 3UEXA 2FHLA 2Y3EA 3KFFA 1CBRA 2UZ2A 1B0OA 1CBIA 1SWDA 3FIQA 1CBSA 3FR4A 2NNEA 4KC7A 3CBCA 4MVEA 3TGAA 1D3SA 3Q34A 1NP1A 5F6BA 1ERXA 2DJGA 5EEDA 1RBPA 3BU1A 3CR6A 1LIEA 1SWBA 1ZNGA 3FR5A 3ZW0B 2FRSA 3FDCA 4NP1A 1DF8A 2Q2MA 1W4TA 1T0VA 4QYPA 2RTLA 2RTPB 3VHHA 3ZW1B 1JYDA 5EZ2A 1MK5A 2CBRA 3CWKA 1MX8A 3FEPA 2OY7A 5HA0A 5IO6A 5FENA 1KQWA 2OVSA 4OS8A 2AH7X 1ICNA 3C76X 2KTDA 3RDMA 4AZNA 4TKBA 1SWUA 5FQ8E 3SZJA 4XMHA 2HYSA 4O4SA 1VWDB 2A5BA 1O1UA 3CBSA 1SWSA 3VHMA 1CRBA 2XKLA 1BWYA 4MVLA 3ZUIA 3EBKA 5L8OA 3RWXA 4NV8A 2G5LA 2OF9A 3S26A 4ZGFA 2X45A 2DM5A 4TKHA 3HWEA 1IJ8A 5H9LA 1QY2A 4TLJA 4DQ3A 3FW5A 4IRWA 1TW4A 2X56A 3TGBA 2OL7A 1EQDA 3D4RA 4CDEA 4QNIA 1IKEA 4BX7A 3FA8A 1VWEB 2QMIA 5AEOA 2KW1A 1X8PA 4YBPA 4A8ZA 4N7DA 4GJVA 1NC9A 2XSTA 1ERBA 2IZIA 1E02A 2WQ9A 3FENA 1CBQA 1BRQA 2HMBA 3I0AA 3IA8A 4KCAA 5H9AA 1PEEA 2HZRA 2RQ0A 5D4AA 1SLEB 2OVDA 2CZUA 3HWDA 1VWJB 2QOMA 3ZW2A 4ZHFA 3VGWA 3HOEA 1K3BA 4NYQA 4XMGA 5AJBA 3WZOA 4Y0QA 3PQUA 3KFIA 3CQNA 1E2TA 4NNSA 1HQPA 3RY1A 1YWCA 1LKEA 5BVTA 5HCDC 1AB0A 1HBPA 2JW1A 2NNQA 2ZSCA 1RSUB 1OSPO 1O1VA 1GT5A 2IZEB 3PP6A 3LV4A 3RZYA 2OZQA 1YIVA 4Z6JA 1L6MA 1S2PA 1AVGI 2Z4IA 3T2WA 2JGSA 4YGZA 1EIOA 1KFFA 3APWA 3ZWEA 1X8OA 1EPAA 1WUBA 1DFVA 1PM1X 3AEHA 4ORRA 1EPBA 2RTEB 1LCVA 1P6PA 3RBYA 4DNEA 1PMPA 5F58A 2AT0X 2VFBA 3HWFA 1KT4A 1VWPB 2RCTA 2KTSA 4YKOA 2JU3A 3T6LA 2JOZA 2Y3FA 3NQKA 1RXJA 2LFOA 4ZHDA 4DCBA 3UAQA 4Z2PA 2BC3A 2FTBA 3PK2A 4AZMA 3O2YA 1U18A 3VG4A 3UEUA 2UYWA 3MM0A 4I3CA 2K62A 2IZFB 2ACPX 1FELA 4GE1A 3RDQA 1E5PA 4GD9A 3EM0A 2GTLO 3T6FA 1NBXA 1SA8A 4GGRA 5K68A 1SY3A 2RTQB 2G78A 2OVAA 3BLGA 5LJEA 1ZNDA 2WPUA 4BX6B 5L8NA 1VWLB 5IRAA 2AT3X 3WJBA 1A2DA 1ADLA 2IZCB 4NV7A 3RDXA 1JV4A 2RA6A 4A1HA 2CBSA 2X34A 2ZAIA 4I3BA 4YFQA 1LELA 1BJ7A 1HXLA 2FS6A 3SLOA 2FKGA 2RN4A 3PH5A 3FA7A 1YUPA 2FKJA 3KVNA 1Z24A 2K23A 4CK4A 5HTDA 3OE3A 4ZHGA 1CJ5A 4YH0A 1VYOA 4QQ1A 1HMTA 3B2IA 4JO6A 3STKA 3NP1A 1VWRB 3ELZA 4YDAA 1SWJA 3S5VA 1LCWA 3WYPA 5H8TA 3ZZVA 1KL5A 2OF8A 1MDCA 4GGZA 1MOYA 4HPDA 1N9MA 2F09A 4ZCBA 5K06A 2ALLX 4L1NA 2NNDA 3STMX 1RLBE 4FBVA 1GKAA 5D48A 1DZKA 3RDSA 3NX1A 4Z27A 1G5WA 2C4IA 3D96A 3SLTA 4XMFA 3WJEA 3U0DA 2A2GA 4TNNA 1OBUA 2CAMA 4COTA 1ZNLA 1JQPA 2QO6A 1NGLA 2WR6A 1SWPA 4IB6A 4WFVA 1EALA 1AVEA 1MUPA 1YP6A 2I5VO 3FA6A 3NADA 3PEDA 3QKGA 4ORSA 4CPHB 4LKPA 3OJYC 2BSZA 2AKQA 1X8UA 4YFRA 1BSOA 1FJ1E 1AQBA 3OD9A 4ORWA 1FTPA 2R74A 4A60A 1KL4A 2HKDA 1TVQA 1JYJA 5H9KA 1MM9A 4NNTA 5EDBA 4YKMA 5IXGA 5F2BA 1RSTB 1KT5A 1DF3A 1KT7A 2AT8X 3JS1A 4TQ2A 2W2AA 5CHKA 5F7GA 1SWLA 4OMXA 1BRPA 5B11O 4Z2OA 1IIUA 5D47A 3VPJE 1I06A 1QFVA 4I9SA 5BVQA 3S5XA 4AZRA 1OEKA 2FHNX 2QO5A 4L3RA 1SWEA 4OS3A 4XMCA 4LKTA 1N9YA 1MVGA 4GNWA 4BX5B 2L67A 1UREA 5FAZA 1GT3A 4AYHA 5D45A 1SRIA 4YMYA 4U9CA 1AELA 2OFRX 3FYFA 2CM4A 1SWOA 1VWNB 2RTJA 4Y0PA 4ODDA 4ZR2A 1KL3A 2R56A 4JHQA 3AUMO 1JMXA 5HZQA 1LFOA 3GAQA 3P6DA 4GDZA 4HPBA 4IMNA 1SWNA 4ZHHA
chains in the Genus database with same CATH topology
2E4JA 1DZJA 1I04A 2MM3A 1IFCA 2OFMX 5F1EA 1X89A 4ORXA 4IB9A 1QFTA 3BDRA 1OEJA 1A18A 1XKIA 1ACDA 1HMRA 3JSQA 3STNA 1FEMA 1SY1A 3WJDA 3WVMA 1KGLA 4ZHCA 1ML7A 4I9RA 2NP1A 4KH8A 2GC9A 4FQBB 4UU3A 1G85A 4IMOA 3ZI8A 2W2FA 3JQOA 5EPQA 2YG2A 2O62A 3NQ9A 1GXAA 1I4UA 4Y0RA 1U17A 4GRJA 3ZQ3A 5IO7A 1X8NA 3U0DA 4M6SA 2IFBA 1HN2A 3C77X 3DTQA 1BSYA 4D6BA 2L9CA 2BLGA 1DC9A 5B27A 4O4UA 1DV9A 4QGXA 1GGLA 5HA1A 1B4MA 2KT4B 2GTFX 1XCAA 3PH6A 4TKJA 4EFGA 1JBHA 1B8EA 4WBKA 4ID2A 3BX8A 1SMPI 3MVFA 5HZ5A 3E3CA 1FENA 3B2HA 5HBSA 4KC8A 4QAEA 2X46A 3VE2A 4YGGA 2FS7A 3CMPA 1HBQA 4MISA 2FR2A 3BRNA 1JJXA 1GX8A 2BS5A 4O9SA 2PY1A 4LQZA 3F8AA 4IBAA 2QM9A 4ALOA 2A0AA 2R73A 3PQSA 4WFUA 3WJCA 4UU2A 4O3WA 1EW3A 1DZPA 4OMWA 3I17A 1I05A 2BHVA 4RUNA 3NPOA 3WBGA 3NQ3A 4GKCA 3D95A 3FA9A 2MO5A 2ACOA 3F9DA 2WUTA 1VYGA 3BY0A 5AJCA 1OBPA 1Y9TA 3APXA 1OBQA 4ZFXA 2HLVA 3BS2A 3VG2A 1TOUA 4NLJA 4GETA 4YGHA 5HCCC 3KFHA 4MIRA 1TXLA 1OPAA 4I3DA 2WQAE 4YBUA 4ALBA 4U8UM 4CSBA 4EQAC 1LIBA 3TZSA 1JJJA 4U8UN 3V8UA 3ZW0A 1TOWA 4EEJA 3NR3A 2WEWA 3ZW1A 3B2JA 4DQ4A 4Y0SA 3P02A 4PSQA 2A13A 1KZWA 2Q9SA 1BSQA 3BU9A 3P6HA 5LJDA 3K3LA 5LKFA 5IO5A 1DZMA 5H9NA 4QRLA 3L4RA 2CZTA 4HPCA 4K19A 2MJIA 4O4OA 4MVKA 3B2LA 2GJ5A 1ZNHA 1T68X 4O3XB 1B56A 3EYCA 1LIFA 3LHNA 3D97A 3FMZA 3MX7A 4BVMA 1BLRA 2X8SA 1JIWI 1GT1A 1KQXA 4U3QA 1SXXA 4XMEA 3IFBA 1QG5A 4BOEA 4QGVA 3PECA 1SY2A 4ORYA 2Q39A 1SXWA 4ML7B 4O3ZA 1EUOA 2JU8A 1KOIA 1FE3A 3OBLA 1QY1A 1QQSA 4AZQA 1R0UA 2Z4HA 4INNA 3VU1A 4XMDA 1YWDA 2EU7X 2G79A 3KQ0A 3HK1A 3SOTA 4FGIB 5FQ6E 1EIIA 1BBPA 5FFHA 4MVIA 3TF6A 2LKKA 2OVEA 1JZUA 3MBTA 1E06A 5HAEA 1BM5A 1SY0A 1BEBA 1G7NA 4PJ2A 1A3YA 5LJGA 4A1YA 4AZPA 4R0BA 5HCEC 5HTEA 1KT6A 3O22A 1IKJA 3P6GA 3UEWA 2X8TA 1ZRYA 4HWMA 3VG5A 4EXZA 1VYFA 1LF7A 4HFOA 3Q6LA 1MX7A 3FR2A 3FELA 2X8FA 3P6CA 1YWAA 1ZNKA 2ANSA 4GNYA 2LBVA 5KICA 1KT3A 2P8GA 4FBRA 5AQ6A 1EXSA 2RCQA 5C0NA 4CV7A 2ZAGA 5KHPA 1SXUA 1Y9LA 4WHIA 1FDQA 4IABA 5CYBA 4GK9A 5DPQA 1QABE 2HZQA 4TJZA 1LICA 2KD2A 3BX7A 3APVA 1OEEA 3ELXA 3EMMA 4RUUA 2AT5X 1LPJA 4EDEA 5BYPA 1GKAB 3VG7A 3PPTA 4GU8A 2WWPA 4YCEA 2WSJA 3UEVA 2FLJA 4U8UO 5LKEA 1IFBA 1ICMA 1EI5A 3VG6A 3O19A 2M4LA 2LB6A 1GT4A 4IAXA 2JU7A 2AMMX 4O3YA 1KXOA 1LNMA 3FLLA 1A57A 5LJBA 4YFPA 1VPRA 4ZGUA 3N91A 3NX2A 1QY0A 3AKMA 1ALBA 1UZ2X 1S44A 1IW2A 2WEXA 5LJCA 3EBWA 2POAA 4M7MA 5DG4A 1LIDA 3SAOA 1N0SA 3G7XA 2G7BA 4GH7A 2MWHA 3B2KA 2ASNX 1X71A 2YMSA 2F73A 3FEKA 4YDBA 2QOSC 4QZTA 4NYRA 3GE2A 1NP4A 4ORUA 3U03A 3F6ZB 4HPAA 3HTYA 4QZUA 3P6FA 2FR3A 2HNXA 3RSWA 5BVSA 1YP7A 4ES7A 4I95A 2LA7A 2A2UA 3ZUOA 4LZUA 1S7DA 5L8IA 3VG3A 3WXQA 5FQ7E 5EDCA 5HZ6A 3WJFA 4FBOA 3S60A 4YCHA 3T1DA 2A3FX 3VE1A 4ON1A 1KZXA 1GX9A 1YWBA 2FT9A 4I6SA 2N93A 4NW4A 2QO4A 5LJKA 4NLIA 5CE4A 2BS6A 2L68A 3CQRA 3HWGA 1ZNEA 2FWVA 1SXYA 1U0XA 4QYNA 4D6AA 1OPBA 1D2UA 4OS0A 1H91A 1X8QA 2L5PA 5HWZA 2JMBA 5JR8A 1E00A 5D8JA 4BQUA 3KZAA 3P6EA 1GM6A 5B29A 2LBAA 3H3IA 1HMSA 5KIDA 3KFGA 4AZOA 3WOVA 2CM9A 5LJHA 4KT5A 3HOLA 4ARHA 4O49A 5F6ZA 2AL0X 2Q4NA 3P24A 4O4XA 5HZ8A 3AKNA 3FW4A 4IAWA 2RD7C 4AW8A 1O8VA 3WJGA 4QGWA 3NBXX 4JGLA 4KIIA 3APUA 5EEEA 4GZVA 3U9PC 2AT6X 4ZJ0A 5HZ9A 1PBOA 4LZVA 3DSZA 2Q2PA 4IB7A 2W2BA 3BSZE 1G74A 2BT9A 2GTLM 1T8VA 1QWDA 4ZH9A 4IB8A 2JN3A 3C78X 2MHDA 2GTLN 4N7CA 3UEXA 3KFFA 1CBRA 1B0OA 1CBIA 3FIQA 3FR4A 1CBSA 2NNEA 4KC7A 3CBCA 4MVEA 3TGAA 1D3SA 1NP1A 5F6BA 1ERXA 5EEDA 1RBPA 3BU1A 3CR6A 1LIEA 1ZNGA 3FR5A 3ZW0B 2FRSA 4NP1A 2Q2MA 1T0VA 4QYPA 3ZW1B 1JYDA 5EZ2A 3FEPA 2CBRA 3CWKA 1MX8A 5HA0A 5IO6A 5FENA 1KQWA 2OVSA 4OS8A 2AH7X 1ICNA 3C76X 2KTDA 4AZNA 4TKBA 5FQ8E 4XMHA 2HYSA 4O4SA 1O1UA 3CBSA 1CRBA 2XKLA 1BWYA 4MVLA 3ZUIA 3EBKA 5L8OA 3RWXA 3S26A 4ZGFA 2X45A 2DM5A 4TKHA 3HWEA 5H9LA 1QY2A 4TLJA 4DQ3A 3FW5A 1TW4A 3TGBA 1EQDA 3D4RA 4QNIA 1IKEA 3FA8A 5AEOA 2QMIA 2KW1A 1X8PA 4YBPA 4A8ZA 4N7DA 2XSTA 1ERBA 3FENA 1E02A 2WQ9A 1CBQA 1BRQA 2HMBA 3I0AA 3IA8A 4KCAA 5H9AA 1PEEA 2HZRA 2RQ0A 5D4AA 2OVDA 2CZUA 3HWDA 3ZW2A 4ZHFA 3HOEA 4NYQA 4XMGA 5AJBA 4Y0QA 3PQUA 3KFIA 3CQNA 4NNSA 1HQPA 1YWCA 1LKEA 5BVTA 5HCDC 2JW1A 1AB0A 2NNQA 1HBPA 3PP6A 1O1VA 1GT5A 3LV4A 3RZYA 2OZQA 1YIVA 1L6MA 1S2PA 1AVGI 2Z4IA 4YGZA 1EIOA 3APWA 1X8OA 1EPAA 4ORRA 1DFVA 1PM1X 1EPBA 1P6PA 3RBYA 1PMPA 5F58A 2AT0X 3HWFA 1KT4A 2RCTA 2KTSA 4YKOA 2JU3A 2JOZA 3NQKA 2LFOA 4ZHDA 3UAQA 2FTBA 4AZMA 3O2YA 1U18A 3VG4A 3UEUA 4I3CA 2K62A 2ACPX 1FELA 4GE1A 1E5PA 3EM0A 2GTLO 1SA8A 1SY3A 2G78A 2OVAA 3BLGA 5LJEA 1ZNDA 5L8NA 2AT3X 3WJBA 1A2DA 1ADLA 1JV4A 2RA6A 4A1HA 2CBSA 2ZAIA 4I3BA 4YFQA 1BJ7A 2FS6A 2RN4A 3PH5A 3FA7A 1YUPA 1Z24A 2K23A 4CK4A 5HTDA 3OE3A 4ZHGA 1CJ5A 4YH0A 4QQ1A 1HMTA 3B2IA 3STKA 3NP1A 3ELZA 4YDAA 3S5VA 5H8TA 3ZZVA 1MDCA 4HPDA 2F09A 4ZCBA 5K06A 2ALLX 4L1NA 2NNDA 3STMX 1RLBE 4FBVA 1GKAA 5D48A 1DZKA 3NX1A 1G5WA 3D96A 4XMFA 3WJEA 2A2GA 4TNNA 1OBUA 4COTA 1ZNLA 2QO6A 4IB6A 1NGLA 2WR6A 4WFVA 1EALA 1MUPA 1YP6A 3FA6A 3NADA 3PEDA 3QKGA 4ORSA 4LKPA 3OJYC 2AKQA 1X8UA 4YFRA 1BSOA 3OD9A 1AQBA 4ORWA 1FTPA 2R74A 4A60A 1TVQA 1JYJA 5H9KA 4NNTA 5EDBA 4YKMA 1DF3A 1KT5A 1KT7A 2AT8X 3JS1A 4TQ2A 2W2AA 5F7GA 4OMXA 1BRPA 1IIUA 5D47A 3VPJE 1I06A 1QFVA 4I9SA 5BVQA 3S5XA 4AZRA 1OEKA 2QO5A 4L3RA 4OS3A 4XMCA 4LKTA 1MVGA 4GNWA 2L67A 1UREA 5FAZA 1GT3A 4AYHA 5D45A 4YMYA 4U9CA 1AELA 2OFRX 3FYFA 2CM4A 4Y0PA 4ZR2A 3ZWEA 4ODDA 3TGCA 2R56A 5HZQA 4ZH6A 3RKGA 1LFOA 3GAQA 3P6DA 4GDZA 4HPBA 4IMNA 4ZHHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E4J A;  1DZJ A;  1I04 A;  2MM3 A;  1IFC A;  2OFM X;  5F1E A;  1X89 A;  4ORX A;  4IB9 A;  1QFT A;  3BDR A;  1OEJ A;  1A18 A;  1XKI A;  1ACD A;  1HMR A;  3JSQ A;  3STN A;  1FEM A;  1SY1 A;  3WJD A;  3WVM A;  1KGL A;  4ZHC A;  1ML7 A;  4I9R A;  2NP1 A;  2GC9 A;  4UU3 A;  1G85 A;  4IMO A;  2W2F A;  5EPQ A;  2YG2 A;  2O62 A;  3NQ9 A;  1GXA A;  1I4U A;  4Y0R A;  1U17 A;  4GRJ A;  3ZQ3 A;  5IO7 A;  1X8N A;  3U0D A;  4M6S A;  2IFB A;  1HN2 A;  3C77 X;  3DTQ A;  1BSY A;  4D6B A;  2L9C A;  2BLG A;  1DC9 A;  5B27 A;  1DV9 A;  4QGX A;  1GGL A;  5HA1 A;  1B4M A;  2KT4 B;  2GTF X;  1XCA A;  3PH6 A;  4TKJ A;  4EFG A;  1JBH A;  1B8E A;  4WBK A;  3BX8 A;  3MVF A;  5HZ5 A;  1FEN A;  3B2H A;  5HBS A;  4QAE A;  2X46 A;  4YGG A;  2FS7 A;  3CMP A;  1HBQ A;  2FR2 A;  3BRN A;  1JJX A;  1GX8 A;  4O9S A;  2PY1 A;  3F8A A;  4IBA A;  2QM9 A;  4ALO A;  2A0A A;  2R73 A;  4WFU A;  3WJC A;  4UU2 A;  1EW3 A;  1DZP A;  4OMW A;  3I17 A;  1I05 A;  3WBG A;  4RUN A;  3NPO A;  3NQ3 A;  4GKC A;  3D95 A;  3FA9 A;  2MO5 A;  2ACO A;  3F9D A;  2WUT A;  1VYG A;  3BY0 A;  1OBP A;  3APX A;  1OBQ A;  4ZFX A;  2HLV A;  3BS2 A;  3VG2 A;  1TOU A;  4NLJ A;  4GET A;  4YGH A;  5HCC C;  3KFH A;  1TXL A;  1OPA A;  4I3D A;  2WQA E;  4YBU A;  4ALB A;  1LIB A;  3TZS A;  1JJJ A;  1TOW A;  4EEJ A;  3NR3 A;  2WEW A;  3B2J A;  4DQ4 A;  4Y0S A;  4PSQ A;  2A13 A;  1KZW A;  2Q9S A;  1BSQ A;  3BU9 A;  3P6H A;  5LJD A;  3K3L A;  5LKF A;  5IO5 A;  1DZM A;  5H9N A;  3L4R A;  2CZT A;  4HPC A;  4K19 A;  2MJI A;  4MVK A;  3B2L A;  2GJ5 A;  1ZNH A;  1T68 X;  1B56 A;  3EYC A;  1LIF A;  3D97 A;  3FMZ A;  4BVM A;  1BLR A;  1GT1 A;  1KQX A;  1SXX A;  4XME A;  3IFB A;  1QG5 A;  4BOE A;  4QGV A;  3PEC A;  1SY2 A;  4ORY A;  2Q39 A;  1SXW A;  1EUO A;  2JU8 A;  1KOI A;  1FE3 A;  4AZQ A;  1QY1 A;  1QQS A;  1A57 A;  1R0U A;  4XMD A;  1YWD A;  2EU7 X;  2G79 A;  3KQ0 A;  3HK1 A;  1EII A;  1BBP A;  5FFH A;  4MVI A;  3TF6 A;  2LKK A;  2OVE A;  1JZU A;  3MBT A;  1E06 A;  5HAE A;  1BM5 A;  1SY0 A;  1BEB A;  1G7N A;  1A3Y A;  5LJG A;  4A1Y A;  4AZP A;  4R0B A;  5HCE C;  5HTE A;  1KT6 A;  3O22 A;  1IKJ A;  3P6G A;  3UEW A;  1ZRY A;  3VG5 A;  4EXZ A;  1VYF A;  1LF7 A;  4HFO A;  3Q6L A;  1MX7 A;  3FR2 A;  3FEL A;  3P6C A;  1YWA A;  1ZNK A;  2ANS A;  4GNY A;  2LBV A;  5KIC A;  1KT3 A;  2P8G A;  5AQ6 A;  1EXS A;  2RCQ A;  5C0N A;  5KHP A;  1SXU A;  1FDQ A;  5DPQ A;  1QAB E;  2HZQ A;  4TJZ A;  1LIC A;  3BX7 A;  3APV A;  1OEE A;  3ELX A;  3EMM A;  4RUU A;  2AT5 X;  1LPJ A;  4EDE A;  1GKA B;  3VG7 A;  3PPT A;  2WWP A;  4YCE A;  2WSJ A;  3UEV A;  2FLJ A;  5LKE A;  1IFB A;  1ICM A;  3VG6 A;  3O19 A;  2LB6 A;  1GT4 A;  4IAX A;  2JU7 A;  2AMM X;  1KXO A;  1LNM A;  3FLL A;  5LJB A;  4YFP A;  1VPR A;  4ZGU A;  3NX2 A;  1QY0 A;  3AKM A;  1ALB A;  1UZ2 X;  1S44 A;  1IW2 A;  2WEX A;  5LJC A;  3EBW A;  2POA A;  4M7M A;  5DG4 A;  1LID A;  3SAO A;  1N0S A;  3G7X A;  2G7B A;  4GH7 A;  3B2K A;  2ASN X;  1X71 A;  2F73 A;  3FEK A;  4YDB A;  2QOS C;  4QZT A;  4NYR A;  1NP4 A;  4ORU A;  3U03 A;  4HPA A;  4QZU A;  3P6F A;  2FR3 A;  2HNX A;  3RSW A;  5BVS A;  1YP7 A;  4ES7 A;  2A2U A;  3ZUO A;  4LZU A;  1S7D A;  5L8I A;  3VG3 A;  3WXQ A;  5EDC A;  5HZ6 A;  3WJF A;  4YCH A;  3T1D A;  2A3F X;  1KZX A;  1GX9 A;  1YWB A;  2FT9 A;  2N93 A;  5LJK A;  2QO4 A;  4NLI A;  5CE4 A;  3HWG A;  2L68 A;  3CQR A;  1ZNE A;  2FWV A;  1SXY A;  1U0X A;  4QYN A;  4D6A A;  1OPB A;  1D2U A;  4OS0 A;  1H91 A;  1X8Q A;  2L5P A;  5HWZ A;  5JR8 A;  1E00 A;  5D8J A;  4BQU A;  3KZA A;  3P6E A;  1GM6 A;  5B29 A;  2LBA A;  1HMS A;  5KID A;  3KFG A;  4AZO A;  2CM9 A;  5LJH A;  4ARH A;  5F6Z A;  2AL0 X;  2Q4N A;  5HZ8 A;  3AKN A;  3FW4 A;  4IAW A;  2RD7 C;  4AW8 A;  1O8V A;  3WJG A;  4QGW A;  4KII A;  3APU A;  5EEE A;  3U9P C;  2AT6 X;  4ZJ0 A;  5HZ9 A;  1PBO A;  4LZV A;  3DSZ A;  2Q2P A;  4IB7 A;  2W2B A;  3BSZ E;  1G74 A;  1T8V A;  1QWD A;  4ZH9 A;  4IB8 A;  2JN3 A;  3C78 X;  4N7C A;  3UEX A;  3KFF A;  1CBR A;  1B0O A;  1CBI A;  3FIQ A;  3FR4 A;  1CBS A;  2NNE A;  3CBC A;  3TGA A;  1D3S A;  1NP1 A;  5F6B A;  1ERX A;  5EED A;  1RBP A;  3BU1 A;  3CR6 A;  1LIE A;  1ZNG A;  3FR5 A;  2FRS A;  4NP1 A;  2Q2M A;  1T0V A;  4QYP A;  1JYD A;  5EZ2 A;  3FEP A;  2CBR A;  3CWK A;  1MX8 A;  5HA0 A;  5IO6 A;  5FEN A;  1KQW A;  4OS8 A;  2AH7 X;  1ICN A;  3C76 X;  2KTD A;  4AZN A;  4TKB A;  4XMH A;  2HYS A;  1O1U A;  3CBS A;  1CRB A;  2XKL A;  1BWY A;  4MVL A;  3ZUI A;  3EBK A;  5L8O A;  3S26 A;  2X45 A;  2DM5 A;  4TKH A;  3HWE A;  5H9L A;  1QY2 A;  4TLJ A;  4DQ3 A;  3FW5 A;  1TW4 A;  3TGB A;  1EQD A;  1IKE A;  3FA8 A;  1X8P A;  4YBP A;  4A8Z A;  4N7D A;  2XST A;  1ERB A;  3FEN A;  1E02 A;  2WQ9 A;  1CBQ A;  1BRQ A;  2HMB A;  3I0A A;  3IA8 A;  5H9A A;  1PEE A;  2HZR A;  2RQ0 A;  5D4A A;  2OVD A;  2CZU A;  3HWD A;  4ZHF A;  4NYQ A;  4XMG A;  4Y0Q A;  3KFI A;  3CQN A;  4NNS A;  1HQP A;  1YWC A;  1LKE A;  5BVT A;  5HCD C;  1AB0 A;  2NNQ A;  1HBP A;  3PP6 A;  1O1V A;  1GT5 A;  3RZY A;  2OZQ A;  1YIV A;  1L6M A;  1S2P A;  1AVG I;  4YGZ A;  1EIO A;  3APW A;  1X8O A;  1EPA A;  4ORR A;  1DFV A;  1PM1 X;  1EPB A;  1P6P A;  1PMP A;  5F58 A;  2AT0 X;  3HWF A;  1KT4 A;  2RCT A;  4YKO A;  2JU3 A;  2JOZ A;  2LFO A;  4ZHD A;  2FTB A;  4AZM A;  3O2Y A;  1U18 A;  3VG4 A;  3UEU A;  4I3C A;  2K62 A;  2ACP X;  1FEL A;  4GE1 A;  1E5P A;  3EM0 A;  1SA8 A;  1SY3 A;  2G78 A;  2OVA A;  3BLG A;  5LJE A;  1ZND A;  5L8N A;  2AT3 X;  3WJB A;  1A2D A;  1ADL A;  1JV4 A;  2RA6 A;  4A1H A;  2CBS A;  4I3B A;  4YFQ A;  1BJ7 A;  2FS6 A;  3PH5 A;  3FA7 A;  1YUP A;  1Z24 A;  2K23 A;  4CK4 A;  5HTD A;  4ZHG A;  1CJ5 A;  4YH0 A;  1HMT A;  3B2I A;  3STK A;  3NP1 A;  3ELZ A;  4YDA A;  5H8T A;  1MDC A;  4HPD A;  4ZCB A;  5K06 A;  2ALL X;  2NND A;  3STM X;  1RLB E;  1GKA A;  5D48 A;  1DZK A;  3NX1 A;  1G5W A;  3D96 A;  4XMF A;  3WJE A;  2A2G A;  4TNN A;  1OBU A;  1ZNL A;  2QO6 A;  4IB6 A;  1NGL A;  2WR6 A;  4WFV A;  1EAL A;  1MUP A;  1YP6 A;  3FA6 A;  3NAD A;  3PED A;  3QKG A;  4ORS A;  4LKP A;  3OJY C;  2AKQ A;  1X8U A;  4YFR A;  1BSO A;  1AQB A;  4ORW A;  1FTP A;  2R74 A;  4A60 A;  1TVQ A;  1JYJ A;  5H9K A;  4NNT A;  5EDB A;  4YKM A;  1DF3 A;  1KT5 A;  1KT7 A;  2AT8 X;  3JS1 A;  4TQ2 A;  2W2A A;  5F7G A;  4OMX A;  1BRP A;  1IIU A;  5D47 A;  1I06 A;  1QFV A;  4I9S A;  5BVQ A;  4AZR A;  1OEK A;  2QO5 A;  4OS3 A;  4XMC A;  4LKT A;  1MVG A;  4GNW A;  2L67 A;  1URE A;  5FAZ A;  1GT3 A;  4AYH A;  5D45 A;  4YMY A;  1AEL A;  2OFR X;  2CM4 A;  4Y0P A;  4ZR2 A;  3TGC A;  4ODD A;  2R56 A;  5HZQ A;  4ZH6 A;  1LFO A;  3GAQ A;  3P6D A;  4HPB A;  4IMN A;  4ZHH A; 
#chains in the Genus database with same CATH topology
 2E4J A;  1DZJ A;  1I04 A;  2MM3 A;  1IFC A;  2OFM X;  5F1E A;  4Y5D A;  1X89 A;  4ORX A;  4IB9 A;  1QFT A;  3BDR A;  1OEJ A;  1A18 A;  1XKI A;  1ACD A;  1HMR A;  3JSQ A;  3STN A;  1FEM A;  1SY1 A;  3WJD A;  1VWO B;  3WVM A;  1STR B;  4BCS A;  1KGL A;  2OY8 A;  4ZHC A;  1ML7 A;  4I9R A;  4C5P A;  2NP1 A;  5IRU A;  4KH8 A;  2GC9 A;  1WBI A;  4FQB B;  4OEL A;  1G85 A;  4UU3 A;  1Y52 X;  4IMO A;  2W2F A;  3ZI8 A;  3JQO A;  5EPQ A;  2YG2 A;  2O62 A;  3NQ9 A;  1GXA A;  1I4U A;  1SRJ A;  1U17 A;  2IZH B;  4GRJ A;  4Y0R A;  1X8N A;  3ZQ3 A;  4M6S A;  2IFB A;  5IO7 A;  1HN2 A;  1STP A;  3C77 X;  3DTQ A;  1BSY A;  1AVD A;  4D6B A;  1SWQ A;  2L9C A;  2BLG A;  1DC9 A;  1LCZ A;  5B27 A;  4O4U A;  1DV9 A;  1JJU A;  1GGL A;  4QGX A;  5HA1 A;  1B4M A;  2KT4 B;  2GTF X;  1XCA A;  1NQM A;  1VWI B;  2RTI B;  3PH6 A;  4TKJ A;  1B8E A;  4EFG A;  4WBK A;  3PDF A;  1JBH A;  4ID2 A;  3BX8 A;  1NQN A;  1SMP I;  3MVF A;  4CPI A;  5HZ5 A;  3SZH A;  3E3C A;  1MEP A;  2A8G A;  1FEN A;  1SWH A;  3B2H A;  2RTD B;  5HBS A;  4KC8 A;  4QAE A;  2X46 A;  3VE2 A;  4YGG A;  2FS7 A;  3CMP A;  3LTW A;  4GJS A;  4B55 A;  1HBQ A;  4MIS A;  2FR2 A;  3BRN A;  1JJX A;  1GX8 A;  2BS5 A;  4O9S A;  2PY1 A;  4LQZ A;  3F8A A;  1N43 A;  4IBA A;  2QM9 A;  3VHI A;  2A0A A;  2R73 A;  3PQS A;  4WFU A;  3WJC A;  4UU2 A;  1W5R A;  4O3W A;  4ALO A;  1EW3 A;  1DZP A;  4OMW A;  5B10 O;  1VWB B;  4BGF A;  3I17 A;  1I05 A;  2BHV A;  4RUN A;  3NPO A;  3WBG A;  3NQ3 A;  4GKC A;  3D95 A;  3FA9 A;  2MO5 A;  2ACO A;  3F9D A;  2WUT A;  1VYG A;  3BY0 A;  2RTN B;  5AJC A;  2VDF A;  1OBP A;  1Y9T A;  3APX A;  1OBQ A;  4YVB A;  4ZFX A;  2HLV A;  3BS2 A;  3VG2 A;  1LDO A;  1TOU A;  4NLJ A;  4GET A;  4YGH A;  5HCC C;  3KFH A;  4MIR A;  5CSE A;  4CPF A;  3WZQ A;  5B5G A;  1TXL A;  1OPA A;  4I3D A;  2WQA E;  4YBU A;  3WYQ A;  4U8U M;  4ALB A;  2RTG B;  1LIB A;  4CSB A;  4EQA C;  3TZS A;  1SRG A;  1JJJ A;  2GH7 A;  3RE5 A;  2FGS A;  4U8U N;  3V8U A;  3ZW0 A;  1TOW A;  4EEJ A;  3NR3 A;  5JD2 A;  2WEW A;  4BX7 B;  3WZN A;  2AVI A;  3ZW1 A;  3B2J A;  4DQ4 A;  4Y0S A;  1GX3 A;  1SLF B;  2RTH B;  4GDA A;  3P02 A;  4PSQ A;  3HPE A;  2A13 A;  1KZW A;  1VWC B;  2Q9S A;  1BSQ A;  3BU9 A;  3P6H A;  5LJD A;  3SLJ A;  2OFA A;  3K3L A;  5LKF A;  4Y59 A;  1DZM A;  5IO5 A;  2RTF B;  5H9N A;  4QRL A;  4CPE A;  3L4R A;  2CZT A;  4HPC A;  4K19 A;  3WZP A;  2MJI A;  1VWK B;  1STS B;  3TGC A;  4O4O A;  2G8C O;  4MVK A;  3B2L A;  2GJ5 A;  1ZNH A;  1T68 X;  4O3X B;  1B56 A;  3EYC A;  1LIF A;  1I9H A;  2DJF A;  3LHN A;  3D97 A;  3FMZ A;  3MX7 A;  4BVM A;  1BLR A;  2A5C A;  2X8S A;  1JIW I;  1GT1 A;  1KQX A;  4U3Q A;  1SXX A;  4XME A;  2RTO B;  1QG5 A;  3IFB A;  2RTB B;  4BOE A;  4QGV A;  3PEC A;  1SY2 A;  4ORY A;  2Q39 A;  1SXW A;  4ML7 B;  4O3Z A;  1EUO A;  2JU8 A;  1KOI A;  1FE3 A;  3OBL A;  1QY1 A;  1QQS A;  4AZQ A;  1R0U A;  2Z4H A;  4INN A;  3VU1 A;  4I60 A;  4XMD A;  2MF6 A;  1YWD A;  2EU7 X;  2G79 A;  3KQ0 A;  3HK1 A;  3SOT A;  4FGI B;  2IZG B;  5FQ6 E;  1EII A;  1BBP A;  5FFH A;  1LDQ A;  2OY5 O;  4MVI A;  3TF6 A;  2LKK A;  2OVE A;  4Z28 A;  1JZU A;  3MBT A;  4MEE A;  1E06 A;  2AF5 A;  5HAE A;  2RTA A;  1BM5 A;  1SY0 A;  1BEB A;  1VWG B;  1G7N A;  4PJ2 A;  2IZL B;  1A3Y A;  5LJG A;  4A1Y A;  4AZP A;  2OYB O;  4R0B A;  5HCE C;  3QQ2 A;  1KT6 A;  1VWM B;  3MG5 A;  5HTE A;  3O22 A;  1SWT A;  1IKJ A;  3P6G A;  3UEW A;  2X8T A;  1ZRY A;  1VWH B;  1I78 A;  2RTC B;  4HWM A;  2X32 A;  1HXZ A;  3VG5 A;  4EXZ A;  1SLD B;  1PTS A;  1VYF A;  1LF7 A;  4HFO A;  3Q6L A;  1MX7 A;  3FR2 A;  3FEL A;  1NDJ A;  2X8F A;  1YWA A;  3P6C A;  1ZNK A;  2ANS A;  4GNY A;  2LBV A;  4CDC A;  5KIC A;  3D9W A;  1KT3 A;  2P8G A;  4FBR A;  5AQ6 A;  2RTK A;  1EXS A;  2RCQ A;  5C0N A;  4CV7 A;  2IZB A;  2ZAG A;  5KHP A;  1SXU A;  2VFC A;  1Y9L A;  4WHI A;  4U46 A;  1FDQ A;  2RTR B;  4IAB A;  5CYB A;  4GK9 A;  5DPQ A;  1QAB E;  2HZQ A;  4TJZ A;  3T2X A;  1LIC A;  2KD2 A;  4JNJ A;  3BX7 A;  3APV A;  3CKG A;  1OEE A;  3ELX A;  3EMM A;  4RUU A;  1SRE A;  1Y53 X;  2AT5 X;  3X00 A;  1LPJ A;  5IRW A;  4EDE A;  5BYP A;  1GKA B;  1Y55 X;  2IZJ A;  3PPT A;  3VG7 A;  4BX6 A;  4GU8 A;  2OL8 O;  2WWP A;  1HQQ A;  4YCE A;  2WSJ A;  3UEV A;  2FLJ A;  4U8U O;  5LKE A;  1IFB A;  1ICM A;  1EI5 A;  1SWK A;  3VG6 A;  3O19 A;  2M4L A;  2LB6 A;  1GT4 A;  4OEM A;  4IAX A;  2JU7 A;  2AMM X;  2IZD B;  4O3Y A;  4ZH6 A;  1RAV A;  1KXO A;  1LNM A;  2I5Z O;  3FLL A;  1A57 A;  1HY2 A;  5LJB A;  4YFP A;  1VPR A;  4ZGU A;  3N91 A;  2F01 A;  3NX2 A;  1N4J A;  1QY0 A;  1ALB A;  3AKM A;  1UZ2 X;  5K67 A;  3FID A;  1S44 A;  1IW2 A;  5B5F A;  2WEX A;  5LJC A;  3EBW A;  2POA A;  4M7M A;  5DG4 A;  1LID A;  3SAO A;  1N0S A;  3G7X A;  2G7B A;  3RE6 A;  2Y32 A;  2MWH A;  1SRF A;  3B2K A;  4GH7 A;  4GGT A;  1K24 A;  2ASN X;  1X71 A;  2YMS A;  1SWC A;  1UYO X;  2F73 A;  3FEK A;  2QCB A;  4YDB A;  2QOS C;  4QZT A;  4NYR A;  5L3Y A;  3GE2 A;  1NP4 A;  4GUZ A;  4ORU A;  3RY2 A;  2IZK A;  3U03 A;  3F6Z B;  4HPA A;  3HTY A;  1VWQ B;  4QZU A;  3P6F A;  2FR3 A;  2HNX A;  3RSW A;  5BVS A;  1YP7 A;  4ES7 A;  4I95 A;  4CPH A;  2C1Q A;  1SWR A;  2LA7 A;  2A2U A;  3ZUO A;  4LZU A;  1S7D A;  5L8I A;  3VG3 A;  3WXQ A;  5FQ7 E;  1SLG B;  5EDC A;  4BBO A;  5HZ6 A;  3WJF A;  4FBO A;  3S60 A;  4YCH A;  3T1D A;  2A3F X;  3RDO A;  3VE1 A;  2OFB A;  4ON1 A;  4CDD A;  1GX9 A;  1YWB A;  1KZX A;  2FT9 A;  1UYN X;  1SWG A;  4I6S A;  2N93 A;  4NW4 A;  2QO4 A;  5LJK A;  4NLI A;  5CE4 A;  2BS6 A;  1LUQ A;  2L68 A;  3CQR A;  3EC5 A;  3HWG A;  1ZNE A;  4BX5 A;  4Z2V A;  2FWV A;  1SWA A;  1SXY A;  1U0X A;  4QYN A;  4D6A A;  3EW1 A;  1OPB A;  2C1S A;  1D2U A;  4OS0 A;  1H91 A;  1X8Q A;  2L5P A;  2IZA A;  5HWZ A;  1Y0G A;  3RKG A;  4CDF A;  2JMB A;  5JR8 A;  1E00 A;  5D8J A;  4BQU A;  3KZA A;  3P6E A;  1GM6 A;  5B29 A;  1RXK A;  2LBA A;  3H3I A;  5B3M O;  1HMS A;  1PBY A;  5KID A;  3KFG A;  4AZO A;  3WOV A;  2CM9 A;  5LJH A;  1RXH A;  3HOL A;  4KT5 A;  4ARH A;  4O49 A;  5F6Z A;  2AL0 X;  2Q4N A;  3P24 A;  1SWF A;  1VWF B;  4O4X A;  3AKN A;  3FW4 A;  4IAW A;  4EKV A;  5HZ8 A;  2RD7 C;  3CKF A;  1O8V A;  4AW8 A;  3WJG A;  4QGW A;  3NBX X;  4JGL A;  4OKA A;  4KII A;  3APU A;  5EEE A;  4GZV A;  2PI3 O;  1W6F A;  1JMZ A;  2AT6 X;  2OY1 O;  2X55 A;  3EW2 A;  3U9P C;  4BJ8 A;  4ZJ0 A;  1SRH A;  5HZ9 A;  3SZI A;  1N7Y A;  1PBO A;  4LZV A;  3DSZ A;  2Q2P A;  1VWA B;  2OL6 O;  4IB7 A;  2W2B A;  5B2A O;  3BSZ E;  1G74 A;  2BT9 A;  2GTL M;  1T8V A;  1QWD A;  2RTM A;  3RDU A;  4ZH9 A;  4IB8 A;  2JN3 A;  2X4M A;  3C78 X;  2MHD A;  2GTL N;  4N7C A;  3UEX A;  2FHL A;  2Y3E A;  3KFF A;  1CBR A;  2UZ2 A;  1B0O A;  1CBI A;  1SWD A;  3FIQ A;  1CBS A;  3FR4 A;  2NNE A;  4KC7 A;  3CBC A;  4MVE A;  3TGA A;  1D3S A;  3Q34 A;  1NP1 A;  5F6B A;  1ERX A;  2DJG A;  5EED A;  1RBP A;  3BU1 A;  3CR6 A;  1LIE A;  1SWB A;  1ZNG A;  3FR5 A;  3ZW0 B;  2FRS A;  3FDC A;  4NP1 A;  1DF8 A;  2Q2M A;  1W4T A;  1T0V A;  4QYP A;  2RTL A;  2RTP B;  3VHH A;  3ZW1 B;  1JYD A;  5EZ2 A;  1MK5 A;  2CBR A;  3CWK A;  1MX8 A;  3FEP A;  2OY7 A;  5HA0 A;  5IO6 A;  5FEN A;  1KQW A;  2OVS A;  4OS8 A;  2AH7 X;  1ICN A;  3C76 X;  2KTD A;  3RDM A;  4AZN A;  4TKB A;  1SWU A;  5FQ8 E;  3SZJ A;  4XMH A;  2HYS A;  4O4S A;  1VWD B;  2A5B A;  1O1U A;  3CBS A;  1SWS A;  3VHM A;  1CRB A;  2XKL A;  1BWY A;  4MVL A;  3ZUI A;  3EBK A;  5L8O A;  3RWX A;  4NV8 A;  2G5L A;  2OF9 A;  3S26 A;  4ZGF A;  2X45 A;  2DM5 A;  4TKH A;  3HWE A;  1IJ8 A;  5H9L A;  1QY2 A;  4TLJ A;  4DQ3 A;  3FW5 A;  4IRW A;  1TW4 A;  2X56 A;  3TGB A;  2OL7 A;  1EQD A;  3D4R A;  4CDE A;  4QNI A;  1IKE A;  4BX7 A;  3FA8 A;  1VWE B;  2QMI A;  5AEO A;  2KW1 A;  1X8P A;  4YBP A;  4A8Z A;  4N7D A;  4GJV A;  1NC9 A;  2XST A;  1ERB A;  2IZI A;  1E02 A;  2WQ9 A;  3FEN A;  1CBQ A;  1BRQ A;  2HMB A;  3I0A A;  3IA8 A;  4KCA A;  5H9A A;  1PEE A;  2HZR A;  2RQ0 A;  5D4A A;  1SLE B;  2OVD A;  2CZU A;  3HWD A;  1VWJ B;  2QOM A;  3ZW2 A;  4ZHF A;  3VGW A;  3HOE A;  1K3B A;  4NYQ A;  4XMG A;  5AJB A;  3WZO A;  4Y0Q A;  3PQU A;  3KFI A;  3CQN A;  1E2T A;  4NNS A;  1HQP A;  3RY1 A;  1YWC A;  1LKE A;  5BVT A;  5HCD C;  1AB0 A;  1HBP A;  2JW1 A;  2NNQ A;  2ZSC A;  1RSU B;  1OSP O;  1O1V A;  1GT5 A;  2IZE B;  3PP6 A;  3LV4 A;  3RZY A;  2OZQ A;  1YIV A;  4Z6J A;  1L6M A;  1S2P A;  1AVG I;  2Z4I A;  3T2W A;  2JGS A;  4YGZ A;  1EIO A;  1KFF A;  3APW A;  3ZWE A;  1X8O A;  1EPA A;  1WUB A;  1DFV A;  1PM1 X;  3AEH A;  4ORR A;  1EPB A;  2RTE B;  1LCV A;  1P6P A;  3RBY A;  4DNE A;  1PMP A;  5F58 A;  2AT0 X;  2VFB A;  3HWF A;  1KT4 A;  1VWP B;  2RCT A;  2KTS A;  4YKO A;  2JU3 A;  3T6L A;  2JOZ A;  2Y3F A;  3NQK A;  1RXJ A;  2LFO A;  4ZHD A;  4DCB A;  3UAQ A;  4Z2P A;  2BC3 A;  2FTB A;  3PK2 A;  4AZM A;  3O2Y A;  1U18 A;  3VG4 A;  3UEU A;  2UYW A;  3MM0 A;  4I3C A;  2K62 A;  2IZF B;  2ACP X;  1FEL A;  4GE1 A;  3RDQ A;  1E5P A;  4GD9 A;  3EM0 A;  2GTL O;  3T6F A;  1NBX A;  1SA8 A;  4GGR A;  5K68 A;  1SY3 A;  2RTQ B;  2G78 A;  2OVA A;  3BLG A;  5LJE A;  1ZND A;  2WPU A;  4BX6 B;  5L8N A;  1VWL B;  5IRA A;  2AT3 X;  3WJB A;  1A2D A;  1ADL A;  2IZC B;  4NV7 A;  3RDX A;  1JV4 A;  2RA6 A;  4A1H A;  2CBS A;  2X34 A;  2ZAI A;  4I3B A;  4YFQ A;  1LEL A;  1BJ7 A;  1HXL A;  2FS6 A;  3SLO A;  2FKG A;  2RN4 A;  3PH5 A;  3FA7 A;  1YUP A;  2FKJ A;  3KVN A;  1Z24 A;  2K23 A;  4CK4 A;  5HTD A;  3OE3 A;  4ZHG A;  1CJ5 A;  4YH0 A;  1VYO A;  4QQ1 A;  1HMT A;  3B2I A;  4JO6 A;  3STK A;  3NP1 A;  1VWR B;  3ELZ A;  4YDA A;  1SWJ A;  3S5V A;  1LCW A;  3WYP A;  5H8T A;  3ZZV A;  1KL5 A;  2OF8 A;  1MDC A;  4GGZ A;  1MOY A;  4HPD A;  1N9M A;  2F09 A;  4ZCB A;  5K06 A;  2ALL X;  4L1N A;  2NND A;  3STM X;  1RLB E;  4FBV A;  1GKA A;  5D48 A;  1DZK A;  3RDS A;  3NX1 A;  4Z27 A;  1G5W A;  2C4I A;  3D96 A;  3SLT A;  4XMF A;  3WJE A;  3U0D A;  2A2G A;  4TNN A;  1OBU A;  2CAM A;  4COT A;  1ZNL A;  1JQP A;  2QO6 A;  1NGL A;  2WR6 A;  1SWP A;  4IB6 A;  4WFV A;  1EAL A;  1AVE A;  1MUP A;  1YP6 A;  2I5V O;  3FA6 A;  3NAD A;  3PED A;  3QKG A;  4ORS A;  4CPH B;  4LKP A;  3OJY C;  2BSZ A;  2AKQ A;  1X8U A;  4YFR A;  1BSO A;  1FJ1 E;  1AQB A;  3OD9 A;  4ORW A;  1FTP A;  2R74 A;  4A60 A;  1KL4 A;  2HKD A;  1TVQ A;  1JYJ A;  5H9K A;  1MM9 A;  4NNT A;  5EDB A;  4YKM A;  5IXG A;  5F2B A;  1RST B;  1KT5 A;  1DF3 A;  1KT7 A;  2AT8 X;  3JS1 A;  4TQ2 A;  2W2A A;  5CHK A;  5F7G A;  1SWL A;  4OMX A;  1BRP A;  5B11 O;  4Z2O A;  1IIU A;  5D47 A;  3VPJ E;  1I06 A;  1QFV A;  4I9S A;  5BVQ A;  3S5X A;  4AZR A;  1OEK A;  2FHN X;  2QO5 A;  4L3R A;  1SWE A;  4OS3 A;  4XMC A;  4LKT A;  1N9Y A;  1MVG A;  4GNW A;  4BX5 B;  2L67 A;  1URE A;  5FAZ A;  1GT3 A;  4AYH A;  5D45 A;  1SRI A;  4YMY A;  4U9C A;  1AEL A;  2OFR X;  3FYF A;  2CM4 A;  1SWO A;  1VWN B;  2RTJ A;  4Y0P A;  4ODD A;  4ZR2 A;  1KL3 A;  2R56 A;  4JHQ A;  3AUM O;  1JMX A;  5HZQ A;  1LFO A;  3GAQ A;  3P6D A;  4GDZ A;  4HPB A;  4IMN A;  1SWN A;  4ZHH A; 
#chains in the Genus database with same CATH homology
 2E4J A;  1DZJ A;  1I04 A;  2MM3 A;  1IFC A;  2OFM X;  5F1E A;  1X89 A;  4ORX A;  4IB9 A;  1QFT A;  3BDR A;  1OEJ A;  1A18 A;  1XKI A;  1ACD A;  1HMR A;  3JSQ A;  3STN A;  1FEM A;  1SY1 A;  3WJD A;  3WVM A;  1KGL A;  4ZHC A;  1ML7 A;  4I9R A;  2NP1 A;  4KH8 A;  2GC9 A;  4FQB B;  4UU3 A;  1G85 A;  4IMO A;  3ZI8 A;  2W2F A;  3JQO A;  5EPQ A;  2YG2 A;  2O62 A;  3NQ9 A;  1GXA A;  1I4U A;  4Y0R A;  1U17 A;  4GRJ A;  3ZQ3 A;  5IO7 A;  1X8N A;  3U0D A;  4M6S A;  2IFB A;  1HN2 A;  3C77 X;  3DTQ A;  1BSY A;  4D6B A;  2L9C A;  2BLG A;  1DC9 A;  5B27 A;  4O4U A;  1DV9 A;  4QGX A;  1GGL A;  5HA1 A;  1B4M A;  2KT4 B;  2GTF X;  1XCA A;  3PH6 A;  4TKJ A;  4EFG A;  1JBH A;  1B8E A;  4WBK A;  4ID2 A;  3BX8 A;  1SMP I;  3MVF A;  5HZ5 A;  3E3C A;  1FEN A;  3B2H A;  5HBS A;  4KC8 A;  4QAE A;  2X46 A;  3VE2 A;  4YGG A;  2FS7 A;  3CMP A;  1HBQ A;  4MIS A;  2FR2 A;  3BRN A;  1JJX A;  1GX8 A;  2BS5 A;  4O9S A;  2PY1 A;  4LQZ A;  3F8A A;  4IBA A;  2QM9 A;  4ALO A;  2A0A A;  2R73 A;  3PQS A;  4WFU A;  3WJC A;  4UU2 A;  4O3W A;  1EW3 A;  1DZP A;  4OMW A;  3I17 A;  1I05 A;  2BHV A;  4RUN A;  3NPO A;  3WBG A;  3NQ3 A;  4GKC A;  3D95 A;  3FA9 A;  2MO5 A;  2ACO A;  3F9D A;  2WUT A;  1VYG A;  3BY0 A;  5AJC A;  1OBP A;  1Y9T A;  3APX A;  1OBQ A;  4ZFX A;  2HLV A;  3BS2 A;  3VG2 A;  1TOU A;  4NLJ A;  4GET A;  4YGH A;  5HCC C;  3KFH A;  4MIR A;  1TXL A;  1OPA A;  4I3D A;  2WQA E;  4YBU A;  4ALB A;  4U8U M;  4CSB A;  4EQA C;  1LIB A;  3TZS A;  1JJJ A;  4U8U N;  3V8U A;  3ZW0 A;  1TOW A;  4EEJ A;  3NR3 A;  2WEW A;  3ZW1 A;  3B2J A;  4DQ4 A;  4Y0S A;  3P02 A;  4PSQ A;  2A13 A;  1KZW A;  2Q9S A;  1BSQ A;  3BU9 A;  3P6H A;  5LJD A;  3K3L A;  5LKF A;  5IO5 A;  1DZM A;  5H9N A;  4QRL A;  3L4R A;  2CZT A;  4HPC A;  4K19 A;  2MJI A;  4O4O A;  4MVK A;  3B2L A;  2GJ5 A;  1ZNH A;  1T68 X;  4O3X B;  1B56 A;  3EYC A;  1LIF A;  3LHN A;  3D97 A;  3FMZ A;  3MX7 A;  4BVM A;  1BLR A;  2X8S A;  1JIW I;  1GT1 A;  1KQX A;  4U3Q A;  1SXX A;  4XME A;  3IFB A;  1QG5 A;  4BOE A;  4QGV A;  3PEC A;  1SY2 A;  4ORY A;  2Q39 A;  1SXW A;  4ML7 B;  4O3Z A;  1EUO A;  2JU8 A;  1KOI A;  1FE3 A;  3OBL A;  1QY1 A;  1QQS A;  4AZQ A;  1R0U A;  2Z4H A;  4INN A;  3VU1 A;  4XMD A;  1YWD A;  2EU7 X;  2G79 A;  3KQ0 A;  3HK1 A;  3SOT A;  4FGI B;  5FQ6 E;  1EII A;  1BBP A;  5FFH A;  4MVI A;  3TF6 A;  2LKK A;  2OVE A;  1JZU A;  3MBT A;  1E06 A;  5HAE A;  1BM5 A;  1SY0 A;  1BEB A;  1G7N A;  4PJ2 A;  1A3Y A;  5LJG A;  4A1Y A;  4AZP A;  4R0B A;  5HCE C;  5HTE A;  1KT6 A;  3O22 A;  1IKJ A;  3P6G A;  3UEW A;  2X8T A;  1ZRY A;  4HWM A;  3VG5 A;  4EXZ A;  1VYF A;  1LF7 A;  4HFO A;  3Q6L A;  1MX7 A;  3FR2 A;  3FEL A;  2X8F A;  3P6C A;  1YWA A;  1ZNK A;  2ANS A;  4GNY A;  2LBV A;  5KIC A;  1KT3 A;  2P8G A;  4FBR A;  5AQ6 A;  1EXS A;  2RCQ A;  5C0N A;  4CV7 A;  2ZAG A;  5KHP A;  1SXU A;  1Y9L A;  4WHI A;  1FDQ A;  4IAB A;  5CYB A;  4GK9 A;  5DPQ A;  1QAB E;  2HZQ A;  4TJZ A;  1LIC A;  2KD2 A;  3BX7 A;  3APV A;  1OEE A;  3ELX A;  3EMM A;  4RUU A;  2AT5 X;  1LPJ A;  4EDE A;  5BYP A;  1GKA B;  3VG7 A;  3PPT A;  4GU8 A;  2WWP A;  4YCE A;  2WSJ A;  3UEV A;  2FLJ A;  4U8U O;  5LKE A;  1IFB A;  1ICM A;  1EI5 A;  3VG6 A;  3O19 A;  2M4L A;  2LB6 A;  1GT4 A;  4IAX A;  2JU7 A;  2AMM X;  4O3Y A;  1KXO A;  1LNM A;  3FLL A;  1A57 A;  5LJB A;  4YFP A;  1VPR A;  4ZGU A;  3N91 A;  3NX2 A;  1QY0 A;  3AKM A;  1ALB A;  1UZ2 X;  1S44 A;  1IW2 A;  2WEX A;  5LJC A;  3EBW A;  2POA A;  4M7M A;  5DG4 A;  1LID A;  3SAO A;  1N0S A;  3G7X A;  2G7B A;  4GH7 A;  2MWH A;  3B2K A;  2ASN X;  1X71 A;  2YMS A;  2F73 A;  3FEK A;  4YDB A;  2QOS C;  4QZT A;  4NYR A;  3GE2 A;  1NP4 A;  4ORU A;  3U03 A;  3F6Z B;  4HPA A;  3HTY A;  4QZU A;  3P6F A;  2FR3 A;  2HNX A;  3RSW A;  5BVS A;  1YP7 A;  4ES7 A;  4I95 A;  2LA7 A;  2A2U A;  3ZUO A;  4LZU A;  1S7D A;  5L8I A;  3VG3 A;  3WXQ A;  5FQ7 E;  5EDC A;  5HZ6 A;  3WJF A;  4FBO A;  3S60 A;  4YCH A;  3T1D A;  2A3F X;  3VE1 A;  4ON1 A;  1KZX A;  1GX9 A;  1YWB A;  2FT9 A;  4I6S A;  2N93 A;  4NW4 A;  2QO4 A;  5LJK A;  4NLI A;  5CE4 A;  2BS6 A;  2L68 A;  3CQR A;  3HWG A;  1ZNE A;  2FWV A;  1SXY A;  1U0X A;  4QYN A;  4D6A A;  1OPB A;  1D2U A;  4OS0 A;  1H91 A;  1X8Q A;  2L5P A;  5HWZ A;  2JMB A;  5JR8 A;  1E00 A;  5D8J A;  4BQU A;  3KZA A;  3P6E A;  1GM6 A;  5B29 A;  2LBA A;  3H3I A;  1HMS A;  5KID A;  3KFG A;  4AZO A;  3WOV A;  2CM9 A;  5LJH A;  4KT5 A;  3HOL A;  4ARH A;  4O49 A;  5F6Z A;  2AL0 X;  2Q4N A;  3P24 A;  4O4X A;  5HZ8 A;  3AKN A;  3FW4 A;  4IAW A;  2RD7 C;  4AW8 A;  1O8V A;  3WJG A;  4QGW A;  3NBX X;  4JGL A;  4KII A;  3APU A;  5EEE A;  4GZV A;  3U9P C;  2AT6 X;  4ZJ0 A;  5HZ9 A;  1PBO A;  4LZV A;  3DSZ A;  2Q2P A;  4IB7 A;  2W2B A;  3BSZ E;  1G74 A;  2BT9 A;  2GTL M;  1T8V A;  1QWD A;  4ZH9 A;  4IB8 A;  2JN3 A;  3C78 X;  2MHD A;  2GTL N;  4N7C A;  3UEX A;  3KFF A;  1CBR A;  1B0O A;  1CBI A;  3FIQ A;  3FR4 A;  1CBS A;  2NNE A;  4KC7 A;  3CBC A;  4MVE A;  3TGA A;  1D3S A;  1NP1 A;  5F6B A;  1ERX A;  5EED A;  1RBP A;  3BU1 A;  3CR6 A;  1LIE A;  1ZNG A;  3FR5 A;  3ZW0 B;  2FRS A;  4NP1 A;  2Q2M A;  1T0V A;  4QYP A;  3ZW1 B;  1JYD A;  5EZ2 A;  3FEP A;  2CBR A;  3CWK A;  1MX8 A;  5HA0 A;  5IO6 A;  5FEN A;  1KQW A;  2OVS A;  4OS8 A;  2AH7 X;  1ICN A;  3C76 X;  2KTD A;  4AZN A;  4TKB A;  5FQ8 E;  4XMH A;  2HYS A;  4O4S A;  1O1U A;  3CBS A;  1CRB A;  2XKL A;  1BWY A;  4MVL A;  3ZUI A;  3EBK A;  5L8O A;  3RWX A;  3S26 A;  4ZGF A;  2X45 A;  2DM5 A;  4TKH A;  3HWE A;  5H9L A;  1QY2 A;  4TLJ A;  4DQ3 A;  3FW5 A;  1TW4 A;  3TGB A;  1EQD A;  3D4R A;  4QNI A;  1IKE A;  3FA8 A;  5AEO A;  2QMI A;  2KW1 A;  1X8P A;  4YBP A;  4A8Z A;  4N7D A;  2XST A;  1ERB A;  3FEN A;  1E02 A;  2WQ9 A;  1CBQ A;  1BRQ A;  2HMB A;  3I0A A;  3IA8 A;  4KCA A;  5H9A A;  1PEE A;  2HZR A;  2RQ0 A;  5D4A A;  2OVD A;  2CZU A;  3HWD A;  3ZW2 A;  4ZHF A;  3HOE A;  4NYQ A;  4XMG A;  5AJB A;  4Y0Q A;  3PQU A;  3KFI A;  3CQN A;  4NNS A;  1HQP A;  1YWC A;  1LKE A;  5BVT A;  5HCD C;  2JW1 A;  1AB0 A;  2NNQ A;  1HBP A;  3PP6 A;  1O1V A;  1GT5 A;  3LV4 A;  3RZY A;  2OZQ A;  1YIV A;  1L6M A;  1S2P A;  1AVG I;  2Z4I A;  4YGZ A;  1EIO A;  3APW A;  1X8O A;  1EPA A;  4ORR A;  1DFV A;  1PM1 X;  1EPB A;  1P6P A;  3RBY A;  1PMP A;  5F58 A;  2AT0 X;  3HWF A;  1KT4 A;  2RCT A;  2KTS A;  4YKO A;  2JU3 A;  2JOZ A;  3NQK A;  2LFO A;  4ZHD A;  3UAQ A;  2FTB A;  4AZM A;  3O2Y A;  1U18 A;  3VG4 A;  3UEU A;  4I3C A;  2K62 A;  2ACP X;  1FEL A;  4GE1 A;  1E5P A;  3EM0 A;  2GTL O;  1SA8 A;  1SY3 A;  2G78 A;  2OVA A;  3BLG A;  5LJE A;  1ZND A;  5L8N A;  2AT3 X;  3WJB A;  1A2D A;  1ADL A;  1JV4 A;  2RA6 A;  4A1H A;  2CBS A;  2ZAI A;  4I3B A;  4YFQ A;  1BJ7 A;  2FS6 A;  2RN4 A;  3PH5 A;  3FA7 A;  1YUP A;  1Z24 A;  2K23 A;  4CK4 A;  5HTD A;  3OE3 A;  4ZHG A;  1CJ5 A;  4YH0 A;  4QQ1 A;  1HMT A;  3B2I A;  3STK A;  3NP1 A;  3ELZ A;  4YDA A;  3S5V A;  5H8T A;  3ZZV A;  1MDC A;  4HPD A;  2F09 A;  4ZCB A;  5K06 A;  2ALL X;  4L1N A;  2NND A;  3STM X;  1RLB E;  4FBV A;  1GKA A;  5D48 A;  1DZK A;  3NX1 A;  1G5W A;  3D96 A;  4XMF A;  3WJE A;  2A2G A;  4TNN A;  1OBU A;  4COT A;  1ZNL A;  2QO6 A;  4IB6 A;  1NGL A;  2WR6 A;  4WFV A;  1EAL A;  1MUP A;  1YP6 A;  3FA6 A;  3NAD A;  3PED A;  3QKG A;  4ORS A;  4LKP A;  3OJY C;  2AKQ A;  1X8U A;  4YFR A;  1BSO A;  3OD9 A;  1AQB A;  4ORW A;  1FTP A;  2R74 A;  4A60 A;  1TVQ A;  1JYJ A;  5H9K A;  4NNT A;  5EDB A;  4YKM A;  1DF3 A;  1KT5 A;  1KT7 A;  2AT8 X;  3JS1 A;  4TQ2 A;  2W2A A;  5F7G A;  4OMX A;  1BRP A;  1IIU A;  5D47 A;  3VPJ E;  1I06 A;  1QFV A;  4I9S A;  5BVQ A;  3S5X A;  4AZR A;  1OEK A;  2QO5 A;  4L3R A;  4OS3 A;  4XMC A;  4LKT A;  1MVG A;  4GNW A;  2L67 A;  1URE A;  5FAZ A;  1GT3 A;  4AYH A;  5D45 A;  4YMY A;  4U9C A;  1AEL A;  2OFR X;  3FYF A;  2CM4 A;  4Y0P A;  4ZR2 A;  3ZWE A;  4ODD A;  3TGC A;  2R56 A;  5HZQ A;  4ZH6 A;  3RKG A;  1LFO A;  3GAQ A;  3P6D A;  4GDZ A;  4HPB A;  4IMN A;  4ZHH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...