1I0XA

Ribonuclease t1 in complex with 2'gmp (form ii crystal)
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
104
structure length
104
Chain Sequence
ACDYTCGSNCYSSSDVSTAQAAGYKLHEDGETVGSNSYPHKYNNYEGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVECT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The contribution of metal ions to the conformational stability of ribonuclease T1: crystal versus solution.
pubmed doi rcsb
source organism Aspergillus oryzae
molecule tags Hydrolase
molecule keywords GUANYL-SPECIFIC RIBONUCLEASE T1
total genus 24
structure length 104
sequence length 104
chains with identical sequence B, C, D
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 2001-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1i0xA00
1RNTA 2BIRA 5BIRA 1BU4A 1HZ1A 3GSPA 1LOVA 1JBRA 1GSPA 3WHOA 3WR2A 1TRPA 4BU4A 1LNIA 1UCJA 1FUTA 2KF5A 9RNTA 1B20A 1I70A 4J5GA 1BRNL 1AY7A 1RDSA 1ZGXA 2F4YA 2F56A 1BNGA 1GOUA 4J5KA 3AHWA 1GOYA 1BAOA 1BSCA 1BSDA 1FZUA 3SYUA 1A2PA 2KF4A 1RGKA 1X1XA 1I0VA 3HOHA 3RNTA 7GSPA 1X1UA 2F5MA 3BIRA 1BGSA 1JBSA 1RSNA 1AQZA 4HAAA 1G02A 1BUJA 1TRQA 1RNBA 1B21A 1DE3A 3URPA 1BRSA 1LOYA 3Q3FA 1FW7A 1I3IA 1I2FA 3D4AA 1RGLA 1UCIA 1R4YA 1YGWA 1MGRA 1CH0A 1BVIA 3AHSA 1C54A 2F5WA 1B2SA 1BSBA 1YNVX 1I2GA 1RTUA 1UCLA 1T2IA 2ZA4A 3BU4A 1TTOA 1BRJA 2BU4A 2RBIA 1BRGA 1JBTA 1RCKA 1DETA 1RLSA 1BSEA 1HYFA 3DGYA 1FUSA 1FYSA 1UCKA 5GSPA 3AGNA 2AAEA 1BNRA 1BRIA 6RNTA 7RNTA 2GSPA 1GMRA 1X1WA 2SARA 1BSAA 1BRKA 1RN4A 4HOHA 1RGHA 1PYLA 3A5EA 2KF6A 2RNTA 1B27A 1LRAA 1MGWA 1B2UA 1SARA 1GMPA 1YVSA 4GHOA 1RGEA 1BNFA 1LOWA 4GSPA 1BOXA 1BNIA 1BRHA 4BIRA 1B2MA 1RHLA 1RCLA 3D5IA 1B2ZA 1I8VA 1Q9EA 3AGOA 6GSPA 2AADA 1I0XA 1RGFA 1GMQA 1BANA 2KAAA 1B2XA 1I2EA 1X1YA 5RNTA 1RN1A 1BIRA 1GOVA 4RNTA 2KF3A 3KCHA 1B3SA 1T2HA 5HOHA 2HOHA 1BNJA 1RGAA 2C4BA 1RMSA 1I3FA 1BNEA 3D5GA 1IYYA 1RGGA 3DH2A 1BNSA 8RNTA 1RGCA 5BU4A 1PY3A
chains in the Genus database with same CATH superfamily
4FMCA 2BMQB 2QIYA 5BIRA 2MF7A 3LT8A 2GU3A 2W04A 1PFPA 3GSPA 1JBRA 1GS3A 3V92A 3WHOA 3Q2PA 4JRFA 3ZG5A 3JUMA 9RNTA 1B20A 1SIIA 5CF2A 2RCDA 1C7HA 4J5GA 1W4NA 1A2KA 2C10A 3B4PA 2F4YA 3JVCA 4RZMA 5AYRB 1BNGA 1GOUA 1GY6A 2P09A 1DYUA 1GOYA 3T8UA 1O7WB 1TFOA 5I97A 2KF4A 3GAXA 2W56A 2UUGC 3RNTA 3HOHA 1PU4A 7GSPA 2F5MA 2P38A 3X3XA 3FZWA 3O8YA 3LMLA 1BGSA 3G0KA 4O8SA 4HYZA 1AQZA 4AKYA 5G1LA 6STDA 4N6OB 1CQSA 4R9LA 1BUQA 1WTHA 4L8PA 4FCZA 1B21A 3WODG 1RNBA 4X2OA 1BRSA 4AEQA 2Z7AA 4R1KA 3OWUA 1LQGC 4WWUC 1VQ63 4BTWA 1I3IA 1DVDA 5AIHA 1ZX2A 3F40A 3J7Yd 3I0YA 4EXRA 2PNCA 1UCIA 2HMOB 3QRDA 3SEDA 1MGRA 1CH0A 3MG2A 3AHSA 3UNLA 3NX0A 5IG3A 1B2SA 1RJOA 2ML5A 2GBWB 2BT3A 1UCLA 1STFI 2BO9B 1W00A 5KP3A 4IIAA 2E2UA 5A0OB 5IG4A 3KFQC 4XDWA 3CNXA 3K5TA 4EBGA 5IF6A 1BRJA 2K0MA 3EN8A 3NQYA 2BU4A 2RBIA 4KT3B 2XGNA 3PCSA 1BRGA 3K63A 3G4S3 3NBJA 1VQK3 3K9MC 1DETA 1RLSA 3LZAA 2ZL8A 4G1MB 1JZDA 2AAEA 3NHXA 1BRIA 3BNBA 1JN5A 1RN4A 1AVLA 1OHSA 1W7CA 3H51A 1VQ73 4HOHA 3CXC2 1PYLA 1UUGB 4FCMA 2KF6A 3HIGA 2CWTA 2V1LA 3CCM3 3CPOA 1MWUA 2BNGA 2O9UX 3BNCA 1IVXA 1GMPA 1IVWA 1YVSA 1RGEA 4GHOA 4DKIA 3NM2A 3LT9A 4HM0B 1IQXA 1ROVA 4LZIA 1TUHA 4FMBA 3A76A 5D82A 1BRHA 1US1A 4L8OA 3SOAA 1B2MA 1QJGA 5M18A 1MOLA 1RCLA 1B2ZA 1I8VA 1W2B2 3OV4A 3AGOA 3CCJ3 1I0XA 4I5QA 3LH4A 4WYKA 1M1XB 2D42A 3CCE3 3B4OA 3F9SA 2CX0A 1X1YA 2KCDA 3CC43 1TIJA 2FXTA 4HM4B 1VQ53 4MMXB 2CIUA 1FGTA 2CG1A 1B3SA 5HOHA 2IUJA 1Z1SA 1JKGB 2C4BA 1IQ8A 3TDGA 1I3FA 2P05A 2BHMA 3D5GA 4HZ9B 1RGGA 3DH2A 3ROBA 1BNSA 3BNEA 4NPBA 1SIHA 4I4KA 1FGQA 5BU4A 1RNTA 5M19A 2HMJB 2Z6BA 1QAKA 1YVBI 1M904 3NBRA 1BU4A 4H61A 3X3ZA 3H3HA 1OACA 1LOVA 1SJWA 2CWVA 3PXMA 4CCVA 1OHPA 3UL6A 4J9AA 3WR2A 2GXFA 4HKVB 1LNHA 3WOEB 1UCJA 1FUTA 4STDA 2B1XB 2XFSA 5AI1A 5CF1A 2OWPA 3G6E3 1EG9B 5IEPA 1RDSA 2Q07A 3PYJA 1S723 1QAFA 1BSCA 1IQYA 1E97A 1FZUA 2CFWA 1YGEA 3SYUA 3X41A 3CCR3 4LYLB 5IENA 1RKYA 3MG1A 3PZWA 3NM7A 3BLZA 3HX8A 1N5HA 1T3BA 1K734 5BXQA 2OTL3 2A15A 3EBTA 5IEOA 3LYGA 1G02A 1OF5B 4ORLA 1KSIA 1BUJA 1UI7A 1S5AA 1MWSA 1TRQA 1DE3A 5ELUA 3URPA 1JKGA 1LOYA 3WA2X 4CJNA 1ROAA 1UGIA 2OCTA 4LSOA 4N6NB 4RNZA 1C54A 2RGQA 1UW1A 3PGBA 2LQVA 1JNQA 3FCSB 3FSDA 3EBYA 2K54A 1FUWA 3S28A 1D6ZA 4HM3B 4HM1B 1ZO2A 3AMOA 2WGOA 1Q40B 5JBSA 3ZG0A 3CCV3 4WYKB 1W6GA 1JBTA 3X42A 1OUNA 4FMDA 1D6YA 1HYFA 3DGYA 2W2CA 2I9WA 3KIIA 3FG4A 2W03A 3AGNA 4LEHA 5GSPA 3S29A 4EW5A 1BNRA 3DY5A 3LOYA 6RNTA 4HZBB 2GSPA 1GMRA 4FMAA 3GWRA 3M8CA 2OOVC 3LTDA 3CC73 3GZYB 4MEIA 5FW5A 2XSOB 3B8LA 1RGHA 4OUQA 4AKZA 1UUVB 1HU9A 2STDA 3NV0A 3D9RA 4HM5B 1DMQA 1B27A 2O3OA 1DMNA 3D79A 2HMMB 3V98A 2RFRA 2W9QA 5EEOA 1IVVA 3RGRA 4CPKA 1Q814 3CME3 1N8QA 1Q7HA 1NDOB 2YFJB 1BNFA 1JB4A 3EE1A 1IV9A 3F8HA 4IT7A 3GZBA 4XM4A 4CDLA 1U5OA 1CEWI 1BOXA 1Q40A 3EX9A 3D3LA 3DGOA 3CMA3 5TGNA 1K41A 3EC9A 1RHLA 1VQM3 1E3VA 3D5IA 2R4IA 3X40A 2P0XA 1BANA 2CWUA 2IY2A 1VQN3 1E3RA 5G1KA 1JZOA 1B2XA 3WA3A 3FF0A 2F86B 2HMNB 8CHOA 1BIRA 1GOVA 2H0IA 1ULJB 5DRVA 1IV7A 1QALA 1RN7A 2KF3A 1W2ZA 4XBXA 3VSYA 1W5ZA 1IU7A 2ZDJA 1STDA 1LOXA 5IG0A 1GY7A 2HOHA 1RMSA 1A90A 1W6CA 1BNEA 2H0GA 1NJI4 3CCL3 1IYYA 1RGCA 2BMRB 1KWIA 1PY3A 1N5PA 3SXXA 4LGQA 1V74A 1O7PB 2FGTA 3F8XA 5LC7A 3CCU3 1QVG2 3UB1A 4K90B 3FH1A 1NB5I 2SBLA 1K9M4 1O7HB 3F7SA 1EEJA 2KF5A 4NHFA 5AIGA 2JQ5A 5AIIA 2K3DA 1A67A 1AY7A 4RBNA 3JUQA 5D81A 1WMPA 1G0TA 3AHWA 1BAOA 4R9KA 1BSDA 1CYVA 3T8NA 3I563 3S67A 3NQZA 1X1XA 1K8A4 3OW22 1X1UA 3BIRA 3DUKA 5FGOA 1RSNA 2W6JH 1NO3A 1IVUA 2J8XB 2Z76A 1DVCA 2IUKA 2OQEC 3GZXB 3KN4A 1VQ43 3EB8A 3FLJA 2F99A 1YIJ3 3HK4A 5AYSC 1VZZA 4ILFA 1VQ93 1EQKA 3LTBA 4ZM8A 1OHOA 2W9PA 4Q53A 1VQP3 4N6TA 1FW7A 4IPBA 4OVMA 3K7CA 3CPW2 1I2FA 2GBXB 3D4AA 1T5YA 2XGLA 1Y4KA 1RGLA 2WO0A 5CLKA 1R4YA 1GD4A 1VQO3 4N6MA 1J2BA 1BVIA 1EKMA 1OGZA 2M7OA 2F5WA 3FGYA 1BSBA 4N3VA 1YNVX 5EVHA 3SOYA 1KD14 1I2GA 1AR0A 1UUWB 2ZA4A 3G16A 1T2IA 4BL2A 3BU4A 1W01A 1TTOA 3MYTA 4KVHA 4HM2B 5IW9A 1QVF2 1RRLA 1WNHA 3OX9A 1U8CB 4O2HA 1UDII 1JB2A 2WOFA 3AMOB 1FYSA 2Z77A 4QWTA 4EV2A 3FKAA 4XBTA 1NWWA 4BTXA 4NREA 4GL6A 1BRKA 1TFKA 4MJDA 3A5EA 3NV0B 4GB5A 2RNTA 3MWZA 5KP4A 4L7KA 1JN5B 2W0QA 2CX1A 1N8R4 1O7NB 1JV2B 5KP1A 3SX1A 1JJ22 1L5GB 1LOWA 2QEX3 2CH9A 1N9EA 2CK3H 1N9JA 3N9HA 1EUIC 1ISKA 1BNIA 3RGAA 1Q824 4BIRA 2CHCA 3JUOA 2IA7A 4MMYB 5HGRA 3ZFZA 4WHAA 1Q9EA 2CFLA 6GSPA 1RGFA 4OK0A 5CK6A 1AV4A 1GMQA 3IJEB 2Y73A 3JUPA 4RNYA 3KKGA 5BVBA 1SPUA 4R4KA 3U97A 4HM8B 2RSXA 1TU5A 1YIT3 1I2EA 1GD3A 2QGUA 3V99A 3VF1A 3CCQ3 3U1WA 3OXAA 1IK3A 3ALAA 2INXA 3G8ZA 1KQS2 1QMAA 3S27A 4BL3A 1Q7Y4 2OOVA 2Y74A 3E99A 3DGMA 3HIIA 3BNDA 1KC84 2XEPA 2IMJA 1OF5A 4HJLB 1VQL3 5ELJA 3SVAA 1SQWA 1V58A 2LYXA 2XR8B 3B7CA 3LTAA 3PCRA 1VQQA 3N8BA 7STDA 1O7GB 2XH9A 2BIRA 2XFTA 3ER7A 3UJMA 3KSPA 2GEYA 5IERA 4EV5A 3MKIA 1HZ1A 4KZ1A 1NU3A 1GSPA 2BMOB 1Q864 4JF8A 3KZTA 3CU3A 1HKXA 3SLUA 1TRPA 4BU4A 1M1K4 1LNIA 3OWSA 1R4CA 3NBBA 1UGHI 3CNMA 1LVNA 3MSOA 1I70A 2QA43 1OCVA 3I553 1ZGXA 2F56A 5M1AA 4J5KA 4XDVA 1A2PA 1TP6A 1D6UA 1G96A 3NUVA 4KFDA 5AIFA 1F8NA 1RGKA 1I0VA 2L1SA 2IYJA 1WMOA 1IT8A 1GYBA 1JBSA 3DM8A 5JPUA 3S5CA 1IDPA 4HAAA 4MMZB 1K28A 4FCJA 4XB5A 3EJVA 4HM6B 5IG5A 1YHQ3 1YJN3 2UGIA 2L4VA 3MG3A 5G2GA 2CC3A 3DZLA 1OGXA 1V57A 3Q3FA 4FR9A 1FA3A 1A2VA 5STDA 4EYCA 1JRQA 3FG1A 5JPPA 3FF2A 1W6YA 2KXGA 4HM7B 2XSHB 4H3UA 4K1UA 3DMCA 2GU1A 2KRTA 3N54B 4K1VA 2HMLB 1YI23 2H0HA 1YGWA 4R80A 3VGNA 5AEUB 4N6UA 1M9GA 1EA2A 3G713 2CW9A 3CD63 3STDA 4LMIA 1RTUA 1W02A 1WQLB 1LXEA 1Q42A 4XBYA 1FGRA 4J8TA 3WOFB 1JB5A 2CKFB 2C11A 1MWRA 1FGMA 1ZS7A 2YFIB 2JDIH 1ULIB 1RRHA 2MC8A 2OTJ3 1RCKA 1BSEA 2WOHA 3CC23 1FUSA 3NXJA 1UCKA 1MWTA 1FGOA 1DMMA 3RDEA 4K61A 1IT7A 3KSED 5LC6A 4PEJA 2ZHXB 7RNTA 3F14A 4HVNA 1X1WA 2R41A 2SARA 2XF3A 4BTYA 1BSAA 2OQEA 1TJDA 3T0UA 2ML6A 1NNVA 2XRXB 3JUNA 3F7XA 1LRAA 2E2TA 2YFLB 1MGWA 2P0MA 3L0RA 1B2UA 2UX0A 4HBRA 2B24B 1SARA 3WDGB 3BB9A 4N6V0 4U13A 3QK9A 2HMKB 4WP5A 3EHCA 4WFOA 4GSPA 5D83A 1LQMB 1YJ93 4X2HA 4KFEA 3EQQB 2WGQA 3GZRA 4N6LA 4O3VA 4KFFA 1ASKA 4TX4A 1YJW3 2YX9A 3EF8A 1OPYA 3WMDA 3UL5A 1O7MB 1UI8A 3CCS3 3Q90A 3K0ZA 2CFDA 3DGLA 3IPTA 2AADA 2D1WA 3DXOA 2FNQA 2W56B 3MHEA 2PZVA 5CXOA 2KAAA 3PS8A 1VQ83 4EC6A 2CFGA 3Q1CA 5RNTA 1RN1A 2CG0A 5EQLA 4RNTA 3EN1B 3GRDA 1CYUA 5AEWB 1AVKA 3HI7A 3KCHA 5DREA 3OWYA 4O02B 3LXUX 2CFKA 2GEXA 3KE7A 1T2HA 3DGNA 1MNLA 2E2VA 1BNJA 1RGAA 2F98A 1GY5A 3LTCA 1NB3I 1WMNA 3HZPA 1OH0A 3FG3A 3ECFA 3MPHA 3X3YA 8RNTA 3IMAB 1BRNL
chains in the Genus database with same CATH topology
1RNTA 2BIRA 5BIRA 1BU4A 1HZ1A 3GSPA 1LOVA 1JBRA 1GSPA 3WHOA 3WR2A 1TRPA 4BU4A 1LNIA 1UCJA 1FUTA 2KF5A 9RNTA 1B20A 1I70A 4J5GA 1BRNL 1AY7A 1RDSA 1ZGXA 2F4YA 2F56A 1BNGA 1GOUA 4J5KA 3AHWA 1GOYA 1BAOA 1BSCA 1BSDA 1FZUA 3SYUA 1A2PA 2KF4A 1RGKA 1X1XA 1I0VA 3HOHA 3RNTA 7GSPA 1X1UA 2F5MA 3BIRA 1BGSA 1JBSA 1RSNA 1AQZA 4HAAA 1G02A 1BUJA 1TRQA 1RNBA 1B21A 1DE3A 3URPA 1BRSA 1LOYA 3Q3FA 1FW7A 1I3IA 1I2FA 3D4AA 1RGLA 1UCIA 1R4YA 1YGWA 1MGRA 1CH0A 1BVIA 3AHSA 1C54A 2F5WA 1B2SA 1BSBA 1YNVX 1I2GA 1RTUA 1UCLA 1T2IA 2ZA4A 3BU4A 1TTOA 1BRJA 2BU4A 2RBIA 1BRGA 1JBTA 1RCKA 1DETA 1RLSA 1BSEA 1HYFA 3DGYA 1FUSA 1FYSA 1UCKA 5GSPA 3AGNA 2AAEA 1BNRA 1BRIA 6RNTA 7RNTA 2GSPA 1GMRA 1X1WA 2SARA 1BSAA 1BRKA 1RN4A 4HOHA 1RGHA 1PYLA 3A5EA 2KF6A 2RNTA 1B27A 1LRAA 1MGWA 1B2UA 1SARA 1GMPA 1YVSA 4GHOA 1RGEA 1BNFA 1LOWA 4GSPA 1BOXA 1BNIA 1BRHA 4BIRA 1B2MA 1RHLA 1RCLA 3D5IA 1B2ZA 1I8VA 1Q9EA 3AGOA 6GSPA 2AADA 1I0XA 1RGFA 1GMQA 1BANA 2KAAA 1B2XA 1I2EA 1X1YA 5RNTA 1RN1A 1BIRA 1GOVA 4RNTA 2KF3A 3KCHA 1B3SA 1T2HA 5HOHA 2HOHA 1BNJA 1RGAA 2C4BA 1RMSA 1I3FA 1BNEA 3D5GA 1IYYA 1RGGA 3DH2A 1BNSA 8RNTA 1RGCA 5BU4A 1PY3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RNT A;  2BIR A;  5BIR A;  1BU4 A;  1HZ1 A;  3GSP A;  1LOV A;  1JBR A;  1GSP A;  3WHO A;  3WR2 A;  1TRP A;  4BU4 A;  1LNI A;  1UCJ A;  1FUT A;  2KF5 A;  9RNT A;  1B20 A;  1I70 A;  4J5G A;  1BRN L;  1AY7 A;  1RDS A;  1ZGX A;  2F4Y A;  2F56 A;  1BNG A;  1GOU A;  4J5K A;  3AHW A;  1GOY A;  1BAO A;  1BSC A;  1BSD A;  1FZU A;  3SYU A;  1A2P A;  2KF4 A;  1RGK A;  1X1X A;  1I0V A;  3HOH A;  3RNT A;  7GSP A;  1X1U A;  2F5M A;  3BIR A;  1BGS A;  1JBS A;  1RSN A;  1AQZ A;  4HAA A;  1G02 A;  1BUJ A;  1TRQ A;  1RNB A;  1B21 A;  1DE3 A;  3URP A;  1BRS A;  1LOY A;  3Q3F A;  1FW7 A;  1I3I A;  1I2F A;  3D4A A;  1RGL A;  1UCI A;  1R4Y A;  1YGW A;  1MGR A;  1CH0 A;  1BVI A;  3AHS A;  1C54 A;  2F5W A;  1B2S A;  1BSB A;  1YNV X;  1I2G A;  1RTU A;  1UCL A;  1T2I A;  2ZA4 A;  3BU4 A;  1TTO A;  1BRJ A;  2BU4 A;  2RBI A;  1BRG A;  1JBT A;  1RCK A;  1DET A;  1RLS A;  1BSE A;  1HYF A;  3DGY A;  1FUS A;  1FYS A;  1UCK A;  5GSP A;  3AGN A;  2AAE A;  1BNR A;  1BRI A;  6RNT A;  7RNT A;  2GSP A;  1GMR A;  1X1W A;  2SAR A;  1BSA A;  1BRK A;  1RN4 A;  4HOH A;  1RGH A;  1PYL A;  3A5E A;  2KF6 A;  2RNT A;  1B27 A;  1LRA A;  1MGW A;  1B2U A;  1SAR A;  1GMP A;  1YVS A;  4GHO A;  1RGE A;  1BNF A;  1LOW A;  4GSP A;  1BOX A;  1BNI A;  1BRH A;  4BIR A;  1B2M A;  1RHL A;  1RCL A;  3D5I A;  1B2Z A;  1I8V A;  1Q9E A;  3AGO A;  6GSP A;  2AAD A;  1I0X A;  1RGF A;  1GMQ A;  1BAN A;  2KAA A;  1B2X A;  1I2E A;  1X1Y A;  5RNT A;  1RN1 A;  1BIR A;  1GOV A;  4RNT A;  2KF3 A;  3KCH A;  1B3S A;  1T2H A;  5HOH A;  2HOH A;  1BNJ A;  1RGA A;  2C4B A;  1RMS A;  1I3F A;  1BNE A;  3D5G A;  1IYY A;  1RGG A;  3DH2 A;  1BNS A;  8RNT A;  1RGC A;  5BU4 A;  1PY3 A; 
#chains in the Genus database with same CATH topology
 4FMC A;  2BMQ B;  2QIY A;  5BIR A;  2MF7 A;  3LT8 A;  2GU3 A;  2W04 A;  1PFP A;  3GSP A;  1JBR A;  1GS3 A;  3V92 A;  3WHO A;  3Q2P A;  4JRF A;  3ZG5 A;  3JUM A;  9RNT A;  1B20 A;  1SII A;  5CF2 A;  2RCD A;  1C7H A;  4J5G A;  1W4N A;  1A2K A;  2C10 A;  3B4P A;  2F4Y A;  3JVC A;  4RZM A;  5AYR B;  1BNG A;  1GOU A;  1GY6 A;  2P09 A;  1DYU A;  1GOY A;  3T8U A;  1O7W B;  1TFO A;  5I97 A;  2KF4 A;  3GAX A;  2W56 A;  2UUG C;  3RNT A;  3HOH A;  1PU4 A;  7GSP A;  2F5M A;  2P38 A;  3X3X A;  3FZW A;  3O8Y A;  3LML A;  1BGS A;  3G0K A;  4O8S A;  4HYZ A;  1AQZ A;  4AKY A;  5G1L A;  6STD A;  4N6O B;  1CQS A;  4R9L A;  1BUQ A;  1WTH A;  4L8P A;  4FCZ A;  1B21 A;  3WOD G;  1RNB A;  4X2O A;  1BRS A;  4AEQ A;  2Z7A A;  4R1K A;  3OWU A;  1LQG C;  4WWU C;  1VQ6 3;  4BTW A;  1I3I A;  1DVD A;  5AIH A;  1ZX2 A;  3F40 A;  3J7Y d;  3I0Y A;  4EXR A;  2PNC A;  1UCI A;  2HMO B;  3QRD A;  3SED A;  1MGR A;  1CH0 A;  3MG2 A;  3AHS A;  3UNL A;  3NX0 A;  5IG3 A;  1B2S A;  1RJO A;  2ML5 A;  2GBW B;  2BT3 A;  1UCL A;  1STF I;  2BO9 B;  1W00 A;  5KP3 A;  4IIA A;  2E2U A;  5A0O B;  5IG4 A;  3KFQ C;  4XDW A;  3CNX A;  3K5T A;  4EBG A;  5IF6 A;  1BRJ A;  2K0M A;  3EN8 A;  3NQY A;  2BU4 A;  2RBI A;  4KT3 B;  2XGN A;  3PCS A;  1BRG A;  3K63 A;  3G4S 3;  3NBJ A;  1VQK 3;  3K9M C;  1DET A;  1RLS A;  3LZA A;  2ZL8 A;  4G1M B;  1JZD A;  2AAE A;  3NHX A;  1BRI A;  3BNB A;  1JN5 A;  1RN4 A;  1AVL A;  1OHS A;  1W7C A;  3H51 A;  1VQ7 3;  4HOH A;  3CXC 2;  1PYL A;  1UUG B;  4FCM A;  2KF6 A;  3HIG A;  2CWT A;  2V1L A;  3CCM 3;  3CPO A;  1MWU A;  2BNG A;  2O9U X;  3BNC A;  1IVX A;  1GMP A;  1IVW A;  1YVS A;  1RGE A;  4GHO A;  4DKI A;  3NM2 A;  3LT9 A;  4HM0 B;  1IQX A;  1ROV A;  4LZI A;  1TUH A;  4FMB A;  3A76 A;  5D82 A;  1BRH A;  1US1 A;  4L8O A;  3SOA A;  1B2M A;  1QJG A;  5M18 A;  1MOL A;  1RCL A;  1B2Z A;  1I8V A;  1W2B 2;  3OV4 A;  3AGO A;  3CCJ 3;  1I0X A;  4I5Q A;  3LH4 A;  4WYK A;  1M1X B;  2D42 A;  3CCE 3;  3B4O A;  3F9S A;  2CX0 A;  1X1Y A;  2KCD A;  3CC4 3;  1TIJ A;  2FXT A;  4HM4 B;  1VQ5 3;  4MMX B;  2CIU A;  1FGT A;  2CG1 A;  1B3S A;  5HOH A;  2IUJ A;  1Z1S A;  1JKG B;  2C4B A;  1IQ8 A;  3TDG A;  1I3F A;  2P05 A;  2BHM A;  3D5G A;  4HZ9 B;  1RGG A;  3DH2 A;  3ROB A;  1BNS A;  3BNE A;  4NPB A;  1SIH A;  4I4K A;  1FGQ A;  5BU4 A;  1RNT A;  5M19 A;  2HMJ B;  2Z6B A;  1QAK A;  1YVB I;  1M90 4;  3NBR A;  1BU4 A;  4H61 A;  3X3Z A;  3H3H A;  1OAC A;  1LOV A;  1SJW A;  2CWV A;  3PXM A;  4CCV A;  1OHP A;  3UL6 A;  4J9A A;  3WR2 A;  2GXF A;  4HKV B;  1LNH A;  3WOE B;  1UCJ A;  1FUT A;  4STD A;  2B1X B;  2XFS A;  5AI1 A;  5CF1 A;  2OWP A;  3G6E 3;  1EG9 B;  5IEP A;  1RDS A;  2Q07 A;  3PYJ A;  1S72 3;  1QAF A;  1BSC A;  1IQY A;  1E97 A;  1FZU A;  2CFW A;  1YGE A;  3SYU A;  3X41 A;  3CCR 3;  4LYL B;  5IEN A;  1RKY A;  3MG1 A;  3PZW A;  3NM7 A;  3BLZ A;  3HX8 A;  1N5H A;  1T3B A;  1K73 4;  5BXQ A;  2OTL 3;  2A15 A;  3EBT A;  5IEO A;  3LYG A;  1G02 A;  1OF5 B;  4ORL A;  1KSI A;  1BUJ A;  1UI7 A;  1S5A A;  1MWS A;  1TRQ A;  1DE3 A;  5ELU A;  3URP A;  1JKG A;  1LOY A;  3WA2 X;  4CJN A;  1ROA A;  1UGI A;  2OCT A;  4LSO A;  4N6N B;  4RNZ A;  1C54 A;  2RGQ A;  1UW1 A;  3PGB A;  2LQV A;  1JNQ A;  3FCS B;  3FSD A;  3EBY A;  2K54 A;  1FUW A;  3S28 A;  1D6Z A;  4HM3 B;  4HM1 B;  1ZO2 A;  3AMO A;  2WGO A;  1Q40 B;  5JBS A;  3ZG0 A;  3CCV 3;  4WYK B;  1W6G A;  1JBT A;  3X42 A;  1OUN A;  4FMD A;  1D6Y A;  1HYF A;  3DGY A;  2W2C A;  2I9W A;  3KII A;  3FG4 A;  2W03 A;  3AGN A;  4LEH A;  5GSP A;  3S29 A;  4EW5 A;  1BNR A;  3DY5 A;  3LOY A;  6RNT A;  4HZB B;  2GSP A;  1GMR A;  4FMA A;  3GWR A;  3M8C A;  2OOV C;  3LTD A;  3CC7 3;  3GZY B;  4MEI A;  5FW5 A;  2XSO B;  3B8L A;  1RGH A;  4OUQ A;  4AKZ A;  1UUV B;  1HU9 A;  2STD A;  3NV0 A;  3D9R A;  4HM5 B;  1DMQ A;  1B27 A;  2O3O A;  1DMN A;  3D79 A;  2HMM B;  3V98 A;  2RFR A;  2W9Q A;  5EEO A;  1IVV A;  3RGR A;  4CPK A;  1Q81 4;  3CME 3;  1N8Q A;  1Q7H A;  1NDO B;  2YFJ B;  1BNF A;  1JB4 A;  3EE1 A;  1IV9 A;  3F8H A;  4IT7 A;  3GZB A;  4XM4 A;  4CDL A;  1U5O A;  1CEW I;  1BOX A;  1Q40 A;  3EX9 A;  3D3L A;  3DGO A;  3CMA 3;  5TGN A;  1K41 A;  3EC9 A;  1RHL A;  1VQM 3;  1E3V A;  3D5I A;  2R4I A;  3X40 A;  2P0X A;  1BAN A;  2CWU A;  2IY2 A;  1VQN 3;  1E3R A;  5G1K A;  1JZO A;  1B2X A;  3WA3 A;  3FF0 A;  2F86 B;  2HMN B;  8CHO A;  1BIR A;  1GOV A;  2H0I A;  1ULJ B;  5DRV A;  1IV7 A;  1QAL A;  1RN7 A;  2KF3 A;  1W2Z A;  4XBX A;  3VSY A;  1W5Z A;  1IU7 A;  2ZDJ A;  1STD A;  1LOX A;  5IG0 A;  1GY7 A;  2HOH A;  1RMS A;  1A90 A;  1W6C A;  1BNE A;  2H0G A;  1NJI 4;  3CCL 3;  1IYY A;  1RGC A;  2BMR B;  1KWI A;  1PY3 A;  1N5P A;  3SXX A;  4LGQ A;  1V74 A;  1O7P B;  2FGT A;  3F8X A;  5LC7 A;  3CCU 3;  1QVG 2;  3UB1 A;  4K90 B;  3FH1 A;  1NB5 I;  2SBL A;  1K9M 4;  1O7H B;  3F7S A;  1EEJ A;  2KF5 A;  4NHF A;  5AIG A;  2JQ5 A;  5AII A;  2K3D A;  1A67 A;  1AY7 A;  4RBN A;  3JUQ A;  5D81 A;  1WMP A;  1G0T A;  3AHW A;  1BAO A;  4R9K A;  1BSD A;  1CYV A;  3T8N A;  3I56 3;  3S67 A;  3NQZ A;  1X1X A;  1K8A 4;  3OW2 2;  1X1U A;  3BIR A;  3DUK A;  5FGO A;  1RSN A;  2W6J H;  1NO3 A;  1IVU A;  2J8X B;  2Z76 A;  1DVC A;  2IUK A;  2OQE C;  3GZX B;  3KN4 A;  1VQ4 3;  3EB8 A;  3FLJ A;  2F99 A;  1YIJ 3;  3HK4 A;  5AYS C;  1VZZ A;  4ILF A;  1VQ9 3;  1EQK A;  3LTB A;  4ZM8 A;  1OHO A;  2W9P A;  4Q53 A;  1VQP 3;  4N6T A;  1FW7 A;  4IPB A;  4OVM A;  3K7C A;  3CPW 2;  1I2F A;  2GBX B;  3D4A A;  1T5Y A;  2XGL A;  1Y4K A;  1RGL A;  2WO0 A;  5CLK A;  1R4Y A;  1GD4 A;  1VQO 3;  4N6M A;  1J2B A;  1BVI A;  1EKM A;  1OGZ A;  2M7O A;  2F5W A;  3FGY A;  1BSB A;  4N3V A;  1YNV X;  5EVH A;  3SOY A;  1KD1 4;  1I2G A;  1AR0 A;  1UUW B;  2ZA4 A;  3G16 A;  1T2I A;  4BL2 A;  3BU4 A;  1W01 A;  1TTO A;  3MYT A;  4KVH A;  4HM2 B;  5IW9 A;  1QVF 2;  1RRL A;  1WNH A;  3OX9 A;  1U8C B;  4O2H A;  1UDI I;  1JB2 A;  2WOF A;  3AMO B;  1FYS A;  2Z77 A;  4QWT A;  4EV2 A;  3FKA A;  4XBT A;  1NWW A;  4BTX A;  4NRE A;  4GL6 A;  1BRK A;  1TFK A;  4MJD A;  3A5E A;  3NV0 B;  4GB5 A;  2RNT A;  3MWZ A;  5KP4 A;  4L7K A;  1JN5 B;  2W0Q A;  2CX1 A;  1N8R 4;  1O7N B;  1JV2 B;  5KP1 A;  3SX1 A;  1JJ2 2;  1L5G B;  1LOW A;  2QEX 3;  2CH9 A;  1N9E A;  2CK3 H;  1N9J A;  3N9H A;  1EUI C;  1ISK A;  1BNI A;  3RGA A;  1Q82 4;  4BIR A;  2CHC A;  3JUO A;  2IA7 A;  4MMY B;  5HGR A;  3ZFZ A;  4WHA A;  1Q9E A;  2CFL A;  6GSP A;  1RGF A;  4OK0 A;  5CK6 A;  1AV4 A;  1GMQ A;  3IJE B;  2Y73 A;  3JUP A;  4RNY A;  3KKG A;  5BVB A;  1SPU A;  4R4K A;  3U97 A;  4HM8 B;  2RSX A;  1TU5 A;  1YIT 3;  1I2E A;  1GD3 A;  2QGU A;  3V99 A;  3VF1 A;  3CCQ 3;  3U1W A;  3OXA A;  1IK3 A;  3ALA A;  2INX A;  3G8Z A;  1KQS 2;  1QMA A;  3S27 A;  4BL3 A;  1Q7Y 4;  2OOV A;  2Y74 A;  3E99 A;  3DGM A;  3HII A;  3BND A;  1KC8 4;  2XEP A;  2IMJ A;  1OF5 A;  4HJL B;  1VQL 3;  5ELJ A;  3SVA A;  1SQW A;  1V58 A;  2LYX A;  2XR8 B;  3B7C A;  3LTA A;  3PCR A;  1VQQ A;  3N8B A;  7STD A;  1O7G B;  2XH9 A;  2BIR A;  2XFT A;  3ER7 A;  3UJM A;  3KSP A;  2GEY A;  5IER A;  4EV5 A;  3MKI A;  1HZ1 A;  4KZ1 A;  1NU3 A;  1GSP A;  2BMO B;  1Q86 4;  4JF8 A;  3KZT A;  3CU3 A;  1HKX A;  3SLU A;  1TRP A;  4BU4 A;  1M1K 4;  1LNI A;  3OWS A;  1R4C A;  3NBB A;  1UGH I;  3CNM A;  1LVN A;  3MSO A;  1I70 A;  2QA4 3;  1OCV A;  3I55 3;  1ZGX A;  2F56 A;  5M1A A;  4J5K A;  4XDV A;  1A2P A;  1TP6 A;  1D6U A;  1G96 A;  3NUV A;  4KFD A;  5AIF A;  1F8N A;  1RGK A;  1I0V A;  2L1S A;  2IYJ A;  1WMO A;  1IT8 A;  1GYB A;  1JBS A;  3DM8 A;  5JPU A;  3S5C A;  1IDP A;  4HAA A;  4MMZ B;  1K28 A;  4FCJ A;  4XB5 A;  3EJV A;  4HM6 B;  5IG5 A;  1YHQ 3;  1YJN 3;  2UGI A;  2L4V A;  3MG3 A;  5G2G A;  2CC3 A;  3DZL A;  1OGX A;  1V57 A;  3Q3F A;  4FR9 A;  1FA3 A;  1A2V A;  5STD A;  4EYC A;  1JRQ A;  3FG1 A;  5JPP A;  3FF2 A;  1W6Y A;  2KXG A;  4HM7 B;  2XSH B;  4H3U A;  4K1U A;  3DMC A;  2GU1 A;  2KRT A;  3N54 B;  4K1V A;  2HML B;  1YI2 3;  2H0H A;  1YGW A;  4R80 A;  3VGN A;  5AEU B;  4N6U A;  1M9G A;  1EA2 A;  3G71 3;  2CW9 A;  3CD6 3;  3STD A;  4LMI A;  1RTU A;  1W02 A;  1WQL B;  1LXE A;  1Q42 A;  4XBY A;  1FGR A;  4J8T A;  3WOF B;  1JB5 A;  2CKF B;  2C11 A;  1MWR A;  1FGM A;  1ZS7 A;  2YFI B;  2JDI H;  1ULI B;  1RRH A;  2MC8 A;  2OTJ 3;  1RCK A;  1BSE A;  2WOH A;  3CC2 3;  1FUS A;  3NXJ A;  1UCK A;  1MWT A;  1FGO A;  1DMM A;  3RDE A;  4K61 A;  1IT7 A;  3KSE D;  5LC6 A;  4PEJ A;  2ZHX B;  7RNT A;  3F14 A;  4HVN A;  1X1W A;  2R41 A;  2SAR A;  2XF3 A;  4BTY A;  1BSA A;  2OQE A;  1TJD A;  3T0U A;  2ML6 A;  1NNV A;  2XRX B;  3JUN A;  3F7X A;  1LRA A;  2E2T A;  2YFL B;  1MGW A;  2P0M A;  3L0R A;  1B2U A;  2UX0 A;  4HBR A;  2B24 B;  1SAR A;  3WDG B;  3BB9 A;  4N6V 0;  4U13 A;  3QK9 A;  2HMK B;  4WP5 A;  3EHC A;  4WFO A;  4GSP A;  5D83 A;  1LQM B;  1YJ9 3;  4X2H A;  4KFE A;  3EQQ B;  2WGQ A;  3GZR A;  4N6L A;  4O3V A;  4KFF A;  1ASK A;  4TX4 A;  1YJW 3;  2YX9 A;  3EF8 A;  1OPY A;  3WMD A;  3UL5 A;  1O7M B;  1UI8 A;  3CCS 3;  3Q90 A;  3K0Z A;  2CFD A;  3DGL A;  3IPT A;  2AAD A;  2D1W A;  3DXO A;  2FNQ A;  2W56 B;  3MHE A;  2PZV A;  5CXO A;  2KAA A;  3PS8 A;  1VQ8 3;  4EC6 A;  2CFG A;  3Q1C A;  5RNT A;  1RN1 A;  2CG0 A;  5EQL A;  4RNT A;  3EN1 B;  3GRD A;  1CYU A;  5AEW B;  1AVK A;  3HI7 A;  3KCH A;  5DRE A;  3OWY A;  4O02 B;  3LXU X;  2CFK A;  2GEX A;  3KE7 A;  1T2H A;  3DGN A;  1MNL A;  2E2V A;  1BNJ A;  1RGA A;  2F98 A;  1GY5 A;  3LTC A;  1NB3 I;  1WMN A;  3HZP A;  1OH0 A;  3FG3 A;  3ECF A;  3MPH A;  3X3Y A;  8RNT A;  3IMA B;  1BRN L; 
#chains in the Genus database with same CATH homology
 1RNT A;  2BIR A;  5BIR A;  1BU4 A;  1HZ1 A;  3GSP A;  1LOV A;  1JBR A;  1GSP A;  3WHO A;  3WR2 A;  1TRP A;  4BU4 A;  1LNI A;  1UCJ A;  1FUT A;  2KF5 A;  9RNT A;  1B20 A;  1I70 A;  4J5G A;  1BRN L;  1AY7 A;  1RDS A;  1ZGX A;  2F4Y A;  2F56 A;  1BNG A;  1GOU A;  4J5K A;  3AHW A;  1GOY A;  1BAO A;  1BSC A;  1BSD A;  1FZU A;  3SYU A;  1A2P A;  2KF4 A;  1RGK A;  1X1X A;  1I0V A;  3HOH A;  3RNT A;  7GSP A;  1X1U A;  2F5M A;  3BIR A;  1BGS A;  1JBS A;  1RSN A;  1AQZ A;  4HAA A;  1G02 A;  1BUJ A;  1TRQ A;  1RNB A;  1B21 A;  1DE3 A;  3URP A;  1BRS A;  1LOY A;  3Q3F A;  1FW7 A;  1I3I A;  1I2F A;  3D4A A;  1RGL A;  1UCI A;  1R4Y A;  1YGW A;  1MGR A;  1CH0 A;  1BVI A;  3AHS A;  1C54 A;  2F5W A;  1B2S A;  1BSB A;  1YNV X;  1I2G A;  1RTU A;  1UCL A;  1T2I A;  2ZA4 A;  3BU4 A;  1TTO A;  1BRJ A;  2BU4 A;  2RBI A;  1BRG A;  1JBT A;  1RCK A;  1DET A;  1RLS A;  1BSE A;  1HYF A;  3DGY A;  1FUS A;  1FYS A;  1UCK A;  5GSP A;  3AGN A;  2AAE A;  1BNR A;  1BRI A;  6RNT A;  7RNT A;  2GSP A;  1GMR A;  1X1W A;  2SAR A;  1BSA A;  1BRK A;  1RN4 A;  4HOH A;  1RGH A;  1PYL A;  3A5E A;  2KF6 A;  2RNT A;  1B27 A;  1LRA A;  1MGW A;  1B2U A;  1SAR A;  1GMP A;  1YVS A;  4GHO A;  1RGE A;  1BNF A;  1LOW A;  4GSP A;  1BOX A;  1BNI A;  1BRH A;  4BIR A;  1B2M A;  1RHL A;  1RCL A;  3D5I A;  1B2Z A;  1I8V A;  1Q9E A;  3AGO A;  6GSP A;  2AAD A;  1I0X A;  1RGF A;  1GMQ A;  1BAN A;  2KAA A;  1B2X A;  1I2E A;  1X1Y A;  5RNT A;  1RN1 A;  1BIR A;  1GOV A;  4RNT A;  2KF3 A;  3KCH A;  1B3S A;  1T2H A;  5HOH A;  2HOH A;  1BNJ A;  1RGA A;  2C4B A;  1RMS A;  1I3F A;  1BNE A;  3D5G A;  1IYY A;  1RGG A;  3DH2 A;  1BNS A;  8RNT A;  1RGC A;  5BU4 A;  1PY3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...