1I1AB

Crystal structure of the neonatal fc receptor complexed with a heterodimeric fc
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
99
structure length
99
Chain Sequence
IQKTPQIQVYSRHPPENGKPNFLNCYVSQFHPPQIEIELLKNGKKIPNIEMSDLSFSKDWSFYILAHTEFTPTETDVYACRVKHVTLKEPKTVTWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure at 2.8 A of an FcRn/heterodimeric Fc complex: mechanism of pH-dependent binding.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Immune system
molecule keywords NEONATAL FC RECEPTOR A
total genus 13
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2001-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1i1aB00
2XN9E 1FCCA 5DMKB 4JLRB 1OPGL 4HBCH 3SE4C 2VDNL 4KPHH 3EO0B 3OKNA 1SYVA 32C2A 5EZJB 5KSBA 4U1KA 3ARYA 2XTLA 4M6MH 3MRCB 4R2GC 4UUJA 3O11A 4WW2F 5GJSH 5LQBL 3GSVA 3KYOB 1U8IB 1GZPB 3O3AA 1MCPL 4GT7A 3SJVA 1MQ8A 3U30C 1AFVH 1J05B 5HYIA 1YNTA 5DRXB 4X6BB 5E6ZA 1S8DB 1QP1A 5DLMH 5TE4H 3A6CL 3JWDC 4L3EB 2R2HB 4G6FD 1A6PA 1RUPH 1PY9A 2P5WA 3TZVA 1JPST 4NBXB 3W9DB 3UXFA 4TNWF 3JVGC 3HR6A 4LKCB 1E4WH 5GISH 3KPRA 5DJ2B 4JM4H 4MJ4A 4PB9L 5ID0B 2VLKA 1RZ8A 2GK0A 3L7FB 1AQKH 4XTRD 5C0BB 4ERSH 1JZ8A 4JQVA 2ICEA 1AHWC 2EC9U 3RVXC 3HI5H 1ZT7A 2B4CL 2I24N 3VCLA 3EJJX 4J23A 2X4RB 5KOVC 1EAJA 4KKLD 4JPIA 3B2VL 4NWTL 1BPVA 4WWKB 5E2TL 3TA3A 3O3EB 3WXVH 3ULVD 4GG6F 1RK1B 3L3KA 1DN0B 1H0DB 4E42B 2RFXB 1AJ7H 1Z9MA 4Y16B 2A6IA 2VJXA 4L4VA 4TYUA 3MA7B 4OLZL 3Q3GA 4U6TA 2BNQB 5C08A 4UU9A 1SM3L 2JTDA 4OLXL 1KXVC 4XMLH 3U7YL 1IC5H 2WBWB 3JTTB 1CF8L 2JJSA 4Z7VA 4XX1E 1OW0A 3CSGA 4OLWH 3ULUC 1PX3A 2W0PA 4KJWD 1RJZA 1CWVA 2PYFA 1TCRA 1U8OA 3C8KB 3K2UH 4G6AC 1R6VA 5FHAH 4MB3A 1E4KC 1D5MA 3ESVF 2Y1VA 3B9AA 1S5IL 4Q7DA 5HHMD 3VGHA 3FHQA 4QRTA 3QO0A 2D0FA 3VDAA 2EDJA 3O8XB 1CFVH 5IB5B 1CR9L 2B7DT 4QXTA 3DVNB 3MRLA 4KJPD 4CU6A 1W0VA 2A9NL 1JYXA 4PREB 3FFCA 1H15B 3MYJB 1GGTA 3ME0A 4E41B 4CVXA 3V5KB 1KGCD 1IMHC 3BVNB 2X4RA 3UJIH 3PE9A 4NSKB 1NCWL 3VXUD 1NEZG 1N8ZB 5C71A 1RVFH 3UZQA 4PTTB 2YSSB 1CICB 1K2DB 1MCLA 2OS7A 4DZ8B 1F3DJ 4KRPB 2YPKA 1S7WB 3VFUA 5F7EL 2APXA 4R2GB 3R1GL 2IAMA 3JWOH 4UAOC 2J12B 2IQAB 3H3PH 1HCVA 3IFOA 3LRGA 2EIDA 3V0WL 1RJYB 4XPAH 5TFSH 4F7MB 4G9FA 2UWEA 5T1MB 1W72B 2VIRB 5C9JA 4LCUA 1OAZL 4LFHG 3I6GA 1H8OA 3QEUA 1EO7A 5EUOE 1NL0L 3BKYH 1RULH 4LU5H 2LTQB 2IADA 3U9PH 4XRCB 1RUML 2HG5A 3HE7C 1BQHB 3REVB 1JGLH 3QWQB 4QCIA 4HJGA 2P8MA 3SJVD 3U7WL 3CXDL 1UWXK 5E8EB 2H45A 4RGNE 2E7LC 2AI0L 2VISB 4GS7B 1G0XA 3PNWA 3UBXA 3DI2B 3EDDA 1J1XH 5IQ9B 1P7QB 3EOTH 1PYWA 2CRMA 5GS0D 4W4OC 3BVNA 2FGWH 4OFVA 3GK8H 3BP7A 3CCHA 2BY3A 2VXTL 4NGHL 5IVOA 3LAFA 1KTDA 4XMKH 2OQJA 4OT1H 4POYA 4U1KB 4TUKH 1WICA 5E9DB 1I85A 5C9KA 1J0ZA 2VXUH 4PRAB 4X8JB 1FFOB 1KXTB 2C1PB 3O8XC 5GSVB 3FRPA 5JOFB 2C3HA 5HVHC 1TZIA 4CN1A 4JVPA 3WFEH 2E7BA 2A9ML 2BNRA 3UC0H 3G5XA 1OD9A 4JO1L 3A6OA 3ARFB 4ODVH 2YPVH 1HZHH 1G7IB 1DJSA 2X4SA 1G7LA 5DQDH 1A22B 1AY1H 1CDIA 4MAUH 3V8OA 2OK0H 4KRPD 1DVFB 1CICD 1FZKB 4ZXBD 3K80A 3CLFL 1OTTD 4TOYL 1PAMA 2G5RA 3H0TA 1T5XA 5FYKH 1EUTA 3MOAL 5MI0B 4R0LB 4E42A 3RZCC 2E6QA 4O2EA 2E7MA 1I8KB 1JPGB 1CGSH 4HJJL 2VLRA 2WLZA 4MVBC 3S35H 1RZJH 5DVLA 3D0LA 1CICC 3AGVA 2V7NA 4QHUB 3SDYL 3VE0B 4J8RA 4U6XA 2ATPB 1KC5H 1CDUA 3IU4L 1AGFA 4Q58C 1TCRB 3C8KA 1OY3B 2R2CA 1INDH 5EFIB 1EXUA 2R69L 1T83A 2EH7L 5DZNA 2G5BA 5ESAB 4XNYH 1WQVT 1IAKB 1C08B 3P3YA 3CFCH 5FKPB 1I3GL 4XP1L 1BGXL 3PWLB 4ODBD 3PDOB 4NQVB 2I60H 3HRPA 4XNMA 3DHMA 1Z5LB 4XCYA 3V4UL 4HAGA 1WGOA 5T3ZE 1CVSC 2F54D 4LSTL 3OX8B 3SDXB 1ZA3B 1KUMA 2BNQD 1I3RA 3GJEB 4D2NA 4QRRB 5MENE 5F89A 2H8PA 3ULVH 1RU9L 4LAQL 1T5XB 4L4TB 2BC4A 5HPMB 4KMLB 4EDWH 5MHSD 1TNNA 4E5XB 2DM4A 4PP1D 1MCWM 4L8SC 4HUWB 4NWUH 4LPWA 2MTPA 3KAAA 5MEPB 5K9JH 2BJMH 5BRZA 4AIZA 3P40A 5C6TL 5CKAA 4OCNC 1T20A 1G7HA 3GSWA 3AC0A 4WFED 2EE3A 3PDGA 3P0VL 1BECA 5MP6L 2P5EE 3K4DA 4X7CC 4PJDB 3C60B 5GGSA 3L95B 4XP6H 3DRQA 2J1KA 2PF6A 5IW3A 3OPZH 3ET9F 2BSED 2HLFC 4DOHE 1IZJA 2W92A 1N2RA 3WIHL 5H2BA 2BVEA 2ITDB 3REVA 1P84K 1BX2B 2A83A 2B5IB 3HG1A 4U1JB 2NXZB 1UQSB 4HMCA 3BQUD 4MNHB 4FFZL 4LCIL 4PJ9C 4MAYB 3BZFA 2VWEE 4Y1AA 1A9EB 3U0TB 3CH1B 1NMBL 5DHYB 3GJEA 5FGBC 3VH8A 1DBJH 2NY0C 4NJ9L 4LSVH 2A6DB 3I3DA 2VKXA 5BS0A 5I8EA 3FT2A 3QHTC 5IF0A 1U3HB 3F7QA 4G8EB 4LHUA 4RZCA 4MQ7B 1EPFA 2RR3A 3DETD 4MD5A 4LCYB 3DRTB 1QR1A 2UZIL 2ENYA 1EX0A 4JFZH 1AGBB 1X5IA 2VC2H 2WUCH 4G6ML 2VDQL 4G80B 3CDCA 3N9GL 4TVPL 3VXRE 1SBBA 4LAJH 4ZUUB 3OXRA 5IM7B 2C3VA 1MI5D 3VFVB 5BV7H 1H15A 5B22A 1TVHB 5KJRH 3RI5K 3QDGB 4KTDH 2EDQA 2QADC 5E2VL 3HI1B 1U8LA 4YIQB 5CJBA 4YUEH 5IGXH 2WUCL 5FDWA 3PQYA 2YA2A 4P99A 5HGHB 5D70L 4Z5RA 4P5KA 1F13A 3MRKA 3P0YL 5E8OA 15C8H 5IR1A 3BUYA 1SBSL 2FR4B 2AXGA 3AAZA 4Y0GA 5FECB 1KTLB 4U0QB 3MGOA 4K8RD 4WW2C 2GYSA 1JN6A 5SWQB 1NQBA 1FFQA 2CIIA 2ZCHH 3KPMB 4I0PA 1Q9LA 5IMLA 3TIEA 1J10A 4AYFA 1X9QA 2DJUA 5EUKB 1KPVA 1UCBL 4RZCB 3IFNL 1E6OH 4HQQL 1ORQB 4Y5XC 4PGZA 3CFBA 2ENSA 4HKXA 1RK0B 3LSOA 3NN8A 4H0HB 2VZOA 2W0LA 3GMNA 2BOCB 3MV7A 4G80A 5KTEH 3S37X 4B50A 3FQWB 5E94A 5JIHA 3X3FL 5BJTA 1OHQA 1TJIL 3D39E 4UBDC 5JR1L 4TQEH 1J0YA 4ZNEE 5D7IE 3AY4A 4YLQT 3T4AA 4KVNH 4JN2B 1JZ6A 4KY1H 1PSKH 4S1QL 5IB2A 1VEPA 5C6TH 4RQQA 1UB6A 3TFKD 1OAXL 4ZNEA 2X4PA 3CCHB 1BVLA 3RVTC 1EK3A 2GQHA 3VWKC 2X4OB 3QNYA 4K3JL 3M1BA 3QG6B 5SWSE 1ZLWH 1CI5A 1ONQA 2JJWA 3NFNB 3SKNA 5EOQL 3ECBB 5JOFA 2J8UB 3HMXH 4XBGB 3ULVL 3V6OE 1YN6B 4ODWB 2CIKA 5DRWB 2V2XB 4XCEB 2AK1H 2FBJL 3VGFA 3RWJA 4JFOA 1S7VB 5KW9L 3PJSB 3M07A 3P11L 5FYJU 1ZS8A 4G7VL 3QA3B 5EA0L 4ZQKA 2I60L 4JO3H 3LRHA 5L6YL 1NGYB 2EO9A 2ZKHH 1T04A 4P9HH 2NY1C 3MRGB 1HHJA 2MFNA 1GC1H 3GSWB 3DVNA 2JK5B 1ZEAH 4YDKH 1T1ZA 2BOCA 4HUVB 4DCQA 4ZAKC 3TO2A 2QQNH 3MLYH 2HA1A 2Z93A 4ZUVA 1WZ1L 2G75A 4JFZL 5JHDA 3ARBB 3QIWC 1RURH 3GBNH 4Q6IA 3D9AL 2BNRE 1IKNC 4A6YB 2NX5B 3BZ4A 3CX2A 2ZUUA 1YNLL 3BGMA 1S7XA 2NY4B 4PY7B 2BXYA 3D87B 1HI6B 3L3DB 2ZPKL 2A0LC 3MRDB 3UPRA 1V5JA 4Z7OE 3STLA 1RJLB 2IFGA 3W39B 1B3JA 3UTPE 4GBXD 3RDTC 4WHYG 1AXSB 4KK8D 4GAGH 2Y36H 5K9QG 5BXFA 3FOLA 3E1F1 3DV6A 4OQTL 4BSVB 3CLFH 1Z9SA 4LRNL 1K3IA 5DRZB 4NQDE 3E8UH 4JFOB 2NNAA 4MAUL 2OK0L 1NC2D 5F7DA 4Z7WA 5DUPH 2F74B 1OF2A 4P23A 1H5BB 1EJ6A 3PWJB 4P3WA 3MCG1 4HJGB 2FH6A 5E99H 4DKFH 3TZVD 3UC0L 3WN5A 5FHBH 5ID1A 3PGDB 3BN9D 1WV7T 4LMQE 3IFPB 5EUOA 4P5MB 3VD3A 1I8LA 3EOAA 4X83A 5E4EC 2OR8A 1MHHB 2R56L 4KTEH 2ICWI 3CVIH 3AREC 4WI9A 2VXUL 3GM0A 2QHLA 1F45A 3BPCB 2GFBA 4YGVB 4GXVH 2XKNA 2FHCA 3X13A 3VWKB 3OR7B 1X5AA 1MFBL 1SYSA 2PO6B 4KI5F 4BQBA 2NY1B 4GW1B 4FP8L 1G0DA 4P57A 1LDSA 3S5LG 1QPXA 1OOAA 2KL6A 1JUFA 3VXNB 1JTTA 5F7KC 1MCSA 3SKUD 1MQKH 3N50A 1YEFH 4H0IA 1KENH 5JQ6L 3ZZ1A 3CXDH 3O41B 4JM2A 2QQKL 4WEBL 1L0QA 3QUZC 4DTGH 4LKXA 3TM6A 4HUUB 5H2BB 5FK9A 1AKJA 1MIEL 4DTGL 4PJEA 1Z9OA 4JREC 2DWDB 4FQJL 5CEZE 4J1UA 1CDCA 3D25A 4K23H 2XWBB 1A9EA 3U0TA 5CJOL 4DKEH 1OGAB 1CFSB 5B21A 4RCAA 2LAAA 5DK0B 2W9EH 4D9RD 3B9KD 1KCKA 1QLRB 1M71B 3SCMB 4F9LA 3C9NA 2X4PB 2IBZX 3BHBA 2GKIA 5LJYH 1D5XA 2X4UB 3IRPX 2YRZA 1PQZA 1I7UB 2NX5E 3SGEH 2W59A 5EIQA 3PQYE 3GHEL 3T77B 1H8SA 5FYKL 3OKYA 1A7NH 3DRTA 1QR1B 1R3IH 1J18A 1LO4L 5IVXA 1G9NH 1RIUH 4XCEA 2J88H 3GSQA 2A9NH 1V3LA 3LIZL 4OCYL 2HRPH 3VXSE 2H3NA 4Z7VF 3NAAL 1ZE3C 3OKDB 5C0EA 1HZHL 3KXFD 1MFNA 4IRSC 3A67L 4LSRH 3EW3B 5TE7L 3QUMB 4EXKA 4M9OA 5F71A 4X99B 3HNVL 4PJEB 4IDJL 5I17A 5DJ6A 3SOBL 1A14L 3P73A 3WFEL 1XIWD 1RUKH 4QRRA 4HIHB 5F1NA 3UAJC 5TF1H 1C16B 5BV7B 1LO4H 2AP2A 4HW6A 3LS4L 5F70A 1U8MA 4JN1L 1AGCA 2YS4A 3WJLC 2RBLA 4HG4J 2FEEI 3QYCA 5F9JB 4H1LA 3QXWA 4X4XB 4XAKD 5JW3H 2BVYA 3AM8C 1U58A 2YC1A 2BVPA 3LPFA 5BRZB 1P4BH 4JFDB 4YHLL 3CFBB 3BH8B 3LVEA 3JV5A 1W72L 5DO2D 4IHOA 4RSVA 2VO5A 5DEFB 3F7VB 4IIQB 4H20H 5J06A 2QQNL 4L9LC 5E6IB 5CZVH 4R7NB 5ITFA 3ZSTA 3UAJD 2IH3A 2R0KH 1W8OA 2NNAB 4WJ5A 4YDKL 1QEWB 1YUHA 3RUGB 3EO1B 3PXHA 4OIIL 3ILPB 1ORSA 5EOTB 1RUMH 4Z7UF 2PW2A 4NKIL 3U30B 5DT1H 3MFFA 3QDJD 2YN5A 2DJ4A 1CGWA 3QDHA 5E70A 2E8YA 2D9CA 1NBQA 4KZDL 4MAYA 4JREB 1C12A 4DAGL 5K9KB 3QJHA 5ACZA 4ZSOA 5D4QA 3H2WA 2CKBH 2M1KA 2VDLL 1G7JB 3EOAB 5ICXB 1S7TB 1PKQE 5DZLA 1UZ6F 2RJMA 4AH2A 1VFBB 5EU3B 4LLYB 2P8PA 3BP7B 4ZOAA 3MA7A 3QI9D 3DXAA 3MUZ1 1JGVH 2DQHH 4LHJB 4NC0B 1PX4A 1Y18B 4JHWH 1KB5L 3FRUB 4HWBA 1OP9A 1K8DA 2C1PA 1KJ2B 5C70A 1FORL 2YD2A 4X6DE 4YR6A 1HHJB 2P4AB 4PJFA 5DUBB 4G8GA 1CZ8H 3BPOC 1UJ3C 5C86A 1TETL 3PGFL 2GSGB 3IKKA 5E99L 1JL8A 3C5ZA 1DLHB 5I9QC 1FNFA 4EI6B 1YNKH 4WDIB 2BVOB 5DUPL 2CH8A 5INDB 1HCFX 3SJVE 3QWRD 1WBZA 1S5IH 4P3CH 2R23A 4JZJA 4G42A 3DVGB 5GRUH 5FHAL 1BIHA 2R29H 4WTWA 1VEOA 4EI5C 1S7UB 4S1RL 3LKSA 5JMRA 4OZHE 5E6IC 3B3IB 2ZUSA 1WC7A 4JRXB 1XF1A 5I8KL 4NPYA 2R0ZL 3GUTA 2ZG1A 2X4UA 3F6LA 3ZDZF 5IHZA 4JGMA 2PW1B 4LK4A 4EIZC 2CK0L 4XNUL 4JPKL 3ZE0F 2Y07L 1Q9KA 3W11C 3D9AH 1FVDB 5AAMA 4EBQH 1ZTXH 3OAUH 4XCNA 1ZANH 2DLFL 3RVTD 4I3SL 4OCRH 4ZFZA 4JANA 3D39B 3LH2H 4F7MA 3O45A 3S37H 3IDMB 1UA6L 4HEME 1UB5B 3NIDF 1OSZB 1BHGA 2LV4A 1H3XA 2F19L 3EJYC 4CVZA 3QRGL 5BV7L 1GHFH 4G8IB 1RHFA 1U8KA 4KU1A 1CTOA 3VFWA 4MJIB 4E9LA 3WL9B 3CSYB 5D71H 5FO9B 3OKKB 2ADGA 1LHZA 2NY0B 4X6CE 5EOCJ 1YEJL 2BRQA 3DX9B 3PWUA 5HGBB 2X4OA 3WE6B 3IDGA 1HE7A 5IB4A 4YGVA 3LQAH 4Q6YA 2AK1L 4CKVX 4PGDA 2D7QA 2OJZH 3RVWC 3JTTA 5AWNL 1U3YA 3BO8A 4K7PX 4P57B 1L7TL 4X6FB 2P1YA 4LSVL 5CIPA 1N5AB 5GJSL 2HT2C 4OCXL 1T0MB 4Q0XL 2X70B 1I7TB 4QWWD 1SMAA 4I48A 4K3JH 2VDNH 1FZOB 4HBCL 2HAZA 1DQTA 1HQRA 4RIRB 5HHOB 4RX4D 1CE1H 1EA9C 4AENB 4OCMC 5D6DC 5I1GL 1MFAL 4XBPA 5IV2A 1UKQA 35C8L 3D5OF 3OG4B 2R2BA 5ADPH 3MLUH 3JUYA 5DZOA 5CGYD 1BEYL 2LFGA 5KANI 4X4YA 1LP9F 3B9KB 4ZO9A 5FYJL 3MUY1 1A0QH 2IQ9H 2FZ3B 5H37H 3X17A 4HD9A 5E03A 3MRDA 1J8HB 2ZCLH 3IJHA 2ZZUT 1B0GB 1MVFA 1U8IA 1UM4H 2QSCH 2SEBB 4G7YH 4I77L 3TLRA 4PB0L 2JB5H 1CU4L 1T5WB 1YNTB 5L2JB 2D4FA 2R4RL 4ZTPH 2VXQL 4JG0H 4Q74A 4GAJH 3FKUS 4YEEA 4Y2DC 2VDOL 3IVKB 3MCLL 5I75C 5T5NF 5CIPB 5H35A 2JELH 3MLZL 4YAQA 4FS0A 1B4JH 3Q0HA 4OZHB 2UY7A 1EJOH 3KXFA 4MQ7A 5K33A 5DJ8B 3ALXA 3QZWG 4PJFF 4PJCF 5ACLA 3DYMA 4LIQL 3BQUC 1UM5L 1BGXH 1R24B 2E7HA 2XNAA 2Q7YA 5DRNA 3SE9H 4LMQI 3VXOB 3EBAA 1HSAA 2VERN 4PJXA 3RIAF 2OZ4L 5E8EA 1T4KB 4K3DL 2DF3A 4NIKB 4YPGB 4L1DA 1QQDA 3IXAB 1ETZB 3W81A 2YWYA 5HVFB 4UTAH 4V2BA 4KUCF 1PYWB 2Z31C 4NQDD 5FKAB 4XWGL 1FFPB 3ARFC 2RAMA 4O9HL 5I8OH 1X5ZA 4HIEA 1KN2H 4ELMF 4UOJA 1ES0A 4JDVB 5JIKA 1I9JL 1P69B 1X7QB 1KTLA 1J5OL 1V7NH 1VFAB 5C0JB 1JP5A 2HFFB 2R1WA 1CVRA 3GSNB 2DQGL 3AMLA 4AIOA 1T22B 5F97E 4W6XB 4EI5D 3B3IA 1XT5A 3L3JA 1QLEH 3V79C 3IDIA 5I1KL 3HS0B 3RWFB 3QUXB 3ZO0A 1PFCA 3U9UA 1X4XA 1T7VA 3OF6D 1IFHH 5GGTA 4C56E 5D6CB 3BFOA 1ORQA 5ANME 1KPUB 3UTSA 1YJDL 1EH9A 3TVMD 1EHAA 3ILQD 3QXUA 1NAMH 4PS4L 1CL7H 5T3ZL 4X0KB 2Q7YB 4O02L 2QSTA 1NC4B 2KQNA 3FFCB 3F12A 4ENEC 3JSSA 1VB9A 2DL9A 3MA9L 3STBA 1YY9D 4PJEE 3INUH 2MHAB 3NA9L 1UYWH 1YQVL 3R0NA 3GGWA 3VMPA 4YNYA 1BREA 3MJ7B 4HMDA 3REWA 4FFWC 5GS1C 3WUWB 3WL9A 1S7TA 1MCKA 1R3HB 2JE8A 3H42L 4U1LB 3NCEB 5KSAA 3QI9B 5HHPA 1GZQA 1F42A 2CKNA 2WP3O 4NDMB 4Z7UE 3KNBB 4OZFH 3HLAB 3P4MB 4CAGA 4YX2H 1FYTE 1N6UA 4N0YL 2VR5A 1UKTA 4GKOA 5FUZH 3LQAC 2DQDH 5EIIA 4NN5C 3U6RA 2YXMA 4X9BA 2HFFA 2R1WB 3S3SA 2H41A 4GKSA 1FYTA 2X70A 1C5CL 1HILA 3GI9H 1NBYB 5I75B 1UJTA 3Q6GH 5EO1A 3H3KA 3F58L 3QO1B 4QRSB 4PJGA 4HG4K 2DI8A 4WU5B 4MD5B 1Q72L 5JNYA 5HHOA 1AGBA 2HWZH 1KTKE 2XTJE 3DARA 2E27H 1LO3H 4W70A 4X7SL 3WKML 4FG6C 4AENA 3O0RH 3GMMA 5GRJH 1RULL 4G9DB 2VISA 4HUXA 1HHIA 4GKZB 3PL6A 4WO4A 4HIHA 3MRNA 4YJZL 1S9WB 3TBYB 1D5ZA 5D5MA 4FXGA 3O9WC 2DQCL 1YQVH 1Q38A 3DX8B 2FO4B 1NLBH 3MO1A 2FGZA 2Z35A 1YY8B 1HKLH 4X80H 4G6KL 3PG2A 3BEWA 5HYJE 4HV8A 3HE6A 4PJGF 4XP5L 4KMTH 4D0DA 5KG9B 4HHAB 3MGOB 1FFOA 1ZLVH 3STLB 4LLWA 5CFHA 4ACPA 2AEIT 5F96L 4HK3J 2HMID 1XIWB 1RIVL 4NHCH 4NZTH 1QACA 2Z0BA 5JW4M 1G6VK 4HH9B 3QCTH 3FQTB 3QFJD 3MREB 3KPSA 5HI3C 3IKCA 5H94A 2K7PA 3GMRB 3FTGA 1I4FB 4Y19B 1H3UA 2YN3A 2R8SL 5DQDL 4PJGB 1CIUA 2FEDC 4I5BB 1EIBA 1IGFL 2IALA 1KN2L 1E28A 2CDGB 4ZPVB 4D94A 3T2NL 1KYOJ 5E8NA 4XWGH 5K9KA 3NMEA 1IAOA 5C07A 1KLFA 5F7YC 5FYLD 3IXAA 1S9WA 2COQA 3BEVB 1I9IL 5DJZB 2ZUWA 4R8WH 2WBJA 5FUCE 1J7VR 4NKOA 8FABB 1IGYB 2NXYC 3DHJA 2OZ4H 1MCWW 2Y06L 5I1JH 4LLAA 4KRMB 4Y5VA 3SCMD 32C2B 3I6LE 2GFBB 2FL5A 3DVFA 3EJZC 4RMRA 3MUGA 4UIMB 1UM5H 2ERJC 1Y18A 5D7KE 3BI9X 3SGJC 5JW5A 5MEOA 3PABB 4S11A 1P5UA 4PJGE 1AC6A 2QQQA 1KV3A 2J6EA 1RJYA 3BIKA 1UEMA 5D7LE 3PGCA 3RY4A 1FV1A 2KBGA 5GRVL 1A3RL 2AKRA 3G6JF 4OAWB 2R4RH 4ZTPL 4ERSL 5D6CA 6CGTA 3L1OH 3VG9C 5C2BH 2EIBA 1U91A 2X40A 5LGJB 5TE6L 4MCZA 2C3WA 1CL7I 1DANT 2VABA 1WEJL 3T1FB 4KGJA 4QY8B 2W38A 2DWDA 1MFEH 5L2KE 2MPAL 5ISZB 3V6OC 5SWZA 5FECA 3R4DA 4JFPB 2VTFA 3A6CH 5AZ2H 1KCRL 5GXBB 2Q7NA 3CVHL 3QH3B 3L5WA 5HJ3B 1JHLL 4B7LA 4HT1H 3TIEB 3QQ4B 5B4MC 3G6JA 1KN4L 4M48L 4P2RB 4YXLH 1RZIB 5IHZB 5CGMA 3EYQC 3Q3GB 1Z2KA 1IGTA 5D7JC 4ODSL 4PV9B 4YEFA 5IKCB 2J3SA 3GHBH 2V5YA 4IOSD 2VRAA 1DN2A 4K7FB 4M7KL 5EBWA 4RGNB 4KRPC 1FNGA 3RWCB 3TPUB 3RL1B 4KI5D 4PGEB 2FX7L 1MY7A 3TYFB 3UTQB 2BHZA 5CUSH 1FGNL 4JQXC 4NUJB 1ZT1B 4X7FC 1F3RB 4PP2B 4RGOH 5LCVH 4HC1A 2VLKB 5AUMB 5FEBA 4C56B 4NQCA 3BDYL 2XA8H 2F53B 4N8VG 1NGQH 5DD6B 2Q8AH 3KDMA 1UQSA 2QQLH 5SX5H 3I50H 2AV1A 1YC7A 4TSCH 4WWID 4OV6F 3IXTA 5BZDA 4BA8A 4FQ1H 2H6PB 4O51A 1AD9B 5JPNB 4I18B 3LN9A 4AJ0A 3B8YA 2BHUA 4HGMA 3ECBA 1J05A 1CF8H 4WFGD 4K2UH 2Q76A 1F90L 3TESA 2J5LB 3CDYA 3FQRA 5D2NE 1FDLL 5IB1A 3QEQD 4CL7A 1IEBB 5JO5B 1A9BB 1WZMA 3W9DA 5BS0E 4RFEA 4TSBL 4OGYH 4PJCE 4ORZC 5HYJA 1I3VA 5IQ7L 3HB3D 4U1NA 2V17H 2XWTB 2WP3T 3BPNC 3HI5L 3E3QE 3TPUA 2P8LA 5CP7A 1S78D 4PG9B 3UTQA 3NZ8A 1TFHA 3V4VH 2BRRL 4KUZL 5F1SA 1MVUA 5GISL 4R0LC 1CT8B 1JTOA 1YMHB 2ICWA 5FKPA 5DQ9B 1ACYL 5CBEB 3IDYC 1OT2A 2HRLA 3F7YB 1MLBA 5F1IA 3KYKL 4P3CL 3G5YA 1YDPA 4HC1H 4ZXBB 3QQ3B 3VXSB 4HUNB 1EEYB 3CFDA 4QRUB 1DVFC 3MRPA 3O2VH 3S7GA 4ETYA 1XF2A 4QHKI 1HHKB 3BDYH 4RFOL 5L2JA 3ZHDA 1WCQA 5D8JH 2G60H 3U6RB 1I9RL 4NQDB 4D0CB 5LQBH 2XI9A 1VPOH 2HT3C 1FBIL 3TYGH 2EXYC 3VRLE 4XBEL 3MV9E 2JCCB 1T3FA 4LDOB 1D3CA 2BY1A 4QRSA 1FFNB 2YD4A 4JY4A 2AW2A 4GFTB 1KB5H 2GW5A 2R0LH 1RZFL 3VGGA 1BZQK 1M4KA 3PV6A 4NQCE 2JB6A 2ESVA 3RVUD 2D4DA 4KDTA 3C5JB 3VRJB 1T7ZA 2XZQH 3IS1X 4P2QE 2DQEL 4D0BA 4UI2A 3RRQA 1UENA 4F80A 2XICA 2EYSA 1WCBA 1TVDA 3VFPB 2R15A 1U0QA 4L3EE 3GRWH 1FQ9C 1RIHH 2IH1A 4PTUA 5INCB 3QHZH 4PJDE 4OUUB 5GGVH 3BPCA 3JV4B 4HLJA 2FJGB 5T1DL 5GGRB 3LQZB 3X13B 1NGPH 1J8HD 1N0XH 5IFHH 1L9NA 2I25N 1VGKA 4OQTA 1VADA 1Q9OB 3VWJA 3KYAA 2CKBB 1HHHA 3C60C 4YHZL 2PTTB 5JUEH 4M61A 1U3HA 4Z0XB 4JFDA 1X5YA 4ZQKB 1W72H 5CJ5A 3SQOL 1G7PB 1KB5B 3QXVA 4FQIL 2XT1B 1J1OH 5TDNB 2WM0A 2QEJA 4OF8A 3ZDXE 2BNRD 3MRFB 4HXBH 4LCWA 5KSUA 2MMXA 5KN5B 2BRRH 1ADQL 3HNSH 2CDGA 1CD0A 1UB5A 4ZPVA 4CVZB 4M3KB 3K4ZA 1WAAA 2XZAL 4Z0BL 2X41A 3U4AA 3VCLB 4G8IA 3UBXG 2IPUK 4MD0A 4OZHF 4U6YA 3UBXB 5JLZB 1FPTL 5IB3B 4RMSA 1IM9A 1OM3H 2DQIL 3QFJE 4HPOL 4YBLC 4XC3H 1A02N 2K7QA 1AXTH 1FNHA 4E41D 4HDIA 4JFXB 3H7LA 4FQHA 4L4JA 2IFFH 3MUGB 3UTPD 5FCSH 5DJDB 3K8KA 4TULL 2NY0D 4B53A 3U0WH 4HUKB 1F3JA 1U95A 1DP0A 2G9HA 1F4YL 1G9NL 3EYOB 4R4FH 2WINB 5IJVB 5LXGH 1S7QB 2HFEB 3GSOA 4Z0XA 1QBBA 3X11A 5L0QC 4NN7C 2BOBB 4JDZA 3T65A 4K9EC 4NKMA 5J9PB 1NEZA 1KT2A 3QFJA 4P3DA 3WN5B 1HKLL 4X80L 3M8OH 4NQVA 3VI4F 1MHEA 3LKRB 1K8IB 1XGRA 2HVKB 1JI2A 2EDWA 5BQ7B 4WV1A 5IB2B 4K23L 4PRBA 1NBVL 1E6JL 3HMXA 3GJFK 1S9VB 5DVKA 3T2OA 5JOEA 5CZKA 4U1IA 5J13C 1Y6MR 3VXUA 1I75A 3CNKA 1AR2A 1MIEH 2C26A 4YXLL 3RA7L 5EOCL 1KN4H 3UEZA 1R3JA 3MRQB 1LVEA 3RWDA 1LK2B 1Q72H 3VE0A 1ITBB 2E3VA 3QHFL 3CD4A 3IS0X 1KENL 3SE8H 1YEGL 1AGFB 3OKLA 4AEFA 2AGJL 5DJYB 1C5CH 5DTFA 1LO0H 1GPOH 1JGUL 3MRMB 5H35B 1NGWB 3MBXL 1CLOH 3ULSA 5HHVL 3KJ6L 1AD0A 2AV7A 1UWGH 1O5DT 4UTBL 3WLWD 4GMSH 1UH2A 4N0YH 3G9VA 5EB9A 1DDHB 1DEEA 5J0BA 4C54A 4LPCA 4NRYA 1FO0L 3S36X 1BZ9A 3S36H 4U1JA 2FYYA 4XCCH 4QXUL 1EFXD 5SV3A 5EU4B 4LHUG 3AMKA 4LEXH 3K1KC 2F58H 1FNEB 1ND0B 4JVWA 3FOMA 5DC9B 2J8UF 2ESVE 4LASL 1C5DB 4A6YA 5GPRA 1B6UA 5IG7A 3JTSA 4XPHL 1QBML 2WV3A 3LCYA 5CBAB 5IJKC 4YXHL 5I71C 3BPLB 2M8XA 3BKMH 5TQ0H 3I85A 4QOKB 4UDTB 4R8WL 4GAYB 4JHAL 3UTZB 3UMTA 1IARB 3E8UL 3WD5H 3KPRD 3VG0L 5I1KH 5TH2A 4DVRL 5IEHB 3HUJA 2DLHA 1RZKC 5CILL 5IBUB 5A40E 3CC5B 4ZS6C 2N7BA 3TCLA 2B1HL 5E6ID 4B0MM 4IRJB 3MFGB 1I9JH 1MCEA 2ED7A 1NFIA 3RX7A 4JRWA 2FH8A 4LEOA 1VGEH 2B1HH 3HG1B 3V0VB 1K6QL 2UV3A 5D2NC 1NC4A 3SDDB 3RWGA 3C5SB 2X4TA 2RIKA 4MD0B 3RZCB 2P5EA 4HKJA 1YEHL 1YQ2A 3P9LB 3OL2A 3QCUL 4NHUA 1C1EL 2WWKO 3OTTA 3FT2B 1BLNB 1BQSA 1WBXB 5ALBL 2O5ZH 5TQ0L 4JFXA 4GAFB 1IAIM 5CBAA 4Y4FA 2XG5A 4P9HL 1KCUL 2ZKHL 5L6YH 4XPHH 1DTUA 1DQQA 1QLFA 5C0NC 4O4YL 3TWCH 5C0DA 4A6YH 3VFNB 2BMKB 1CN4A 2AEPH 3FN3A 2PR4H 3G08B 2CIKB 2DIBA 5F7FA 3S88H 1BBJA 1JNHA 1JNLH 3WFDH 1SJVA 2FBJH 3OJDB 1G7QA 2VDOH 4P2OB 4GAJL 1LD9A 4JG0L 3IDXL 1CXHA 3MV7B 5E2UH 1EMTH 2Z92B 1LO3L 2B8OT 1LEIB 2VAJA 5L7XH 1WFTA 3MR9A 4L3CB 2IH1B 2VZ3A 4PTUB 4JEGB 3O81A 1CLYL 5BO1H 3SDXA 3MBXH 3LV3A 4OGXH 3MYJA 4PGDB 5IBTL 1J88A 1KG0B 4KVNL 4QTHA 5ICXA 2FB4L 1ZVSB 2BK8A 4XVUC 3RWIB 1KULA 2X1OA 5ADPL 4QRQB 5DR5H 3TEUA 4PRHE 5JR1H 1TJIH 4I0PB 4JFEB 4LP4A 4DK3A 3X3FH 1OGAD 5CWSB 3U83A 4NRXA 2VE6A 5B4MD 1L6ZA 1HSBB 1H9VA 5EBMA 2YSSA 3DROA 2GAZA 2ATKB 1BZ7A 5GS0L 4XGZB 4JFFB 3UTOA 3B6SA 2NTFB 1ZLWK 3HZVA 4QNPF 3DV6B 4BSVA 4HBQA 4Z7UB 3V6BR 4FQ2L 5FO8A 5FM5O 5FYKE 1OP3H 3K81A 3WKNA 3IU3A 4PJBE 5B8CC 3VD4A 3GO1L 5ID0A 5HHMB 4PS4H 5T3ZH 4ZS6D 2ITDA 5DJ2A 2CDEB 2EO1A 4C4KO 1SBSH 4GBXA 1MLBB 3QEQB 1OAQH 5JPMA 4LSSL 3H9HB 3HUJE 2C4XA 4X4ZA 2ICEB 5LXGL 1YEKL 3VXRA 3EDEA 3KWWB 4LCCB 4RA0C 2DOCA 3CH1A 4U3CA 1KCVH 5DHYA 5GRXG 2BNUA 4JQVC 4Y7MA 1H0DA 2FNBA 4Y4KA 3REWB 1UCTA 4FQQA 4TPRL 1A7RH 4YE4H 3OJMB 2D2OA 3S97C 1SVCP 3TA3C 5DYOB 3W39A 3P4OB 1NAKH 4ODHH 2VDQH 4FNLL 2KH2B 3MCKB 4XHJD 4O9HH 1R5VB 1SY6H 3EFDH 3ULVC 2I9TB 4PYHA 1NGYA 2C4FT 2ZOKA 4X9HA 2CK0H 4XNUH 5EZLB 3ZKSD 2VLKE 1NEZB 1DE4A 4TTGA 1G84A 3PWNA 2CMRL 1D5IL 3WCYA 3LDBC 3TBSB 3HNSL 4YHPB 2H2SD 1G6RA 4Q9RL 1CDYA 3QNXA 1MLCB 4C83A 4WW1A 3TVMC 2DQFB 2WZPD 4JLRA 3WS6A 2IPTL 4GBXB 4NFBA 5HD8D 1Z3GH 3MV8E 2O26U 4UQ2B 2DM7A 2EYTA 3SDDA 1B4JL 3VXTA 4M00A 5HI4D 4EDXA 1JGDA 4E41A 1U8JA 1B0RB 4F57H 1CFSA 1DLFL 3D2UD 1FCGA 2GUOA 5D7IF 3X14A 4G7YL 4NQXB 1CZ8L 4O2FB 1YPZA 3RP1A 3NA4A 4ELKB 4WWKC 4O2EB 4MNQE 5C7XH 5CINH 5E56A 3BN3B 4M6OL 2D7OA 3BAEL 4KROC 4QYOB 5TJWK 4POUB 1F4XH 3NVQA 2XZCH 3ZTNL 1FRGL 1QSEA 4LLUA 1JFQH 3ZKXB 4EQ3A 4GG8A 3PWVB 4WRLA 3QXDA 3TGXA 3V4PH 4FQPA 1ZSDA 2N4IA 3WIFB 1IAIL 5HYQA 2UUDH 1I1AB 4LCCC 5SV4A 2FJFB 3ZL4H 1ODAA 3KS0J 1FG2A 5CJQH 3IJYB 4G6JH 1CXIA 1XGUB 4YWGL 1MCHA 3PHSA 1KJ3H 1MFAH 2EIEA 4ZXBC 4H8WC 3RTQD 4Y88A 2A6JB 3H9SD 4I0PD 5CEZH 5EU4A 4IMLA 4JPIB 1K5NB 4U1LA 4DAGH 3PDOA 3TN0A 3Q1SL 1JZ3A 2IC2A 4MSWA 5DJCA 2WMPA 1OCWL 2O5XH 1KELL 3MXVH 2AQ1A 3RGVA 1A7BA 4YDLC 3TT3L 3BYYA 2FSEA 5CZVL 4JJ5A 3QFDA 3DGGB 3O2VL 1RPQA 4PRPE 1QYGL 4JRYA 1CXEA 5D2LE 4N5ED 2ADIA 4NQTA 4I9WE 4ZFFA 5HXMA 4GG6B 5D7LB 4JDZB 3T65B 2QR0A 1NANI 2AK4E 3QIBB 4YK4B 5CEXB 5K9OA 4NP4H 1HOCA 2NTFA 2ITCB 1U8QA 5AAWA 2OR9L 2NTSP 4X9IA 3CFKA 4UAOB 1DQLL 1U36A 2VAAB 4YDJB 3ZMRA 5IFJA 1BOYA 3UBXI 4OAWA 3QIBD 5F9WC 1IM3A 3EO9L 4D9QE 2LU7A 4OLYL 4OZFA 1ORSB 5EOTA 4WV1B 1MIML 5TF1L 4I3SH 4FXKB 4N0UA 4OCRL 1NMCC 1ZANL 4WI6A 5DJXA 1RUKL 4Y1AE 4ZFOB 2XA3A 3OAUL 3K1DA 4OGYL 1O0VA 2H1PL 5DQ9A 3D3VA 3SCMA 3CDFA 1XZ0A 5F7UA 2ZJSH 2UZYB 2XQBL 2NW2A 3LN4B 2EYRA 4MNHA 2PXYA 1CXLA 3WUZA 1LEGA 3SDDD 4PPTA 3A67H 4JKPL 3QEHA 3MRPB 1QFHA 4K8RC 1LK2A 3LKPA 4CADB 5LGHH 3ZT6A 5HVWA 1I1AC 1S9YA 1MJJA 2JCCF 2VDRH 3QDGE 5I8EB 5KS9A 1E4XI 3TO4C 3WFCH 1GIGL 5HDBE 1H5BC 4N1EA 4NT6A 5BMFH 3IRZA 1OTUC 2RGSA 1X3DA 5DQJA 5CHNA 4RMTA 3BRFA 5SWSA 3FT4B 5LAXB 3H9SB 1BJ1H 3RTQB 3KPRB 4XC1L 1PLGH 2GTWB 3D69A 3MZTA 4TUKL 4XP9H 3QULA 1HXMB 4F7PA 1C5BH 1KACB 2VQ1B 4NGHH 4QOKD 4HK3N 1RSFA 4NUJA 4PY8J 4QHMB 1SVZA 5TDPA 3EJYD 4ZS7L 1Q9WB 4M7JH 1H8NA 3DXAD 1E0OB 2VL4A 3PHOA 2BY2A 1J1XL 1F6FB 3FFDA 4RAVA 1HH6B 3QNXB 5I66A 3R0MA 4Q97A 1IGIL 4M93B 2EXYD 3GZKA 3FO0L 2AI0H 4PJIA 2NY2D 1XGTB 4JHWL 4JFQB 3IDNB 4NKDB 4XP4L 1RAMA 1HKFA 2XKNB 5SX4I 5E08L 3D2UB 4MAYD 4D3CL 5JHLH 3HAEH 3R06B 5I1LA 3ARDC 2YD6A 4R26H 1MREL 1JUFB 1UVQB 3VXNA 5HPMA 4JFFA 3FFCD 1Q9OA 4BZ1L 5DEFA 2O5YH 3ARGC 5LVEA 3MRBB 3BP5B 3C60D 4BZ1H 3H3PL 4F2MA 4TUOA 3OAZH 5HI5D 4UV4H 5TE6H 1HWHB 5CSGA 5F7LB 3ALPA 1KCSL 1R3LB 2I07A 2NW3B 3RBGA 3O6LH 3QUXD 3L1OL 3GMNB 1HEZA 4MNQA 4KHTH 4M5ZH 5E9DE 2R0KL 3C08L 3D3VE 3O2WH 2FIKA 3MUHL 3NFPB 1P1ZA 2WSKA 3T0DA 4AG4L 4QRRE 5MENB 2LU3A 5GZND 3EYFA 5C8JB 4HGKC 5CD5C 1A3LH 4QRRD 2FECI 2JKXA 4LLQA 2X7LA 3RX8A 3E6HA 3DMMB 3WHXA 1BOGA 2P7TA 3G08A 1Q0YH 1A6UH 3O6FC 5FGBA 3JV0A 4FQLH 4I48B 4LARL 2VL5B 3HS0A 4JCLA 4NZRH 4IDJH 3O45B 4Q9CA 2Z31B 2Y72A 5ETUA 5LGHL 3U7YH 4XMLL 25C8L 4LSRL 5TE7H 2X4QB 1T1YB 5DD3L 2WWMD 1XR8B 3KPOA 1U93A 4PJXF 4DCQB 1YNLH 3U4BL 4IRZL 2IPUG 4FRWA 2OTUA 5E2TH 1MHCA 2H1PH 1RFDL 3VGBA 2IF7A 1WZ1H 2Z91A 2GJJA 3EKCA 1RIVH 4NHCL 4NZTL 4BFIB 3RAJH 2K9UA 4N0FB 4M93C 4M5ZL 5DI8B 4JFED 5D93B 3C6LA 1GC1L 3UROR 1DQDL 3MLTB 2XWJB 2OJEB 3JBG7 4X5XB 3KPSE 1T1WA 5MEPA 5L8LB 4OFKA 4F58L 3HB3C 3VFGH 5IFAL 1DQML 4PJ9B 5KSBF 5C0CA 4QTIH 5T3XE 1CK0L 5A3IC 4WW2A 5JHDE 2CKBA 5I19L 4YHNB 2MSPA 4NRZA 2C1OB 3KLHD 3SHSA 3VFTA 4FQJH 4M7LT 1QHOA 5I6XB 4YFDB 3S4SB 1YC8A 2PW2B 1RK0A 3LSOB 3NN8B 4HS8L 4UT6H 4R7DB 2VLLB 4JR9H 3OAYK 3ZDXF 3NCYS 2CRIA 4MA8L 4XZUB 2X4NB 3S34L 4GLRI 4JN2A 5HYEA 5JQ6H 4ALAH 3WIIH 4BELD 3BDXA 3Q1SH 4PD4K 1I7RA 4OCSL 2W0KA 3QDMD 1S3KH 1IGML 4N9GA 1KIRB 3QUYA 5KSVB 1A6ZB 5FKAA 4XPBL 5F3HA 3B2UD 3HHRB 4FA8A 2X6MA 4BH7A 4GXVL 4KKAC 3NZHL 1IAIH 3VWKA 1AO7E 1UJ3B 2GK2A 2ZNWA 3RZCD 4LLWB 3ZTNH 5DHXB 3JWOC 1WUNT 1XMWA 4PJ5D 3FB5A 5GS2D 3UTTD 1R5WB 4WTXA 3NA9H 1ULVA 4ZUUA 5DD5L 2AEQL 1H3PH 2F5BL 5GGRY 1NMAH 3QEUB 3WFBL 1CE6A 4IRJD 2F53A 1M7IB 2YD3A 2VLMD 5ESQA 2BOBA 4EQ2A 4FFYL 4ZG1A 4WU7B 3ZT7A 3HAEB 4R3SA 4NJAL 4JRXD 4N8VB 3HTLX 2W9DL 1YYML 5A3ID 3BUYB 3ARBA 3VXSD 4F7TB 2HMIC 5LBSH 1XIWC 2X4TB 1NGZB 1IGCH 1DBBH 3LKNB 3PUCA 2Y5TA 3PWPA 2FX8H 1HXYB 3FMGH 4HMEA 4MDIA 3UYPA 1CDHA 3QIWA 3ULUD 1UACH 3L3DA 1IKNA 4RISH 1KTDB 1K4DA 4GW5B 5MI0C 4G6MH 1Q9KB 2VC2L 5CHNB 1T1XA 4YQXH 3RWDB 3V52L 1CXKA 3F6IA 4RMUA 2PTVA 4BK4A 3HPJA 5B8CB 4OLUH 2IBZY 1NCBH 1OW0C 2HJLB 1BAFL 4OV5A 4N0RA 2CLVA 1E4KA 3N1MC 4WHTB 4QRPB 4NQSB 1KELH 1FO0B 3EDJA 3T0BA 2O5XL 2DLIA 3W9EA 1XR8A 4FFZH 1NFDB 5TDOA 1WAAE 3OJVC 5I17B 2CXGA 2V6HA 4IRSD 5FCUH 5IHLB 5D5MB 2J4WH 1ES0B 4JDVA 5CKGA 3WN5C 3HC0A 2A6IB 4W81A 3GO1H 2OBGA 4F37K 3FO1A 5MP6H 3HZYB 4G8EA 4LHUB 4NO0B 2WIIB 4U1SA 4P2RA 3AREA 3AS3A 4P2QD 3GFUA 5JTWA 1UC6A 1QSFA 3CFEB 5E1AB 5D1ZA 5I8CB 3QIBA 3MLSL 2NLJA 4ISVA 3MRGA 4RGND 5EZOL 2P47B 4OD3L 4CMHB 5IEHA 5JXAL 4EDWL 5CS7A 35C8H 3VMOA 4M8QB 5E5UB 3ZKXC 4P2RD 2CUIA 4JFDD 4GLRH 5FOBA 4BH8A 5BRZD 4KQ3L 2CLVB 4X5WA 5IHBA 2R1XA 4C56A 4F7CB 4HZLA 3VG9B 4KI1A 4V1DD 3TBYA 3QI9A 1Y0LA 3MFFB 4J1UB 2FJGA 1MF2L 2BSSA 2N1KA 3V6FB 3SGEI 3RFZC 3QT2A 4PRHB 2C7UB 3LKPB 4CADA 1S5HA 3AROA 4N9GB 3QEQE 3CFCL 4AEEA 3MV11 1YPZE 4U1MA 5E2UL 3RKDC 4BM7A 1BAFH 1QRND 4PR5B 1YEIH 2Z4QA 4ZD3H 4TRPL 1IC7L 1WITA 4Y5YB 1AHWA 3EFDL 5D70H 2ARJQ 3S35L 3MBEB 2I27N 4HZAA 4H88L 1KCUH 4BYHA 2XOTA 3KVQA 5C0IA 3O8XA 3QDME 5IB5A 1HQ4A 1XF5B 1MEXL 1MFCL 1JWMA 4MNGA 2BNRB 2ADJB 4I18C 5CP7B 5J1AB 4DUWA 4ZUTB 3JXAA 4Z7WF 1ZWIA 4WUUB 3MLWL 4YK4C 4TVPH 3HPLA 1A1OB 4XTRC 3S37L 5C0GB 4P5MA 2EEAA 5FOBB 1BVZA 4LPYA 3WLWC 4DGYL 4HWZA 3ORJA 1ND0A 5M94B 1CT8A 3PWPD 1ZTXL 4ODXA 3CPLA 1EEZB 5D7KD 3U2SB 3H7BA 2GTZB 3QUMH 1P7QA 1P9MA 1ZHKB 3GSRA 3GB7B 1FGVH 2BVQB 4LF3B 5DD3H 4FFYH 5F3BA 3RWHB 1V3JA 5C6PB 1QSFE 1KJ2H 3ULVF 3T0WA 1NKRA 3NCYP 3SDAA 5LGKA 1H3PL 1F3JB 2DMCA 2C3XA 2AEQH 4HH9A 4I3RH 5D1QA 4FZEL 1IZKA 4QO1A 3G04A 3WD5L 2PW1A 5JMOC 1QBAA 1BFOB 3MLRH 4OM0L 4LKCA 1F4WL 1FV1B 1GVIA 4I5BA 5F6HI 4LCYA 4M3JA 3E6FB 4WHDA 4Z7VE 2VLLA 4C57C 3MACL 3OPZL 1F2QA 3CK0H 2YXFA 2FJFA 4MJ6B 5E5RB 4DK6A 3GBMH 4IEFB 1N0LA 2YEZB 3C5SA 3DX7B 4MJ5A 2X4SB 2PO6D 2EKSB 1XR9A 4LEXL 4ZNCD 5F7NC 1SYVB 3VFWB 4QHLA 5IQ9A 4ZAKD 3SDCA 1XF4A 3ARGD 3KDMB 3BP6A 4UUJB 1Z0NA 3QEQA 2BJML 4MZ2A 4KKBC 5TDOB 3WEXB 5CAYB 1CS6A 5IWLC 3FB6A 2AVGA 1WWAX 3CPLB 3T0ED 3TO4B 2XPGA 1JGVL 4G8GE 3W0WD 3WDIA 5IBLD 1WWWX 4HS8H 4AH2B 1IQWH 2B39A 1QLFB 1NDMA 1NCCL 4KWUA 1RU9H 2DM3A 4LAQH 2ZUVA 3KPQA 1VFBA 5EU3A 1CLOL 4FTVB 2VDLH 2DTMH 5BVPL 3ARSA 4G6AD 4LSUH 3I6KB 4FQXD 4J8RB 1WFUA 3DJ9A 1F6AB 1EGJH 1T21B 1OVZA 1YEGH 1GJIA 2HLAB 4X6DF 3JWOL 1ZHBB 2V9QA 3ZYOA 4F58H 3ROOA 2OP4H 4NKIH 4HKXB 5FUOL 1G7HB 1U8QB 1RVFL 5AYUH 1K9TA 1W0VB 1KBGH 5JW4R 3CFKB 5B38A 5ISZA 1E6JH 3LEYL 2IAMD 2Y25A 1M1SA 4M1GL 5KVGH 2AJSH 3CXHJ 5EC1A 4UQ3B 3BZEA 1H3TA 3C5ZC 1D9KA 2OSLB 2DL2A 5EU6D 3WNKA 2CLZB 4ZFOA 1I3RB 3RVXD 5F7WC 3D85B 1XEDA 1RJCA 4U49A 1VGEL 5E6YA 2ILLA 2HJKB 1P84J 1MI5E 4Z76B 3MX0A 5IVXF 1IC1A 5FUCC 3QZWA 5I1DA 2DMKA 1PY4A 2IAMB 3SN6N 3DIFA 2V7HB 4XC1H 4S2SA 1ZLVK 1U42A 3GKWH 2P24A 3TVMB 4AEIL 4NOFA 2W0FA 5EFIA 3RU8H 3DYPA 3UTSE 5BW7A 3BSZH 4PFEA 1NPUA 2F53D 1JPFA 4WJ5B 2HKHH 1ZHBA 4EI5B 4HGWA 3ZE0E 4YXHH 4XVSL 3DRQB 2EE2A 4XMPL 4PG2A 4FTVD 4CVUA 1QBMH 3LIZH 5IESL 2XQBH 3I75B 1E27B 3HC3H 3C09C 5EU5B 4KHXH 4OKVB 2F58L 3RZCA 3NH7H 2P42B 4LLDA 3OKKA 2VDKH 3F7PC 3OMZA 3V6ZB 1U8LB 1RIUL 3SKOB 2J2ZA 1YMME 1A6ZA 3GIZH 1JNNH 5FYJD 2A1WL 3VXSA 1QO3A 2EDYA 3C08H 1WF5A 4YBLB 1XGYH 4OLVL 43CAB 5SX5K 4X8JA 4G9FB 2Y7QA 4D8PB 5C0FA 1PGRB 1BWWA 1J1OL 5MEOB 3BO8B 4OD1H 1GZPA 2XTJC 1JGEB 1FH5L 3SE3A 4QLRA 4I0KA 1IKFH 3EYUH 3JWDL 4WI4A 4MDJA 4X6BA 4YR6B 2FWOA 4V2CB 3RJQB 5JXEA 1LE5B 5J11C 1PEWA 3VFSB 3DWTA 3BT2L 4NOBA 3O3BB 1LEKB 1MAMH 4NYLB 4LCWB 3T04D 1BX2A 5HHQA 2HTLC 3L3OB 1K4CB 4MJIE 4MXWH 3CDGB 4MJ6A 1CIDA 2B20A 5I6XC 4RBPH 5DO2C 5HDQH 1YEFL 1IAMA 1CD1B 2FIKB 1IGIH 1S9KC 5GRYA 4LVEA 3MTRA 1OSPH 3O2DA 5EWIH 5IR1B 3GIVB 5JORB 2NY7L 3ARZA 4XPGH 5F7EH 4ZS7H 3MRJA 3LQZA 1U6AL 4WGVB 4NN6C 4GRWF 2DQEH 2DKUA 4NPYB 1JPGA 5L2KA 3JTSB 1VGKB 1T5WA 3MJ9A 5IT2L 1LEGB 3ZL4L 2NZ9C 2YMXL 5IKCA 3MOBH 4OUOA 3L3IA 1NCWH 1MCOL 4D8PA 3WJJA 4AT6B 5D5MF 1F00I 3CMOL 4PJBF 2E6PA 1T66D 1JGEA 5HHOD 3BRGC 1UH3A 3C09B 4M6OH 1PG7L 5IP4A 2WNGA 4JM2D 4YAQB 5DJ8A 1KB5A 3DURA 1ZXQA 3P0GB 3LOWA 4OI7A 1IBGL 5KVDL 4F33A 3RL2B 2VXSL 1R5IA 2YUVA 4XB7A 1FYTD 2PKDA 4QXGL 3MGTB 4Y19D 2AEWA 4MCYB 3LB6C 2ADGB 4KXZI 3QSKB 4Z5RB 4IJ3C 1I8IB 1JZ4A 3KYNB 3GJFA 2EEDA 4PJ8A 2BXZA 4IMKA 4EOWL 2OX5A 4NM8H 4OCWL 4AM0A 4XC3L 4O51B 2F8VA 1YECH 1ZHKA 3GSRB 1JPSH 2OTUB 4J4PC 3K2UL 1L6XA 2E9JA 1LNUB 2WQ8A 2D3VA 3RWHA 2HVKA 1WFOA 3CU1A 3RTQC 4Q9RH 1BD2D 3RVUC 3BQUB 5FGCE 4XB8A 1IM9D 1INEH 4HIEB 4WFFD 2OR9H 1BFTA 2UVEA 1A7QL 5HY9B 5E8PA 2QL1A 4J6RH 1H3VA 2BVUA 3VRLF 4C4KT 3L3IB 1CGYA 2R9HC 4TSBH 3D39D 4WCYH 5C0AD 3U46A 2QSQA 3G6AB 4UMGA 2WINA 5IJVA 1QYGH 2ARWA 3RKDD 3BP5A 1D6EB 2Z9TA 5C1MB 2WUBL 2DI7A 3L5XL 5D7SL 2P5WD 3TT3H 4QXGH 4K2UL 1NH6A 4XPFH 2HH0L 4IRJC 5CBEA 1W8NA 4R7DA 3HAEG 4LHUD 5J1SC 1ZT7B 3LEXA 3RGVD 3WV0A 4M7ZB 1BJ1J 5CEYB 1RIHL 5HD8C 1GGBL 4ZDHB 1UT9A 3BEVA 1KJ3L 3X14B 4E0RB 4ZPTB 4YXKL 4YDIL 1WC7B 2WBJB 4JY5L 4WNQA 4ODWA 1U95B 1L0XA 3LN5B 4Z77A 2Z8SA 5CMAB 5EDXA 4QRPD 5E9DA 4R90L 4XCNB 4A2MA 4KKAD 1XGQA 4M7KH 1P7KA 2XXMB 3AY4C 5CINL 4APQC 4P46A 3C2SA 4ODSH 2UUDK 1KJMA 5EH1A 2VUOA 4JZOB 4RDQF 1WT5C 3ALWA 2IG2H 4LVNC 2HTKD 2KDGA 4TQEL 1CLZL 4YPGA 4DZBB 5D1XA 4FZ8H 4M9PA 1IQDA 2DQJH 3L9RB 3MJ8A 5FA4A 1FNAA 2A73A 4LKXB 4F57L 5JHDB 2UZXB 2XIDA 2Z8VC 4KI5E 1T1YA 2NY6B 3QUZA 1QFOA 4OGXL 1BQHG 3TT1L 3U2SA 5L8KB 3STZA 3EO0A 4KXZH 3FT3B 1Z9LA 1ZHLA 3W5NA 4OD1L 1CLYH 5C0ND 3H3BC 3LPGA 4YDVB 5E0QA 1R0AH 1GC1C 4XAWH 2XY1A 4HV8B 4KJPC 3V4VL 4L29A 1NEUA 3O9WA 2FJHB 1YY8A 4ZTOH 1NGXA 3RNQB 3OWEA 1QLRA 4M6NH 5IMLB 5E5MB 1P7HL 1SJHB 2A1WH 1D5XB 4X9FA 1INQA 3G04B 1T89C 3HE6C 3UTZA 1AP2A 1JF1A 2ZG2A 3DNKA 3EYSL 3HI6L 3VI3F 3ARFD 3TP4A 2QR0B 5I1HL 5IMKA 5I74C 1JI1A 3DTXA 3T1WA 1G6RH 1SY6L 4A6YL 2V7NB 4QHUA 5FYKU 3VXPB 5KS9E 4TNVF 5IGXL 4JO2H 1KJ2A 4UIKL 1DDHA 3QRFM 1UG9A 4LBEA 5E2VH 3OBAA 4PJ5B 4WGWB 3OJDA 1IVLA 4NRYB 1GCFA 1F90H 1WBYA 1QSFD 3OKMA 3HFMH 4KK6D 4DUVA 1G7MA 5IW6B 1Y6KR 2HN7B 3MV8A 1I9IH 3C87A 4Y4HC 5E9DD 2XXCB 3RU8L 1YEHH 5F1OB 1KCVL 4X4MA 3DECA 4F15B 3PP3H 3MRHB 2JF1A 3FO9B 5GIRA 3KYNA 5GGQH 3STZB 5F9OH 4LSSH 5C09E 3VJ6A 5J89A 3NIFF 2Q3AA 2UWEF 4Y8DC 5I18H 1EZVX 1NSNH 2FBOJ 5IBLC 3WHXB 3IJSA 1KTRL 4GRLA 4ONFL 4Y5VB 2OTWA 1TTUA 3KPQB 4ZO8A 4DGVH 4Q2ZA 4NJ9H 1MCCA 1IGYA 1Y6NR 3FAWA 3SDXE 4UT9H 1YPZB 5GSVA 3GI8L 4DWHA 4UIMA 1T03L 5DMYA 3QA3A 3O2DL 4Z78B 3KLAB 3IAGC 5D1ZB 2QHRH 5FYJE 1AR1C 1VSCA 3B2UC 3E3QC 4F7PB 2VZ1A 5E4IA 3SGJA 3KXFE 1A4KA 3MJ9L 3D39A 2EIZB 4G3YH 4LVHC 1ZHNB 1EUUA 1OTSD 4ZOBA 4LBEB 4GJTB 4X5LA 4XP5H 5ALCH 4HT1L 4RAUB 3NPZB 3EOBA 5DR5L 1M05A 3NZ8B 1HYRC 3ZDZE 1KCRH 1ED3A 1XGRB 2Z91B 5IBTH 4DN3L 4JHBA 5IROC 2FHBA 4PRBB 4YHIB 4DEPC 4F7CA 1FG9C 4EJ1C 4ETQA 1YN6A 2F8XC 5HI5C 5MEQA 2F9BT 2N7AA 3B9EA 5I1LB 1DQQB 2R2HA 5ESVA 2CPCA 1A4JB 3EIFA 4Q2ZB 5FO7B 2FECL 4KK5D 2W65A 3IKCB 5H94B 1RHHB 1LO0L 3SDXF 1JNLL 5EBWB 2VB5A 3PIQA 4F8QA 3QBTB 3TBWA 4Y19A 2Z31D 2E8ZA 4FOMA 4O4YH 3TWCL 1X5KA 4KROB 4XRCA 4CU7A 2VDML 1OT1A 4XNQB 1I3GH 4ORGA 1U2HA 4G8FA 2IJ0C 3CK0L 5EOCH 3NCBB 3RA7H 3MACH 2NY1D 2HJLA 2Y06H 1ZHNA 1QOKA 4XNYL 4LIQE 1TQBB 4F9LC 5J57B 4DVBB 4OM0H 1INDL 1ZOXA 1MWAA 4JQXA 3DUHA 1B4RA 4L4VB 1QNZL 1UYWL 2Q8BH 2HT3D 3HCVA 2DIAA 5MEND 3NACL 1G7JA 4MJ2A 12E8L 1SEBB 3DSFH 1IAII 1CGSL 4OZGB 2H6PA 4G5ZL 3ULUH 1SYSB 3IJHB 5EBMB 4HSQA 3S96B 2P7TB 4MXQD 5F3BB 4LPTA 2NY3D 1RJZB 2PYFB 1QBLL 2Q6WA 4DVRH 1D5MB 1TPXB 4C59B 3VG0H 5E6IA 1DQJB 3WS3B 1QBLH 3O41A 4BZYA 3MLWH 4ZFGH 5A1AA 4LLUB 1TQCC 3NTCH 5CGYC 3BIBX 4N0CC 5IMMB 5GGUB 4PRNA 1J5OH 2DLEA 2AK4B 2FDBP 1RD6A 2BP3A 5EULV 5FYLH 4DW2H 12E8H 3DSFL 3H9YA 2J5LC 3DLQR 4LVHB 4LASH 1AXTL 3B9VA 1MSPA 2A9MH 1NLBL 4U05A 3AM8A 2NY4D 3HC4L 1VKXA 1KEML 4X5WB 4TRPH 2C4FU 4N90D 2F54E 1EDQA 2QJDA 3QQ3A 5HJ3A 1FL5B 2OM5A 3ARBD 4Y1AB 5DMKA 1T7YA 3EHBC 1FO0H 4DGIL 3QUKB 1AE6L 5I1IL 3G6JB 2NY2B 4JFQA 4NKDA 5BVJA 1T1WB 1FFRA 3NCCB 5I1CH 5CMAA 4D0CA 5TF0A 2XN9B 2EKJA 2VDMH 4PUBH 4R97C 2NMSA 4O2FA 1FLRL 4UTBH 3C6SB 3KJ6H 1U92B 1MF2H 4KV5E 3F58H 2JCCA 1TQBC 3X12B 1MJ7H 1NCDL 1KLGA 1KFAH 3GSQB 1OP3K 1QSEB 3H8NA 4TNVK 5IK3B 3VA2C 3W2DH 3QHFH 4QGTA 4HWEH 3VRIA 4P4KA 5JA8B 1IL1A 1BQHA 1U3ZA 3KPRE 3L3HA 4JKMA 1TTFA 4LRIA 3OAYH 4YX2L 3U9PL 1PZUB 1NL0H 3BKYL 1OGAA 1IAOB 5GGVL 1I7RB 3DO7B 5EPMB 3H42H 3PNWB 1JCKA 1E4XL 4KDTC 4EDXB 5HI4C 1QFWL 4H0GA 4KK9C 3DO3A 5HGBA 1VDGA 2G75B 2OQJB 5GGTH 3VGDA 2VDPH 4WY7H 5KSBB 3M45A 2AJUL 2O93L 3S9DB 2GSIA 1TZHB 3KJ4C 4QHNA 5KZCB 4IIQC 2BVQA 2H32A 2JIXD 4LLQB 4TSAH 4XX1G 3UJTH 5CEZD 1SMOA 1TDQA 2R1YA 3DGGA 2XN9A 3T8XB 4TVPD 1YEEH 3MLXL 2YRPA 4JPWL 5FV1L 5A2LH 5I16B 1QLEL 2W0FB 1X6NA 2GHWB 1HILB 2D03L 4JZJC 3KXFB 3U0WL 4ESKA 3VH8G 4EN3D 1CFVL 1ERNA 1U91B 1V7NL 4AQ1B 5KN5A 3TNMB 1UFUA 5D8JL 2CJUH 4QNPE 3HAEA 5BJTB 3ZE2E 2ED9A 2AJXL 2BSTA 4PJAB 5T1KA 2AJ3B 1CFTA 1WTGT 5ELIA 4HC1L 3TBTB 3NCJH 4NO2A 3TNNA 1UB6B 4OKVA 3CIQA 1F3DH 4OJFL 1VHPA 4H25A 2GJ6B 2PXYB 4Z7WE 5I30L 1N5AA 1RZGB 1MHPH 3HFML 4X6CA 4F3FA 3S5LA 1Q8MA 1I8KA 3MLPA 4HXBL 4OLZH 2J7LA 3ULUF 4NZDA 3F7VA 3RHWK 4JO2L 5KVEL 1AJ7L 2A6KA 4FQIH 5IQ7H 4U6XB 3LDBB 2PO6A 1YECL 1OWRM 4PGBA 4PLOB 4NM8L 1LDPL 2GEEA 4GRMB 2GITA 3B2VH 4NWTH 1UZ8A 2V5SA 1HOCB 3GSUB 3BGAA 4F7EA 4WHCA 2D9QB 3QUXA 3HA0A 1J1PL 2OL3L 4DZBA 1T21A 2DD8H 3MJ6A 4DFHA 2VXQH 2Y6SD 2VXSH 1AIFB 4ZOCA 1U3HD 4CN4A 5B39B 4AL8L 5T33L 3OF6A 2ZOLA 1N0XL 2ZNXA 4P3DB 5DD5H 1F58H 2DBJA 4XVTH 4K94L 3VDCA 1R0AL 1F8TL 1PVHA 1KT2B 3VWJD 5C6WH 4JM2F 5CD3B 1W0WA 4S0SD 5J12B 3AVEA 4L8CA 4MNQB 5GJTH 1TZGH 3TT1H 2AJZA 3I50L 4LQ1A 5HHXL 2FR4A 5IEKA 5HYSB 1R3KA 3BZ4B 3RWEB 3MOBL 1ZGLB 2NXZD 3LKSB 4GRWE 4UNUA 4OGAD 3L7EA 5FA3A 2VN7A 2P49B 5D96B 3GIVA 1KIRA 4IOFD 4BKLB 4S1DC 3O11B 4NKOB 1TETH 1AO7A 4LPVA 3O4LD 1P4LA 3CUPA 4M5YL 1VFAA 2RHEA 5A2FA 4XT1C 1JIBA 5SX4H 1S3KL 2C5DC 4RRPA 2R0LL 1VERA 4NM4L 4OCSH 4R6UA 1P6FA 3GMPB 4CUCA 4KDVA 5DD1L 2YHGA 2XWTA 3L95A 3TZVB 4ZO6A 4YPJA 3N0PB 1KPUA 1FBIH 4UT6L 4C55A 2LE9A 4JY5H 3BT2H 1NFDE 1NLDL 4YXKH 1YY9C 3ARTA 4J3TA 4MJIA 1IL1B 1HNFA 5DF0A 5SWSD 1NC2B 3MROA 2P8MB 1A7OL 4GQPH 4L4TD 3BKJL 3BZFB 5I76A 1QKZH 1RUQL 5DMIL 3BP4A 1C8PA 3BYTA 3VH8B 3LB6D 2IBGA 1FH5H 2NY5C 1UM6L 4HWBL 1J8HE 4GKNB 1D9KD 1H3WM 5MENA 5DT1L 3BXNA 4JFHE 2VQTA 3ARVA 2JLLA 4WEUD 3NCFB 3PL6C 2CDFB 5J3HC 5JIIA 4KUZH 5J1TC 3FOMB 5IG7B 4XBGA 4H26B 5F1KC 4IDLA 1LO2L 3UZEA 5EIIB 3TV3H 4V1DA 3LH2L 4U0RC 1MJUL 3AUVA 2EH8H 2VLRB 2VN4A 3HRZA 4XCFH 3CGTA 3BZDA 1JRHL 4KHXL 3O3DB 5DEGB 2LU4A 1NCTA 4LL9A 5BV7C 2KZ1B 3QDGA 4FQXA 2WLYA 4XMPH 1XCTA 2Z31A 5B3JE 1FDLH 5JNYB 3QWOA 4KC3B 4PGJA 1JRHI 4KZEL 4KJYB 3QPXH 1NFIB 2MHAA 1WIPA 3ZHLA 1B2WL 4JQIL 5DSCB 2WWKT 3VFPA 5DHVB 2VXVL 3L5JA 5E24E 43C9B 4FQ1L 4GKZA 4WO4B 4RRPG 3LHPL 3RDTA 3SPVB 3BH9B 4N8CL 4OCWH 2D7TH 1Z5LA 1M7XA 4Z76A 3KWWA 4GG6E 1YNKL 3UCRA 1PZ5A 2ARJA 3DMMA 5J11B 4RGOL 1NKOA 1OP5H 2ZSWB 4H25B 2NR6C 2R8SH 3FOLB 4P23C 3MLVL 3S5LB 3RGHA 1JNJA 3ZE1F 1W2KT 1HHGB 5EN2A 3MUJA 5GSRB 3RVVC 1NJ9B 1R3IL 3LEYH 4OZGF 4EZMA 4Z7WB 3O2WL 1T80A 5EO0A 3RY6C 2P46B 3O3DA 5DEGA 1HH9B 5D5ME 1I8LC 3OAZK 1GSMA 2YPLD 3T0VA 2XQYK 4KJQD 1XCTB 3IETB 3BWAB 4P2OA 1ITCA 1A6AB 5AD0B 1RMFL 1HDMA 1KJVA 2VDPL 4TUJB 4GSDH 1LE9B 3QJFA 2CKBL 4FFWD 3X3GH 2DQCH 1MHHA 1V7ML 2DLGA 5DUMH 4U1HB 1I3UA 3Q5YA 4LLMB 1AO7D 1JPTH 1WEJH 3D2UA 1TZHA 2APVA 3H9SE 4QHNB 1TXKA 2OJEA 4X5XA 4QTHB 3QB7C 3SJVB 3GSNA 2XFXA 1T0NB 2I9LA 2BVPB 3UYRH 4HWEL 2DB8A 2VLJB 3HG1D 3RWFA 1YA5A 3PJSA 5TH2B 4H20L 1I1FA 3GUTB 2BCKB 2IEPA 3Q6FB 1IKFL 3EYUL 1LE5A 1I4FA 1I9EA 4ZSOE 2NZ9D 3C5ZD 3CFIC 2DDQL 1SEQH 4WO4C 3QDGD 1FLRH 3EZJB 1D5BB 1MFBH 3HNTH 1AGDA 4BQ6A 1QQDB 4ZFZB 4GRWH 1AKJB 1QFUH 4L4VE 3T3ME 5TGBB 1U9KA 1K4CA 1QRNA 3VFOB 1RI8A 4DFIA 3L6FB 3IU3B 3GIZL 4WHTA 1HDMB 1PJ9A 4DKDC 3N85H 4U6VL 1VFOA 5J6GB 1HINH 1JYNA 2PN5A 4QOKE 3W9EB 3I9GH 1M71A 4ELMB 3T2NH 1DUZB 5HHNA 5DJCB 4Y4KB 4OI8A 4Y5YC 4DKFL 3QUZD 4NZUL 3CU7A 1IGJB 1JHKH 1NAML 3T77A 2P8PB 2HRPL 4O2CA 4HCRL 3ZLQC 4Z6AT 1YJDH 4BZ2H 4EUPA 2CD0A 4UB0L 3BSZL 4OFIA 3RUGE 1QFPA 3MRMA 3D0LB 5K9QI 2CUMA 1R5WA 5D1XD 3BMVA 4ONOA 4WU5A 1MFDL 2I5YL 4YHMH 3GKWL 1A7NL 5F96H 4Y2DD 5CLTA 4U31A 5B39A 1VACA 4MCYA 3T0EC 4FQCL 5L0QB 4G5ZH 2M2DA 2WBJC 4QY8A 4M4PA 1L9MA 5KS9F 2MKLC 4M8QA 1FZKA 2R0WL 1GGUA 3V5KA 1JMXA 3VI3E 1N4XL 4QT5B 1EHLL 2GCYA 4RNRA 5D72L 5AYQA 3C6LD 1N6VA 4OQ1A 4QRQA 3MXWH 2W60A 4I4WB 4UV7H 4BQCA 4OB5L 5J7CC 3G5YB 3F5WB 1LP9A 4PJAF 2H32B 3EAKA 2IWGA 2VLME 4QRUA 4WO4D 4CN6A 3SE9L 5FUOH 1BZ7B 2OP4L 4MD4B 1ZV5A 1KEGL 1RZ7H 2ZSWA 4JRXE 3SGKC 4XI5C 4G7VH 5IVZB 4XNXL 3GI9L 1I1CA 4FTVA 5GS2H 4RGMB 2ADFH 3KR3H 3JWNC 3MCLH 5C0AA 5DJAB 5CZXC 5EOQH 1EHXA 1MRDL 2DM2A 3VFRA 1F5WA 5FV2A 1ZSDB 2QKIA 1E28B 1UM4L 2QSCL 4I77H 5EZOH 2Q87A 5E8NB 3C8DA 2IQ9L 1JFQL 3V2AR 1YMHA 2ICWB 2A83B 5DVOA 3BAEH 5D7JA 1A64A 2N56A 3DX9A 1CDJA 3PWUB 4KY1L 4POZD 1Q0XH 4DQOH 2APTA 2ERJB 3MMEB 3V6FA 2WK2A 5FHBL 3S3JA 8FABA 1IEHA 4XXCA 3MA9H 3QG6A 4K9EH 3H7BB 1NDGB 3U1SH 3FQXA 1OARH 3KYOA 4UT7L 1CL7L 5L88L 3MJ9H 3K8MA 2DYPB 3MRCA 5C0DB 1CD9B 1EV2E 1BM3L 3O3AB 3QDAA 3G6DL 3U7AA 4HQQH 3ZKND 1DVFD 4J3VA 3IFNH 2IPTH 4JZNA 3MC0A 2HG5B 1DCLA 1RY7B 3TBSA 2NCMA 5I1EH 3C60A 1GGCL 1UH4A 5F7MC 2X1XR 5C09A 4ONFH 5IHUH 2CMRH 4KKBD 3P30H 5F8QC 4EI5A 5I18L 4OFPA 1BIIA 1XH3A 2YWZA 4JZJB 3EFFA 4R4BA 2YEZA 4GRWB 5HSFA 1M05B 1CD8A 5DJXB 4JB9L 4PV8A 1JWSA 3TH3T 5D2NB 1ZGLA 1ZVSA 2LVEA 1EEZA 1S5HB 3QDMA 3IFPA 2HVJB 4TNWK 5EUOB 4LPUA 4F8TA 3GB7A 4Z7NE 3AAZB 3CUPB 1ZEAL 2FX8L 3FMGL 3KPPB 4TPRH 4U1GB 4PV9A 3SCMC 2A38A 3N9GH 3VWJB 4K7FA 1QA9A 4AY0A 4QOKA 3HMWL 7FABL 4PY8I 3MODL 4GW1A 3PWPE 2IH3B 3HI6H 1NMCB 5JXED 3OHXA 4OZGE 2BHYA 3KPSD 1OSZA 1YMMB 1YEIL 1M6OB 1TTGA 2HT4D 5I8KH 1C08A 4D0BB 4S1SL 5C0CD 3R8QA 4NQCB 4PB0H 1DVFA 1GGYA 5GZOD 3VXMD 4ORGB 4LLVB 3QO0B 4MA1C 4PREA 4WI3A 4PJHB 5HBBA 5HGDB 4AEHL 2GJ6E 5E8OB 4QXTB 4ODTL 1DL7L 1ZT4B 3SDAD 2XTJB 2AXGB 2GJ6D 2D0GA 3BPOB 3NZHH 4XH2B 3D3VD 4UT7H 5L88H 2V9TA 3PL6D 1OARL 1J9CT 3NIDE 3VXUB 4Z7NF 4DEPB 3RVVD 3SE4A 1A9BA 3MLTA 1PQZB 3A6BH 1RUAL 2H9GA 2G2RA 1E6OL 1GGIL 5BO1L 2IANE 1WZKA 2XQYG 4HIJA 4DJMA 2NR6D 3ARDA 4JR9L 5I16A 4PYGA 3O8XD 4NUGL 4Q0XH 1NAMA 3RY5A 3MV01 3FTGB 4BH8B 4UOW1 2R23B 3TZVC 1RZ8B 2GK0B 1CGTA 1GGBH 5B39G 3VFMA 2DRUA 3S88L 3VWJC 4X99A 3P0YH 4FMFA 2RCSL 1EEYA 3CFDB 1TPXC 5KSAD 1KEGH 1MAJA 5D71L 2X42A 2XRAH 3E0GA 5T1LA 4KKNA 4NNYB 4XP1H 1QPPA 1BP3B 2HH0H 4YHKL 5JA9A 5KVMC 3WHE0 5LG1A 1J8KA 3BW9B 4OZIB 3FO2B 2WANA 2VZTA 5ABDE 1C1EH 5D7SH 1N59A 3MXWL 1A6TA 4NCC2 5EC2B 4L5FL 1NCBL 5DQJB 4C56D 3NIGE 4U1GC 1EERB 2O61A 1BOGB 1RFDH 2XKSA 4KKLC 2VYRE 2YA0A 3FJTA 3Q5OA 4JPKH 2XNAB 3ESUF 1VEMA 2L0DA 2JJSC 4U7KA 5C0BD 4HJJH 1KLGB 3MRIA 4PJFE 4HUVA 1ZVHA 2X4QA 1GOGA 3QIUC 2F5AH 3QJFB 4JN1H 1QRNE 3WE6A 3MRLB 4NYLA 4PBXA 1LEKA 3RHWF 3MRKB 1N3NA 5IIEA 5GGSY 5LGJA 4OUUA 5ILTH 3H9HA 1EAPB 3T1FA 2CO7B 5F88B 4KVCH 4NJAH 3WIHH 4ZSOB 1U8MB 4GRLB 1R3KB 5AG8A 4MQSB 1SQ2N 4N1CA 1RQ5A 2V9RA 2I9LB 4PJAE 1T0MA 3UPAA 5C0FB 3MRBA 4FABL 3T09A 1AXIB 3BOVA 1HINL 1QRKA 5M95B 4MB4A 3VRJA 4W68A 3GRWA 1BQUA 3TFKC 5GS1A 3ARXA 3OGCB 5KSAC 1QFUL 3RUGA 2NXZC 2IGFH 1A5FH 4HIXL 3O6FB 3DX7A 4MJ5B 3VFTB 2LQRA 4UV4L 1LD9B 3UZVB 1UWXH 2H2PC 1FYHB 2CLRB 3O9WD 2DDQH 4MMZC 5F93C 5HHVH 3RL2A 1J86A 2FZ3A 4YNYB 3MJ8B 1IGMH 3HG1E 1UXSB 2ADFL 5CJOH 2O5YL 2Q86A 3BN9C 4OTXL 4PJHA 4ETQB 4ALAL 4OF7A 3UYRL 3IT8D 4UZGA 3TNNB 4RMQA 4MA8H 3KPMA 1FAIH 2CIIB 3FT3A 2BNQA 3D6GA 2E7LA 3T3MF 4OIIH 4MA7H 3OG6B 1L7IL 1FAIL 4BH7B 1ZA6A 2V2XA 4HLZH 2QQKH 4WEBH 1MPAH 2ORBL 1JPTL 4NT6B 4JRXA 1V7MH 1WK0A 3EHBD 2V2TA 1S7QA 2HFEA 4NO5B 4RX4A 3V0WH 1CK0H 4HUWA 4WEMB 4P9ML 3UJJL 3K8LA 5ETUB 1I85C 1RMFH 2PCPA 4WI5A 5I73C 2QADB 3F7RA 4YHOH 4AMKH 2IGFL 4ONGH 5D9SA 2GY5A 4YBQD 1I1YB 3QFJB 4CMMB 5CSBA 4YHYC 4K94C 3KHOA 2P8LB 5T5FL 2F15A 4DVBA 1PLGL 5D2LB 5EPMA 1OTSC 4HULB 3MRNB 1WIOA 2BVOA 1IC4L 4LNRA 2DBLH 2MJWA 4HDIB 4HKJB 4N8PA 2KUTA 4PJIB 2NX5A 1FFPA 3UO1H 4BFIA 3DPBA 4I8DA 1GIGH 3P77A 3HE6B 2NY6C 3MLVH 1D7FA 5GIRB 2FEEL 2AJZB 1T22A 4IM8A 1JHKL 4XVJL 4CW1A 3LZFL 3NAAH 2YPVL 2OMBA 3FFCE 4M43H 4JO1H 2IPKB 1U8NA 3OKEA 5E8PB 3D1MC 3QDJE 1YN7B 2D7TL 3ZTJG 3T4YB 5ILTL 3OHXB 1RZJC 1NBZA 2GY7B 5CJXA 4U6VH 3LKOB 4JHZA 1OWWA 3ARDD 3HZKA 3KPTA 4Y16C 3V5DB 1BFVH 1Q0YL 4NO5A 4GAGL 1OF2B 1IRAY 4Z78A 3GHEH 2F5AL 3T0XA 5T5FH 4DKAA 3ZHKA 2G5BB 3HR5A 1FL3A 4ONGL 1K8IA 1I8IA 1HQ4B 1XF5A 3ILPA 4NP4L 3GK8L 1SHMA 4RAUA 2KZWA 4NQUA 2F8OA 3OGOE 4I3GA 4Y5VC 4P9MH 2E5EA 3NFPA 1M7DA 1F4AA 4AG4H 5B3NA 4DKEL 2EH8L 3U0PA 3G9AB 5LKNA 1FNEA 3OZ9H 5JUEL 5ACZB 4L5FH 4N0UB 4UU9B 3QUKA 1A7PL 1FNLA 1S7SB 4NDMA 3MNVA 4F9PC 3S98A 2BSRB 3EYVA 3GMLA 4WI8A 3WS6C 5DC0A 1YPZF 4MA7L 5AYUL 2BC4B 4GKSB 1QFWI 1JV5A 1NGPL 2A6KB 3DROB 3P4LA 2P5ED 2EDBA 4OF3A 4EN3A 4MQXD 2RCSH 3B6SB 1NC4D 3U79A 4OTXH 4G8GD 4N1HB 1J0KA 1MQKL 2F74A 5KW9H 4MYWB 3HZMA 5D96C 4CDGC 3BKCH 3WNMA 1KYOK 1JYWA 2EDKA 1HNGA 1DFBL 3G5ZB 3HMXL 4FP8H 2RQ8A 4UBDD 1B0WA 2AQ2A 4JGUA 4YWGH 5F21B 3M17A 3QXDB 5D1ZC 1H3GA 5ID1B 1IQWL 5I73B 5E08H 2FYYB 1B9ZA 3IJYA 1FVEA 5E2WL 3CVIL 1RZFH 1XAUA 2XWBA 3UJIL 2DQFA 3Q2CA 4O58H 3MV9A 1F4XL 4K71B 4NCDA 1TIUA 4Y89A 1A6VH 2CRZA 2Y23A 4FABH 4E0RA 4HHAA 1QSEE 3BH9A 3WNOA 4MSWB 4MHHI 1E4JA 2VR9A 1NCNA 2XWJA 3CVHB 4I9WD 2APWA 4L8DB 3QI9C 2AABH 5EZIL 1K4DB 4GW5A 2NY6D 3MCKA 4RFOH 1BQLL 4PJ9A 3WO4C 4N5EC 4HWUA 1FLTX 1LO5A 4JGJA 1F11A 5HHXH 4KGLA 3ZKQD 1Z3GL 5ADOH 4C58B 3NGBC 4LRNH 1JF6A 1PD6A 1G9ML 4G8GB 3RWJB 3U36B 2V2TB 3PWVA 1LK3L 4QCIB 1F58L 1NUNB 4I3RL 2GSGA 4IJ3B 1ZS8B 4GMTH 2ZCHL 4AL8H 3O6MH 1P53A 5D7LA 2OMNA 3VXOA 1AQDB 4PJ7B 3RWGB 3MQIA 1HH9A 4XXDA 2ITCA 4P5TB 2DLTA 4UNVA 1I1YA 3O3UN 1KB9J 3HUJF 3K7UA 3QUML 2R2EB 2WBJD 4HWZB 2Q20A 4HKZA 1RURL 4TUJA 5JIPA 1LE9A 3G5VA 1DBML 3OJ2C 1QTYT 4MVBD 4KK6C 4ODXB 3I2CL 2B4CH 4J3UA 4L8BA 4OLYH 5CLWA 1G0YR 2GCYB 4RNRB 4PBVC 4KTDL 3ES6B 3MBEC 4NN7B 3RNKB 3CSPA 2BDNL 1AQKL 5IB1B 1DQLH 2GIYA 4S1DD 4GXUM 4JPVH 4E5XA 4PJ7F 1CDBA 3MV9D 1MEXH 4OZ4B 3WYRA 5GQBA 2JCCE 1TQCB 3CVHA 4S0TD 2XRAL 3LKQB 1OTUD 4M1DL 1P9MC 1GYAA 1OAKH 4JO3L 5D7IA 4PJ5E 1WJ3A 1MJJB 2PYEE 1FSKB 3CAFA 3MZGB 2EE9A 5TPWL 1D6EA 2QQLL 1IC7H 3TVMA 3SDAC 4R7NA 1FG2B 1WTLA 1NGWA 5H37G 3QO1A 5FGRA 1MCPH 1AI1L 5C0AB 1OGAE 5DSCA 5DHVH 4BFBD 2HN7A 1S78C 4QRTB 4FQ2H 4MXVF 4N5UA 3RDTB 3SPVA 1FL3B 1CBVH 3HE6D 2JIXA 3VJ6B 5SWZB 1E27A 1RUAH 3WUWA 4HS6A 3CH8A 4KRNA 4R96A 1BD2B 4WWKA 5EU6A 3TA3B 2ARJB 4X4XA 1VA9A 3R8BB 3NGBB 4U1MB 5FGSA 4M48H 1T2JA 3RPKA 1WIUA 3HCVB 3SGDI 4JJ5B 5JXAH 4WY7L 3TA3D 1LWRA 1W0YT 5GS0C 4IHOB 1TNMA 3GNML 1DANU 2J8OA 5J6HB 1BVKA 1QFWH 4P5TC 1FYTB 1PKQA 3ROLB 3UDWC 1UVQA 4ODTH 5K9JL 5B3JF 3MRIB 5E4EB 2HLAA 2X1WL 1N6QH 3L3GA 1XFPA 5L7XL 5AEAA 4P23D 3FCTA 2L7UA 1TVHA 4X7DC 5DRNB 5HDOA 1NC2A 3MROB 4LNRB 2YPLE 5I71B 2DD8L 3S4SA 1J1PH 1VACB 4PRNB 1P4IL 2B0SH 5EU7E 1Q9WA