1I1DA

Crystal structure of yeast gna1 bound to coa and glnac-6p
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
159
structure length
156
Chain Sequence
b'MSLPDGFYIRRMEEGDLEQVTETLKVLTTVGTITPESFCKLIKYWNEATVWNDKKIMQYNPMVIVDKRTETVAATGNIIIERKIIHELGLCGHIEDIAVNSKYQGQGLGKLLIDQLVTIGFDYGCYKIILDCDEKNVKFYEKCGFSNAGVEMQIRK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUCOSAMINE-PHOSPHATE N-ACETYLTRANSFERASE
publication title The crystal structures of Apo and complexed Saccharomyces cerevisiae GNA1 shed light on the catalytic mechanism of an amino-sugar N-acetyltransferase.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase
total genus 44
structure length 156
sequence length 159
chains with identical sequence B, C, D
ec nomenclature ec 2.3.1.4: Glucosamine-phosphate N-acetyltransferase.
pdb deposition date 2001-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1i1dA00
3DR6A 3DR8A 3S6GA 4K30A 2Q04A 4R87A 3JVNA 1BO4A 3EXNA 1NE9A 3DNSA 4NCZA 1QSNA 4B5PA 1P0HA 3W6SA 4MY3A 3IWGA 3G8WA 2P6FA 1S60A 5IX3A 2ATRA 4FD5A 2FXFA 2ZW5A 2Q7BA 4PK3A 3TCVA 1IIDA 2P0WA 1I12A 1WK4A 1NSLA 2VBQA 5C88A 1P4NA 2ZW7A 4UA3A 5DWMA 4F0YA 1I21A 3T90A 2B5GB 2OH1A 2D4PA 3ZZIA 3D2MA 4E2AA 1XF8A 3OWCA 3R1KA 4UWJA 2Q44A 3GY9A 2PDOA 5J8FA 2P6GA 4KOXA 2DXQA 1QSRA 3S6HA 4JXQA 3LODA 1Z4EA 4ZBGA 2OU2A 4AVCA 5KTDA 2QECA 4CRZB 2B3UA 2GIVA 3FXTA 2O28A 1VKCA 2B4DB 1KUYA 1VHSA 1B6BA 2QMLA 3DSBA 3S6FA 4FD7A 1RXTA 4FD6A 4PK2A 1WWZA 4M85A 2NMTA 5GCNA 2BSWA 5HH1A 4DNCA 2AJ6A 3I3GA 2WPWA 5I0CA 2BL1A 1TIQA 2ARHA 2PQ8A 2R98A 3NE7A 4NXYA 5DWNA 3TT2A 5JQ4A 1XIXA 4RI1A 5F46A 3R9GA 4MI4A 5F49A 2H5MA 2VEZA 1NMTA 1N71A 2GANA 4Y49C 4KOVA 3PP9A 4KORA 1IYLA 2G3AA 1KUXA 3P2FA 4R3KA 1XE4A 2QIRA 3JUWA 4H6UA 1L0CA 1YR0A 1I1DA 3D3SA 2ZPAA 4HNWB 2P6EA 2EUIA 5EBVA 1MJAA 4LX9A 4L8AA 2G0BA 3UY5A 2Z0ZA 4CAVA 4Y49B 2X7BA 3G3SA 2ZW6A 3EC4A 2VZYA 3F8KA 4NEXA 2VQYA 2REEA 4R9MA 2FS5A 3FNCA 3BJ8A 2G3TA 3WR7A 2BEIA 2JLMA 1QSMA 3K9UA 4KOSA 2VZZA 2JDCA 3P2HA 4NSQA 3TOAA 4HNXB 4H6ZA 4ORFA 1OZPA 5E96A 4KUBA 3D8PA 4OAEA 1MJBA 2BUEA 1S7LA 2VI7A 2Q4VA 4PSXA 4PV6A 1UFHA 4XNHC 2B5GA 1KUVA 5F47A 1IB1E 4B5OA 4YFJA 3FIXA 1K4JA 2R8VA 3R96A 5F48A 1FY7A 1S7FA 4R57A 2C27A 3CXQA 3H4QA 4OADA 4XNHB 2B4DA 2EVNA 5H86A 2OZUA 4E0AA 1XMTA 3VWDA 2HQYA 2AE6A 2J8RA 3LD2A 2PR8A 4X5KA 5H84A 4CAXA 1Q2CA 1Z9UA 2B4BA 1BOBA 1MJ9A 3F5BA 3EO4A 5JPHA 4M3SA 4UBRA 4ONUA 4QUSA 4KZTA 3PGPA 4PSWA 3N7ZA 4FD4A 1M4DA 2Q0YA 4U5YA 4AVAA 1MK4A 4XPKA 2ZW4A 2R1IA 4XPDC 2FT0A 4F6AA 3R95A 2HV2A 1IICA 4YRHA 2B58A 2FL4A 2JDDA 2J8MA 3RYOA 1S7NA 2Y0MA 2Z10A 3VWEA 3B8GA 3TO9A 2PSWA 1YREA 4AB7A 2CNTA 4NF1A 1YVOA 4XPDB 4HNYB 3R9FA 2K5TA 3PZJA 4JWPA 2Q4YA 2OB0A 1IYKA 4MHDA 1PUAA 1Y9WA 3GYAA 4IF5A 4U9YA 4KLVA 2A4NA 4AG9A 4XPLA 1S3ZA 3EFAA 2OZGA 5J8CA 1R57A 4MY0A 4KLWA 3E0KA 1M1DA 1RO5A 3FYNA 4UWIA 5FVJA 3TO6A 3IGRA 3W6XA 5KTCA 3TFYA 2FIWA 4JXRA 4E8OA 1S5KA 3I9SA 1Y9KA 3SXNA 1KZFA 1QSOA 4CRYB 2F5IA 3D2PA 4KOTA 3FBUA 2B3VA 3CXSA 2I79A 2CNSA 4II9A 3C26A 3W91A 3ZJ0A 4J3GA 3TTHA 4QC6A 1YX0A 4MBUA 1YLEA 1V0CA 2HUZA 2WPXA 1Q2DA 4MJ8A 4I49A 4B5PB 1LRZA 2FE7A 1GHEA 1M4GA 2FSRA 5IV0A 4H89A 1YVKA 2PC1A 3GKRA 4BMHA 3CXPA 5ISVA 2ZXVA 4KOWA 4IUSA 5CNPA 4EVYA 3BJ7A 4U9ZA 1B87A 3S6KA 2D4OA 2GE3A 5C82A 4KOYA 4LUAA 3SHPA 2FIAA 2I00A 3FRMA 1Q2YA 4KOUA 5IB0A 4R3LA 3QAHA 3DDDA 1YK3A 1QSTA 1J4JA 3FB3A 2FCKA 4CAWA 1M4IA 3MGDA 2REFA 4HKFA 3F0AA 1S7KA 3QB8A 1YGHA 4QBJA 5EC4A 3SXOA 2PRBA 1XEBA 5KTAA 2CY2A 2CNMA 4JLYA 4KVXA 4KVOE 2VXKA 3TO7A 5HMNA 1Y7RA 1CJWA 3TOBA 2PR1A 2J8NA 1M44A 2OZHA 1SQHA 1U6MA 3V8IA 2KCWA 4GS4A 2Z11A 2R7HA 3TE4A 4AG7A 3KKWA 3R9EA 3T9YA 4OLLA 4YGOA 1Z4RA 4KUAA 4JD6A 3EY5A 1CM0A 4L89A 1ON0A 4KVME 4JJXA 3BLNA 4CS0B 2RC4A 4RS2A 2JEVA 4AVBA 4QVTA 4QB9A 2IL4A 1PU9A
chains in the Genus database with same CATH superfamily
2ODFA 3DR6A 4F8ZA 2PE3A 1X12A 2RFHA 2Z3KA 3DR8A 3MN8A 5DS0A 2OOTA 3S6GA 1NSAA 3PBBA 4K30A 4PQAA 4TNUA 4CAEA 2Q04A 4K3NA 3GIUA 2ZEMA 4NFRA 4P10A 1YMEA 2J9AA 4R87A 4CAFA 3JVNA 4B12A 2PJAA 1BO4A 3RZAA 5HVGA 3EXNA 1NE9A 3DNSA 4NCZA 1QSNA 5LYDA 4B5PA 1UWYA 5JM6A 1P0HA 4OP4A 3W6SA 4MY3A 3IWGA 4EMEA 3G8WA 4OC4A 2P6FA 1S60A 8CPAA 5IX3A 2ATRA 4FD5A 2FXFA 2ZW5A 5LRKA 2Q7BA 4PK3A 4UEEA 3TCVA 1IIDA 1BAVA 3D67A 4WJBA 3SJGA 2P0WA 1I12A 1WK4A 3H8GA 3D7HA 1NSLA 2Z3MA 4X3RA 5JH9A 2VBQA 5C88A 1P4NA 4EWTA 3IWWA 2ZW7A 2PJ7A 4UA3A 4PXEA 4FBEA 1ARLA 1VHEA 5DWMA 4F0YA 1ELLP 1I21A 5LRJA 2O53A 3BHXA 3HUVA 3T90A 4B6ZA 2B5GB 2OH1A 4B11A 2D4PA 5JGFA 3ZZIA 4B13A 1R3NA 1VIXA 3D2MA 1H8LA 1QQ9A 3KGQA 4MCPA 1LCPA 4E2AA 4OIWA 1XF8A 3OWCA 3R1KA 3DLJA 1JQGA 4UWJA 2Q44A 3GY9A 2PDOA 4A37A 4A31A 2AFUA 5J8FA 2P6GA 4KOXA 2DXQA 3IIBA 4F0XA 2YNDA 1QSRA 5EMIA 3S6HA 4JXQA 3VATA 1TXRA 1Z4EA 2EWBA 2F8HA 2OU2A 2Q4ZA 3LODA 4ZBGA 4AVCA 3B3VA 4C2ZA 5KTDA 2EK9A 2QECA 4CRZB 4NJQA 4MXUA 2B3UA 4BD9A 2GIVA 2PJBA 2IQ6A 3FXTA 3LACA 2O28A 2Q7SA 3GLJA 1VKCA 2B4DB 4MFQA 2Z3NA 1KUYA 3RNZA 1CPXA 1VHSA 1B6BA 2QMLA 3DSBA 2Q51A 3S6FA 4FD7A 2V8HA 1RXTA 4FD6A 1YQEA 1WWZA 3CZXA 4PK2A 2QVPA 4M85A 2NMTA 5GCNA 2BSWA 4FUUA 5HH1A 4DNCA 2AJ6A 5LYLA 3TC8A 3I3GA 4MHNA 2PCUA 2WPWA 5LYIA 4ZY1A 2CTCA 5I0CA 4Q38A 2Z3LA 1DTDA 2BL1A 5F09A 1TIQA 2ARHA 2PQ8A 4LQ6A 2R98A 3NE7A 4C7HA 3IO1A 1YSJA 4NXYA 3IEHA 5DWNA 3TT2A 5JQ4A 3PB6X 3PEIA 1XIXA 1CP7A 2FVGA 4KSFA 4P6YA 4RI1A 4W9YA 5AG6A 3R9GA 3JTKA 4MI4A 5F49A 4A2ZA 2H5MA 1Y0YA 2V8DA 2VEZA 4C7IA 4YU9A 1XRYA 3B2YA 4R6TA 5HVFA 3GUXA 2WUUA 1NMTA 2IMOA 1N71A 2GANA 3SJFA 4Y49C 2NSMA 4KOVA 3PP9A 4KORA 1IYLA 2G3AA 2PJ0A 4NGQA 1OBRA 1KUXA 2EBJA 3P2FA 3WT4A 2NYQA 4R3KA 4Q7AA 4JYWA 3I1UA 1XBUA 2HC9A 1CBXA 1XE4A 1YW6A 2QIRA 3JUWA 5G22A 4H6UA 1L0CA 1YR0A 1I1DA 2JBJA 3S9MA 4ZI6A 3D3SA 2ZPAA 3B3CA 3IJ3A 2PJ4A 1Y0RA 4HNWB 3FX6A 4UCNA 2P6EA 1BLLE 2EUIA 5EBVA 1MJAA 3H5ZA 4IHMA 5I4MA 2VL1A 4NGTA 4LX9A 4A32A 1ZO0A 4KS9A 4L8AA 2G0BA 3UY5A 2Z0ZA 4CAVA 3FEEA 5AG7A 4FAIA 4B14A 4Y49B 2X7BA 1HDUA 1Z2LA 3G3SA 3H8FA 2ZW6A 3EC4A 2VZYA 5A27A 1F57A 3F8KA 2OR4A 4P45A 1F2OA 4NEXA 2GLJA 2VQYA 2YNCA 2F7VA 3QNVA 5CBMA 1TKFA 3B35A 2REEA 2V8VA 4MHPA 2FS5A 1LFWA 4NJRA 4R9MA 3RO0A 1PCAA 2RB7A 1YW4A 2V8GA 3CT9A 3FNCA 3BJ8A 4OIDA 2ZEGA 2G3TA 3KASA 4OC5A 1LAPA 3WR7A 4C2YA 1AUGA 2AFXA 2BEIA 2JLMA 4JZ0A 1QSMA 3K9UA 3NFZA 1GYTA 2DPTA 3CPXA 3GB0A 2VZZA 2JDCA 3P2HA 4KOSA 4NSQA 3WC6A 2CTBA 4PPZA 4WWVA 3TOAA 4HNXB 4H6ZA 2GFQA 4ORFA 1OZPA 5E96A 2IJZA 4KUBA 3D8PA 4OAEA 2AFWA 5D29A 1MJBA 2BUEA 3FH4A 2ANPA 1S7LA 3PB4X 2VI7A 1CP6A 2Q4VA 4PSXA 4PV6A 1UFHA 4XNHC 2B5GA 4OKOA 1HEEA 4A38A 4Q36A 1KUVA 5F47A 2EK8A 3V7ZA 1IB1E 4B5OA 2QYVA 4UIAA 4M6GA 1ZLHA 4G1PA 4A39A 4YFJA 3FIXA 4LQGA 1K4JA 2R8VA 3IWEA 3R96A 4MFKA 5THWA 1CG2A 5F48A 1FY7A 4CPAA 5A28A 2G9DA 3D68A 1S7FA 4R57A 2C27A 3CXQA 3H4QA 3NE8A 2ZELA 4HPSA 4KSAA 4OADA 2PVVA 4XNHB 3V38A 4OMEA 4ZYQA 1LANA 2B4DA 1F2PA 2EVNA 2I3CA 5H86A 2OZUA 4MRIA 4PXCA 3NH4A 4GXHA 4E0AA 1XMTA 3VWDA 2HQYA 2BO9A 4P4IA 5F46A 2AE6A 2J8RA 3FJUA 2ZEPA 3LD2A 3K2KA 2PR8A 4X5KA 5CPAA 5H84A 4CAXA 2AFMA 1Q2CA 1Z9UA 4FWUA 2B4BA 5LRGA 1Z8XA 1BOBA 1MJ9A 3F5BA 3EO4A 6CPAA 5JPHA 3WABA 3NH5A 4M3SA 2GREA 1JWQA 4UBRA 4ZX8A 1KWMA 4A95A 4ONUA 4OC3A 4NGRA 1LAMA 1ZG8A 3PRTA 2PIYA 1LOKA 3BI0A 4MCSA 4QUSA 2CF4A 3IC1A 3TX8A 5K8OA 2POKA 4CGNA 3IU1A 4KZTA 3PGPA 4PSWA 3N7ZA 4FD4A 5HVHA 1M4DA 1XOVA 2Q0YA 4U5YA 3D4UA 5AG4A 5BWAB 3FMCA 4AVAA 1MK4A 2HB6A 3PB9X 4P4DA 3SJEA 4CYNA 4XPKA 1CX8A 3RAMA 4ZGYB 2Z3PA 2ZW4A 1XJOA 2R1IA 4MCQA 1IGBA 4XPDC 2BCOA 2FT0A 4C2XA 3R95A 4F6AA 1XMBA 2HV2A 1IICA 4CGLA 2C6GA 4YRHA 2B58A 4UIBA 2FL4A 1Y7EA 2PIZA 2JDDA 1ELMP 2J8MA 3RYOA 4DJLA 1S7NA 1ARMA 2Y0MA 2Z10A 1QMUA 3N5FA 3VWEA 3WC5A 3B8GA 4ONWA 2GU2A 1TKHA 1R43A 3S9LA 3TO9A 2PSWA 1RTQA 1Q7LA 1YREA 2CNTA 3FEDA 4NF1A 4AB7A 1YVOA 4NGMA 4XPDB 4IAVA 5LYFA 1IOIA 1IY7A 4HNYB 3R9FA 4MFZA 2K5TA 3PZJA 1FNOA 4JWPA 1AYEA 2Q4YA 4MHZA 3L2NA 3ISZA 3D7FA 3KI9A 3VARA 2OB0A 1IYKA 4MHDA 3QAYA 1PUAA 1Y9WA 3GYAA 5G1ZA 4IF5A 2C6CA 4R8FA 4U9YA 5AG5A 2AFSA 2ZEHA 4KLVA 4OC2A 2A4NA 3MRUA 4AG9A 4XPLA 2EO8A 1S3ZA 4F9UA 2XEGA 3EFAA 4MCRA 3IU2A 2OZGA 3NA6A 4DUKA 4ZX9A 1R57A 2O4HA 5J8CA 4UFVA 4MY0A 2PJ1A 3PBEA 4KLWA 4RN7A 2CIJA 2YNCC 3E0KA 4UCMA 1M1DA 1RO5A 1Z8TA 3FYNA 3LMSA 3FVLA 4UWIA 5FVJA 3B3SA 1DE4C 3TO6A 1ZLIA 4P44A 3IGRA 2XEJA 3W6XA 5KTCA 3TFYA 4DYOA 2FIWA 4BINA 4JXRA 4UEFA 4E8OA 1S5KA 2Q43A 3I9SA 2ZEFA 3KQZA 4OC0A 1Y9KA 1VGYA 3S9NA 3SXNA 2DEAA 3D7DA 1KZFA 2DF5A 3LWUA 4PXDA 1QSOA 4YWYA 3PB8X 4P4EA 4CRYB 2F5IA 2PJ2A 3D2PA 4KOTA 3FBUA 2B3VA 3CXSA 3CDXA 4Z65A 4CYPA 4GM5A 2CNSA 2YNEA 4B10A 4II9A 3C26A 5ELYA 1Z8WA 4PXBA 3SJXA 3W91A 3ZJ0A 4J3GA 4A33A 3TTHA 4QC6A 1YX0A 2DPSA 2PJ8A 3KZWA 5K8MA 1TKJA 4MBUA 1YLEA 4AXVA 1V0CA 2GLFA 1CPSA 2HUZA 1IOFA 2IL4A 4P4FA 4BBHA 3KR5A 2PJ9A 2PJ5A 2WPXA 1Q2DA 4MFPA 1Z5RA 4NGNA 5G20A 1YLOA 3KL9A 4I49A 4MJ8A 2AFOA 4B5PB 2ABZA 1LRZA 4RUHA 4MMOA 4ZY0A 3PB7X 2FE7A 1GHEA 1M4GA 2FSRA 2Z3OA 2ZEEA 4H89A 1YVKA 5IV0A 2PC1A 3GKRA 2ZENA 4BMHA 3CXPA 5ISVA 2ZXVA 4KOWA 4UFXA 2PVWA 2PJ3A 4IUSA 5CNPA 4EVYA 3IFEA 3FF3A 1BPNA 3BJ7A 4A94A 4U9ZA 3VH9A 1B87A 3S6KA 2D4OA 4A30A 2GE3A 5G21A 2ZOFA 3WC7A 5C82A 1PYTB 4KOYA 4EFDA 4LUAA 2YGWA 4UCPA 1TF8A 4CGPA 4IK2A 1X10A 3SHPA 2JEWA 2JBKA 2FIAA 3ISXA 2I00A 4F9VA 3FRMA 1Q2YA 2C1CA 3BXMA 4KOUA 4MFJA 4P4BA 5IB0A 4R3LA 2WSAA 2QJ8A 1Z8LA 3QAHA 4M6HA 3DDDA 5D8NA 1XFOA 5HXDA 1YK3A 2XEFA 3KR4A 1QSTA 4NGPA 1J4JA 2ZEOA 3FB3A 5AGEA 2FCKA 4CAWA 1M4IA 1IU8A 3MGDA 2REFA 4MFLA 4HKFA 1FT7A 4MHYA 4OC1A 3F0AA 4X8IA 1S7KA 2CXAA 5K8PA 4C68A 2ZOGA 5K8NA 3QB8A 4UFWA 4R76A 7CPAA 1YGHA 3KQXA 3FECA 4QBJA 3HLPA 5EC4A 3H8EA 1EE3P 3SXOA 3B3WA 2PRBA 1XEBA 5KTAA 2CY2A 2V77A 2ZEDA 2AFZA 2CNMA 4JLYA 4KVXA 4KVOE 4CGMA 4H2KA 2VXKA 4UEZA 1AMPA 1BPMA 2WYRA 4KSIA 2XEIA 3B7IA 3TO7A 1HDQA 5IB9A 3CPAA 2PJCA 1VHOA 2PJ6A 5HMNA 1Y7RA 3K9TA 1CJWA 1TF9A 4ZY2A 3TOBA 2PR1A 2J8NA 1M44A 4M6IA 2OZHA 5J1QA 1M4LA 4CYQA 1SQHA 1U6MA 3V8IA 3DGVA 2KCWA 3SI0A 4R7MA 3JRUA 2WZNA 4GS4A 3BI1A 2Z11A 3RBUA 2R7HA 3TE4A 2BOAA 3PFOA 4AG7A 3KKWA 3NH8A 3R9EA 4O23A 3D66A 3T9YA 3SI2A 4OLLA 3B3TA 3KHZA 4TWEA 3T8WA 4YGOA 1Z4RA 4KUAA 4JD6A 3EY5A 1CM0A 4L89A 1A2ZA 4CYOA 1ON0A 2PRQA 3BLNA 4JJXA 4KVME 4NGSA 4X2TA 2RC4A 3SI1A 4UF4A 4CS0B 3D7GA 4RS2A 4CGOA 2JEVA 4AVBA 3KHXA 2C6PA 1ZG9A 3PFEA 4P4JA 4QVTA 1ZG7A 4QB9A 3A9LA 2I79A 1PU9A
chains in the Genus database with same CATH topology
3DR6A 2Z3KA 3DR8A 3S6GA 4CAEA 4K30A 2Q04A 4R87A 4CAFA 3JVNA 4B12A 1BO4A 3EXNA 1NE9A 3DNSA 4NCZA 1QSNA 4B5PA 1P0HA 3W6SA 4MY3A 3IWGA 3G8WA 2P6FA 1S60A 5IX3A 2ATRA 4FD5A 2FXFA 2ZW5A 2Q7BA 4PK3A 3TCVA 1IIDA 2P0WA 1I12A 1WK4A 1NSLA 2Z3MA 2VBQA 5C88A 1P4NA 2ZW7A 4UA3A 5DWMA 4F0YA 1I21A 3T90A 2B5GB 2OH1A 4B11A 2D4PA 3ZZIA 4B13A 3D2MA 4E2AA 1XF8A 3OWCA 3R1KA 4UWJA 2Q44A 3GY9A 2PDOA 4A31A 5J8FA 2P6GA 4KOXA 2DXQA 4F0XA 2YNDA 1QSRA 3S6HA 4JXQA 3LODA 1Z4EA 4ZBGA 2OU2A 4AVCA 5KTDA 4C2ZA 2QECA 4CRZB 2B3UA 2GIVA 3FXTA 2O28A 1VKCA 2B4DB 4MFQA 2Z3NA 1KUYA 1VHSA 1B6BA 2QMLA 3DSBA 3S6FA 4FD7A 1RXTA 4FD6A 4PK2A 1WWZA 4M85A 2NMTA 5GCNA 2BSWA 5HH1A 4DNCA 2AJ6A 3I3GA 2WPWA 5I0CA 4Q38A 2Z3LA 2BL1A 1TIQA 2ARHA 2PQ8A 2R98A 3NE7A 4C7HA 4NXYA 5DWNA 3TT2A 5JQ4A 5AG6A 1XIXA 4KSFA 4RI1A 5F46A 3R9GA 3JTKA 4MI4A 5F49A 4A2ZA 2H5MA 2VEZA 4C7IA 2WUUA 1NMTA 1N71A 2GANA 4Y49C 4KOVA 3PP9A 4KORA 1IYLA 2G3AA 1KUXA 3P2FA 4R3KA 1XE4A 2QIRA 3JUWA 5G22A 4H6UA 1L0CA 1YR0A 1I1DA 3D3SA 2ZPAA 4UCNA 4HNWB 2P6EA 2EUIA 5EBVA 1MJAA 3H5ZA 4LX9A 1ZO0A 4KS9A 4L8AA 2G0BA 3UY5A 2Z0ZA 4CAVA 5AG7A 4B14A 4Y49B 2X7BA 3G3SA 2ZW6A 3EC4A 2VZYA 5A27A 3F8KA 4NEXA 2VQYA 2YNCA 2REEA 4A32A 4R9MA 2FS5A 3FNCA 3BJ8A 2G3TA 3WR7A 4C2YA 2BEIA 2JLMA 1QSMA 3K9UA 2DPTA 4KOSA 2VZZA 2JDCA 3P2HA 4NSQA 3TOAA 4HNXB 4H6ZA 4ORFA 1OZPA 5E96A 4KUBA 3D8PA 4OAEA 1MJBA 2BUEA 1S7LA 2VI7A 2Q4VA 4PSXA 4PV6A 1UFHA 4XNHC 2B5GA 4Q36A 1KUVA 5F47A 1IB1E 4B5OA 4YFJA 3FIXA 1K4JA 2R8VA 3IWEA 3R96A 4MFKA 5F48A 1FY7A 5A28A 1S7FA 4R57A 2C27A 3CXQA 3H4QA 4KSAA 4OADA 4XNHB 2B4DA 2EVNA 5H86A 2OZUA 4E0AA 1XMTA 3VWDA 2HQYA 2AE6A 2J8RA 3LD2A 2PR8A 4X5KA 5H84A 4CAXA 1Q2CA 1Z9UA 2B4BA 1BOBA 1MJ9A 3F5BA 3EO4A 5JPHA 4M3SA 4A95A 4UBRA 4ONUA 4QUSA 4CGNA 3IU1A 4KZTA 3PGPA 4PSWA 3N7ZA 4FD4A 1M4DA 2Q0YA 4U5YA 5AG4A 5BWAB 4AVAA 1MK4A 4CYNA 4XPKA 4ZGYB 2Z3PA 2ZW4A 2R1IA 4XPDC 2FT0A 4C2XA 4F6AA 3R95A 2HV2A 1IICA 4CGLA 4YRHA 2B58A 2FL4A 2JDDA 2J8MA 3RYOA 1S7NA 2Y0MA 2Z10A 3VWEA 3B8GA 3TO9A 2PSWA 1YREA 4AB7A 2CNTA 4NF1A 1YVOA 4XPDB 4HNYB 3R9FA 4MFZA 2K5TA 3PZJA 4JWPA 2Q4YA 2OB0A 1IYKA 4MHDA 1PUAA 1Y9WA 3GYAA 5G1ZA 4IF5A 4U9YA 5AG5A 4KLVA 2A4NA 4AG9A 4XPLA 1S3ZA 3EFAA 3IU2A 2OZGA 5J8CA 1R57A 4UFVA 4MY0A 4KLWA 2YNCC 3E0KA 4UCMA 1M1DA 1RO5A 3FYNA 4UWIA 5FVJA 3TO6A 3IGRA 3W6XA 5KTCA 3TFYA 2FIWA 4JXRA 4E8OA 1S5KA 3I9SA 1Y9KA 3SXNA 1KZFA 1QSOA 4CRYB 2F5IA 3D2PA 4KOTA 3FBUA 2B3VA 3CXSA 4CYPA 2I79A 2CNSA 2YNEA 4B10A 4II9A 3C26A 3W91A 3ZJ0A 4J3GA 4A33A 3TTHA 4QC6A 1YX0A 2DPSA 4MBUA 1YLEA 1V0CA 2HUZA 4BBHA 2WPXA 4MFPA 1Q2DA 5G20A 4MJ8A 4I49A 4B5PB 1LRZA 2FE7A 1GHEA 1M4GA 2FSRA 2Z3OA 5IV0A 4H89A 1YVKA 2PC1A 3GKRA 4BMHA 3CXPA 5ISVA 2ZXVA 4KOWA 4UFXA 4IUSA 5CNPA 4EVYA 3BJ7A 4U9ZA 1B87A 3S6KA 2D4OA 4A30A 2GE3A 5G21A 5C82A 4KOYA 4LUAA 2YGWA 4UCPA 4CGPA 3SHPA 2FIAA 2I00A 3FRMA 1Q2YA 4KOUA 4MFJA 5IB0A 4R3LA 2WSAA 3QAHA 3DDDA 1YK3A 1QSTA 1J4JA 3FB3A 5AGEA 2FCKA 4CAWA 1M4IA 3MGDA 2REFA 4MFLA 4HKFA 3F0AA 1S7KA 2CXAA 4C68A 3QB8A 4UFWA 1YGHA 4QBJA 5EC4A 3SXOA 2PRBA 1XEBA 5KTAA 2CY2A 2CNMA 4JLYA 4KVXA 4KVOE 4CGMA 2VXKA 3TO7A 5HMNA 1Y7RA 1CJWA 3TOBA 2PR1A 2J8NA 1M44A 2OZHA 4CYQA 1SQHA 1U6MA 3V8IA 2KCWA 4GS4A 2Z11A 2R7HA 3TE4A 4AG7A 3KKWA 3R9EA 3T9YA 4OLLA 4YGOA 1Z4RA 4KUAA 4JD6A 3EY5A 1CM0A 4L89A 4CYOA 1ON0A 3BLNA 4JJXA 4KVME 4CS0B 2RC4A 4RS2A 4CGOA 2JEVA 4AVBA 4QVTA 4QB9A 3A9LA 2IL4A 1PU9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DR6 A;  3DR8 A;  3S6G A;  4K30 A;  2Q04 A;  4R87 A;  3JVN A;  1BO4 A;  3EXN A;  1NE9 A;  3DNS A;  4NCZ A;  1QSN A;  4B5P A;  1P0H A;  3W6S A;  4MY3 A;  3IWG A;  3G8W A;  2P6F A;  1S60 A;  5IX3 A;  2ATR A;  4FD5 A;  2FXF A;  2ZW5 A;  2Q7B A;  4PK3 A;  3TCV A;  1IID A;  2P0W A;  1I12 A;  1WK4 A;  1NSL A;  2VBQ A;  5C88 A;  1P4N A;  2ZW7 A;  4UA3 A;  5DWM A;  4F0Y A;  1I21 A;  3T90 A;  2B5G B;  2OH1 A;  2D4P A;  3ZZI A;  3D2M A;  4E2A A;  1XF8 A;  3OWC A;  3R1K A;  4UWJ A;  2Q44 A;  3GY9 A;  2PDO A;  5J8F A;  2P6G A;  4KOX A;  2DXQ A;  1QSR A;  3S6H A;  4JXQ A;  3LOD A;  1Z4E A;  4ZBG A;  2OU2 A;  4AVC A;  5KTD A;  2QEC A;  4CRZ B;  2B3U A;  2GIV A;  3FXT A;  2O28 A;  1VKC A;  2B4D B;  1KUY A;  1VHS A;  1B6B A;  2QML A;  3DSB A;  3S6F A;  4FD7 A;  1RXT A;  4FD6 A;  4PK2 A;  1WWZ A;  4M85 A;  2NMT A;  5GCN A;  2BSW A;  5HH1 A;  4DNC A;  2AJ6 A;  3I3G A;  2WPW A;  5I0C A;  2BL1 A;  1TIQ A;  2ARH A;  2PQ8 A;  2R98 A;  3NE7 A;  4NXY A;  5DWN A;  3TT2 A;  5JQ4 A;  1XIX A;  4RI1 A;  5F46 A;  3R9G A;  4MI4 A;  5F49 A;  2H5M A;  2VEZ A;  1NMT A;  1N71 A;  2GAN A;  4Y49 C;  4KOV A;  3PP9 A;  4KOR A;  1IYL A;  2G3A A;  1KUX A;  3P2F A;  4R3K A;  1XE4 A;  2QIR A;  3JUW A;  4H6U A;  1L0C A;  1YR0 A;  1I1D A;  3D3S A;  2ZPA A;  4HNW B;  2P6E A;  2EUI A;  5EBV A;  1MJA A;  4LX9 A;  4L8A A;  2G0B A;  3UY5 A;  2Z0Z A;  4CAV A;  4Y49 B;  2X7B A;  3G3S A;  2ZW6 A;  3EC4 A;  2VZY A;  3F8K A;  4NEX A;  2VQY A;  2REE A;  4R9M A;  2FS5 A;  3FNC A;  3BJ8 A;  2G3T A;  3WR7 A;  2BEI A;  2JLM A;  1QSM A;  3K9U A;  4KOS A;  2VZZ A;  2JDC A;  3P2H A;  4NSQ A;  3TOA A;  4HNX B;  4H6Z A;  4ORF A;  1OZP A;  5E96 A;  4KUB A;  3D8P A;  4OAE A;  1MJB A;  2BUE A;  1S7L A;  2VI7 A;  2Q4V A;  4PSX A;  4PV6 A;  1UFH A;  4XNH C;  2B5G A;  1KUV A;  5F47 A;  1IB1 E;  4B5O A;  4YFJ A;  3FIX A;  1K4J A;  2R8V A;  3R96 A;  5F48 A;  1FY7 A;  1S7F A;  4R57 A;  2C27 A;  3CXQ A;  3H4Q A;  4OAD A;  4XNH B;  2B4D A;  2EVN A;  5H86 A;  2OZU A;  4E0A A;  1XMT A;  3VWD A;  2HQY A;  2AE6 A;  2J8R A;  3LD2 A;  2PR8 A;  4X5K A;  5H84 A;  4CAX A;  1Q2C A;  1Z9U A;  2B4B A;  1BOB A;  1MJ9 A;  3F5B A;  3EO4 A;  5JPH A;  4M3S A;  4UBR A;  4ONU A;  4QUS A;  4KZT A;  3PGP A;  4PSW A;  3N7Z A;  4FD4 A;  1M4D A;  2Q0Y A;  4U5Y A;  4AVA A;  1MK4 A;  4XPK A;  2ZW4 A;  2R1I A;  4XPD C;  2FT0 A;  4F6A A;  3R95 A;  2HV2 A;  1IIC A;  4YRH A;  2B58 A;  2FL4 A;  2JDD A;  2J8M A;  3RYO A;  1S7N A;  2Y0M A;  2Z10 A;  3VWE A;  3B8G A;  3TO9 A;  2PSW A;  1YRE A;  4AB7 A;  2CNT A;  4NF1 A;  1YVO A;  4XPD B;  4HNY B;  3R9F A;  2K5T A;  3PZJ A;  4JWP A;  2Q4Y A;  2OB0 A;  1IYK A;  4MHD A;  1PUA A;  1Y9W A;  3GYA A;  4IF5 A;  4U9Y A;  4KLV A;  2A4N A;  4AG9 A;  4XPL A;  1S3Z A;  3EFA A;  2OZG A;  5J8C A;  1R57 A;  4MY0 A;  4KLW A;  3E0K A;  1M1D A;  1RO5 A;  3FYN A;  4UWI A;  5FVJ A;  3TO6 A;  3IGR A;  3W6X A;  5KTC A;  3TFY A;  2FIW A;  4JXR A;  4E8O A;  1S5K A;  3I9S A;  1Y9K A;  3SXN A;  1KZF A;  1QSO A;  4CRY B;  2F5I A;  3D2P A;  4KOT A;  3FBU A;  2B3V A;  3CXS A;  2I79 A;  2CNS A;  4II9 A;  3C26 A;  3W91 A;  3ZJ0 A;  4J3G A;  3TTH A;  4QC6 A;  1YX0 A;  4MBU A;  1YLE A;  1V0C A;  2HUZ A;  2WPX A;  1Q2D A;  4MJ8 A;  4I49 A;  4B5P B;  1LRZ A;  2FE7 A;  1GHE A;  1M4G A;  2FSR A;  5IV0 A;  4H89 A;  1YVK A;  2PC1 A;  3GKR A;  4BMH A;  3CXP A;  5ISV A;  2ZXV A;  4KOW A;  4IUS A;  5CNP A;  4EVY A;  3BJ7 A;  4U9Z A;  1B87 A;  3S6K A;  2D4O A;  2GE3 A;  5C82 A;  4KOY A;  4LUA A;  3SHP A;  2FIA A;  2I00 A;  3FRM A;  1Q2Y A;  4KOU A;  5IB0 A;  4R3L A;  3QAH A;  3DDD A;  1YK3 A;  1QST A;  1J4J A;  3FB3 A;  2FCK A;  4CAW A;  1M4I A;  3MGD A;  2REF A;  4HKF A;  3F0A A;  1S7K A;  3QB8 A;  1YGH A;  4QBJ A;  5EC4 A;  3SXO A;  2PRB A;  1XEB A;  5KTA A;  2CY2 A;  2CNM A;  4JLY A;  4KVX A;  4KVO E;  2VXK A;  3TO7 A;  5HMN A;  1Y7R A;  1CJW A;  3TOB A;  2PR1 A;  2J8N A;  1M44 A;  2OZH A;  1SQH A;  1U6M A;  3V8I A;  2KCW A;  4GS4 A;  2Z11 A;  2R7H A;  3TE4 A;  4AG7 A;  3KKW A;  3R9E A;  3T9Y A;  4OLL A;  4YGO A;  1Z4R A;  4KUA A;  4JD6 A;  3EY5 A;  1CM0 A;  4L89 A;  1ON0 A;  4KVM E;  4JJX A;  3BLN A;  4CS0 B;  2RC4 A;  4RS2 A;  2JEV A;  4AVB A;  4QVT A;  4QB9 A;  2IL4 A;  1PU9 A; 
#chains in the Genus database with same CATH topology
 2ODF A;  3DR6 A;  4F8Z A;  2PE3 A;  1X12 A;  2RFH A;  2Z3K A;  3DR8 A;  3MN8 A;  5DS0 A;  2OOT A;  3S6G A;  1NSA A;  3PBB A;  4K30 A;  4PQA A;  4TNU A;  4CAE A;  2Q04 A;  4K3N A;  3GIU A;  2ZEM A;  4NFR A;  4P10 A;  1YME A;  2J9A A;  4R87 A;  4CAF A;  3JVN A;  4B12 A;  2PJA A;  1BO4 A;  3RZA A;  5HVG A;  3EXN A;  1NE9 A;  3DNS A;  4NCZ A;  1QSN A;  5LYD A;  4B5P A;  1UWY A;  5JM6 A;  1P0H A;  4OP4 A;  3W6S A;  4MY3 A;  3IWG A;  4EME A;  3G8W A;  4OC4 A;  2P6F A;  1S60 A;  8CPA A;  5IX3 A;  2ATR A;  4FD5 A;  2FXF A;  2ZW5 A;  5LRK A;  2Q7B A;  4PK3 A;  4UEE A;  3TCV A;  1IID A;  1BAV A;  3D67 A;  4WJB A;  3SJG A;  2P0W A;  1I12 A;  1WK4 A;  3H8G A;  3D7H A;  1NSL A;  2Z3M A;  4X3R A;  5JH9 A;  2VBQ A;  5C88 A;  1P4N A;  4EWT A;  3IWW A;  2ZW7 A;  2PJ7 A;  4UA3 A;  4PXE A;  4FBE A;  1ARL A;  1VHE A;  5DWM A;  4F0Y A;  1ELL P;  1I21 A;  5LRJ A;  2O53 A;  3BHX A;  3HUV A;  3T90 A;  4B6Z A;  2B5G B;  2OH1 A;  4B11 A;  2D4P A;  5JGF A;  3ZZI A;  4B13 A;  1R3N A;  1VIX A;  3D2M A;  1H8L A;  1QQ9 A;  3KGQ A;  4MCP A;  1LCP A;  4E2A A;  4OIW A;  1XF8 A;  3OWC A;  3R1K A;  3DLJ A;  1JQG A;  4UWJ A;  2Q44 A;  3GY9 A;  2PDO A;  4A37 A;  4A31 A;  2AFU A;  5J8F A;  2P6G A;  4KOX A;  2DXQ A;  3IIB A;  4F0X A;  2YND A;  1QSR A;  5EMI A;  3S6H A;  4JXQ A;  3VAT A;  1TXR A;  1Z4E A;  2EWB A;  2F8H A;  2OU2 A;  2Q4Z A;  3LOD A;  4ZBG A;  4AVC A;  3B3V A;  4C2Z A;  5KTD A;  2EK9 A;  2QEC A;  4CRZ B;  4NJQ A;  4MXU A;  2B3U A;  4BD9 A;  2GIV A;  2PJB A;  2IQ6 A;  3FXT A;  3LAC A;  2O28 A;  2Q7S A;  3GLJ A;  1VKC A;  2B4D B;  4MFQ A;  2Z3N A;  1KUY A;  3RNZ A;  1CPX A;  1VHS A;  1B6B A;  2QML A;  3DSB A;  2Q51 A;  3S6F A;  4FD7 A;  2V8H A;  1RXT A;  4FD6 A;  1YQE A;  1WWZ A;  3CZX A;  4PK2 A;  2QVP A;  4M85 A;  2NMT A;  5GCN A;  2BSW A;  4FUU A;  5HH1 A;  4DNC A;  2AJ6 A;  5LYL A;  3TC8 A;  3I3G A;  4MHN A;  2PCU A;  2WPW A;  5LYI A;  4ZY1 A;  2CTC A;  5I0C A;  4Q38 A;  2Z3L A;  1DTD A;  2BL1 A;  5F09 A;  1TIQ A;  2ARH A;  2PQ8 A;  4LQ6 A;  2R98 A;  3NE7 A;  4C7H A;  3IO1 A;  1YSJ A;  4NXY A;  3IEH A;  5DWN A;  3TT2 A;  5JQ4 A;  3PB6 X;  3PEI A;  1XIX A;  1CP7 A;  2FVG A;  4KSF A;  4P6Y A;  4RI1 A;  4W9Y A;  5AG6 A;  3R9G A;  3JTK A;  4MI4 A;  5F49 A;  4A2Z A;  2H5M A;  1Y0Y A;  2V8D A;  2VEZ A;  4C7I A;  4YU9 A;  1XRY A;  3B2Y A;  4R6T A;  5HVF A;  3GUX A;  2WUU A;  1NMT A;  2IMO A;  1N71 A;  2GAN A;  3SJF A;  4Y49 C;  2NSM A;  4KOV A;  3PP9 A;  4KOR A;  1IYL A;  2G3A A;  2PJ0 A;  4NGQ A;  1OBR A;  1KUX A;  2EBJ A;  3P2F A;  3WT4 A;  2NYQ A;  4R3K A;  4Q7A A;  4JYW A;  3I1U A;  1XBU A;  2HC9 A;  1CBX A;  1XE4 A;  1YW6 A;  2QIR A;  3JUW A;  5G22 A;  4H6U A;  1L0C A;  1YR0 A;  1I1D A;  2JBJ A;  3S9M A;  4ZI6 A;  3D3S A;  2ZPA A;  3B3C A;  3IJ3 A;  2PJ4 A;  1Y0R A;  4HNW B;  3FX6 A;  4UCN A;  2P6E A;  1BLL E;  2EUI A;  5EBV A;  1MJA A;  3H5Z A;  4IHM A;  5I4M A;  2VL1 A;  4NGT A;  4LX9 A;  4A32 A;  1ZO0 A;  4KS9 A;  4L8A A;  2G0B A;  3UY5 A;  2Z0Z A;  4CAV A;  3FEE A;  5AG7 A;  4FAI A;  4B14 A;  4Y49 B;  2X7B A;  1HDU A;  1Z2L A;  3G3S A;  3H8F A;  2ZW6 A;  3EC4 A;  2VZY A;  5A27 A;  1F57 A;  3F8K A;  2OR4 A;  4P45 A;  1F2O A;  4NEX A;  2GLJ A;  2VQY A;  2YNC A;  2F7V A;  3QNV A;  5CBM A;  1TKF A;  3B35 A;  2REE A;  2V8V A;  4MHP A;  2FS5 A;  1LFW A;  4NJR A;  4R9M A;  3RO0 A;  1PCA A;  2RB7 A;  1YW4 A;  2V8G A;  3CT9 A;  3FNC A;  3BJ8 A;  4OID A;  2ZEG A;  2G3T A;  3KAS A;  4OC5 A;  1LAP A;  3WR7 A;  4C2Y A;  1AUG A;  2AFX A;  2BEI A;  2JLM A;  4JZ0 A;  1QSM A;  3K9U A;  3NFZ A;  1GYT A;  2DPT A;  3CPX A;  3GB0 A;  2VZZ A;  2JDC A;  3P2H A;  4KOS A;  4NSQ A;  3WC6 A;  2CTB A;  4PPZ A;  4WWV A;  3TOA A;  4HNX B;  4H6Z A;  2GFQ A;  4ORF A;  1OZP A;  5E96 A;  2IJZ A;  4KUB A;  3D8P A;  4OAE A;  2AFW A;  5D29 A;  1MJB A;  2BUE A;  3FH4 A;  2ANP A;  1S7L A;  3PB4 X;  2VI7 A;  1CP6 A;  2Q4V A;  4PSX A;  4PV6 A;  1UFH A;  4XNH C;  2B5G A;  4OKO A;  1HEE A;  4A38 A;  4Q36 A;  1KUV A;  5F47 A;  2EK8 A;  3V7Z A;  1IB1 E;  4B5O A;  2QYV A;  4UIA A;  4M6G A;  1ZLH A;  4G1P A;  4A39 A;  4YFJ A;  3FIX A;  4LQG A;  1K4J A;  2R8V A;  3IWE A;  3R96 A;  4MFK A;  5THW A;  1CG2 A;  5F48 A;  1FY7 A;  4CPA A;  5A28 A;  2G9D A;  3D68 A;  1S7F A;  4R57 A;  2C27 A;  3CXQ A;  3H4Q A;  3NE8 A;  2ZEL A;  4HPS A;  4KSA A;  4OAD A;  2PVV A;  4XNH B;  3V38 A;  4OME A;  4ZYQ A;  1LAN A;  2B4D A;  1F2P A;  2EVN A;  2I3C A;  5H86 A;  2OZU A;  4MRI A;  4PXC A;  3NH4 A;  4GXH A;  4E0A A;  1XMT A;  3VWD A;  2HQY A;  2BO9 A;  4P4I A;  5F46 A;  2AE6 A;  2J8R A;  3FJU A;  2ZEP A;  3LD2 A;  3K2K A;  2PR8 A;  4X5K A;  5CPA A;  5H84 A;  4CAX A;  2AFM A;  1Q2C A;  1Z9U A;  4FWU A;  2B4B A;  5LRG A;  1Z8X A;  1BOB A;  1MJ9 A;  3F5B A;  3EO4 A;  6CPA A;  5JPH A;  3WAB A;  3NH5 A;  4M3S A;  2GRE A;  1JWQ A;  4UBR A;  4ZX8 A;  1KWM A;  4A95 A;  4ONU A;  4OC3 A;  4NGR A;  1LAM A;  1ZG8 A;  3PRT A;  2PIY A;  1LOK A;  3BI0 A;  4MCS A;  4QUS A;  2CF4 A;  3IC1 A;  3TX8 A;  5K8O A;  2POK A;  4CGN A;  3IU1 A;  4KZT A;  3PGP A;  4PSW A;  3N7Z A;  4FD4 A;  5HVH A;  1M4D A;  1XOV A;  2Q0Y A;  4U5Y A;  3D4U A;  5AG4 A;  5BWA B;  3FMC A;  4AVA A;  1MK4 A;  2HB6 A;  3PB9 X;  4P4D A;  3SJE A;  4CYN A;  4XPK A;  1CX8 A;  3RAM A;  4ZGY B;  2Z3P A;  2ZW4 A;  1XJO A;  2R1I A;  4MCQ A;  1IGB A;  4XPD C;  2BCO A;  2FT0 A;  4C2X A;  3R95 A;  4F6A A;  1XMB A;  2HV2 A;  1IIC A;  4CGL A;  2C6G A;  4YRH A;  2B58 A;  4UIB A;  2FL4 A;  1Y7E A;  2PIZ A;  2JDD A;  1ELM P;  2J8M A;  3RYO A;  4DJL A;  1S7N A;  1ARM A;  2Y0M A;  2Z10 A;  1QMU A;  3N5F A;  3VWE A;  3WC5 A;  3B8G A;  4ONW A;  2GU2 A;  1TKH A;  1R43 A;  3S9L A;  3TO9 A;  2PSW A;  1RTQ A;  1Q7L A;  1YRE A;  2CNT A;  3FED A;  4NF1 A;  4AB7 A;  1YVO A;  4NGM A;  4XPD B;  4IAV A;  5LYF A;  1IOI A;  1IY7 A;  4HNY B;  3R9F A;  4MFZ A;  2K5T A;  3PZJ A;  1FNO A;  4JWP A;  1AYE A;  2Q4Y A;  4MHZ A;  3L2N A;  3ISZ A;  3D7F A;  3KI9 A;  3VAR A;  2OB0 A;  1IYK A;  4MHD A;  3QAY A;  1PUA A;  1Y9W A;  3GYA A;  5G1Z A;  4IF5 A;  2C6C A;  4R8F A;  4U9Y A;  5AG5 A;  2AFS A;  2ZEH A;  4KLV A;  4OC2 A;  2A4N A;  3MRU A;  4AG9 A;  4XPL A;  2EO8 A;  1S3Z A;  4F9U A;  2XEG A;  3EFA A;  4MCR A;  3IU2 A;  2OZG A;  3NA6 A;  4DUK A;  4ZX9 A;  1R57 A;  2O4H A;  5J8C A;  4UFV A;  4MY0 A;  2PJ1 A;  3PBE A;  4KLW A;  4RN7 A;  2CIJ A;  2YNC C;  3E0K A;  4UCM A;  1M1D A;  1RO5 A;  1Z8T A;  3FYN A;  3LMS A;  3FVL A;  4UWI A;  5FVJ A;  3B3S A;  1DE4 C;  3TO6 A;  1ZLI A;  4P44 A;  3IGR A;  2XEJ A;  3W6X A;  5KTC A;  3TFY A;  4DYO A;  2FIW A;  4BIN A;  4JXR A;  4UEF A;  4E8O A;  1S5K A;  2Q43 A;  3I9S A;  2ZEF A;  3KQZ A;  4OC0 A;  1Y9K A;  1VGY A;  3S9N A;  3SXN A;  2DEA A;  3D7D A;  1KZF A;  2DF5 A;  3LWU A;  4PXD A;  1QSO A;  4YWY A;  3PB8 X;  4P4E A;  4CRY B;  2F5I A;  2PJ2 A;  3D2P A;  4KOT A;  3FBU A;  2B3V A;  3CXS A;  3CDX A;  4Z65 A;  4CYP A;  4GM5 A;  2CNS A;  2YNE A;  4B10 A;  4II9 A;  3C26 A;  5ELY A;  1Z8W A;  4PXB A;  3SJX A;  3W91 A;  3ZJ0 A;  4J3G A;  4A33 A;  3TTH A;  4QC6 A;  1YX0 A;  2DPS A;  2PJ8 A;  3KZW A;  5K8M A;  1TKJ A;  4MBU A;  1YLE A;  4AXV A;  1V0C A;  2GLF A;  1CPS A;  2HUZ A;  1IOF A;  2IL4 A;  4P4F A;  4BBH A;  3KR5 A;  2PJ9 A;  2PJ5 A;  2WPX A;  1Q2D A;  4MFP A;  1Z5R A;  4NGN A;  5G20 A;  1YLO A;  3KL9 A;  4I49 A;  4MJ8 A;  2AFO A;  4B5P B;  2ABZ A;  1LRZ A;  4RUH A;  4MMO A;  4ZY0 A;  3PB7 X;  2FE7 A;  1GHE A;  1M4G A;  2FSR A;  2Z3O A;  2ZEE A;  4H89 A;  1YVK A;  5IV0 A;  2PC1 A;  3GKR A;  2ZEN A;  4BMH A;  3CXP A;  5ISV A;  2ZXV A;  4KOW A;  4UFX A;  2PVW A;  2PJ3 A;  4IUS A;  5CNP A;  4EVY A;  3IFE A;  3FF3 A;  1BPN A;  3BJ7 A;  4A94 A;  4U9Z A;  3VH9 A;  1B87 A;  3S6K A;  2D4O A;  4A30 A;  2GE3 A;  5G21 A;  2ZOF A;  3WC7 A;  5C82 A;  1PYT B;  4KOY A;  4EFD A;  4LUA A;  2YGW A;  4UCP A;  1TF8 A;  4CGP A;  4IK2 A;  1X10 A;  3SHP A;  2JEW A;  2JBK A;  2FIA A;  3ISX A;  2I00 A;  4F9V A;  3FRM A;  1Q2Y A;  2C1C A;  3BXM A;  4KOU A;  4MFJ A;  4P4B A;  5IB0 A;  4R3L A;  2WSA A;  2QJ8 A;  1Z8L A;  3QAH A;  4M6H A;  3DDD A;  5D8N A;  1XFO A;  5HXD A;  1YK3 A;  2XEF A;  3KR4 A;  1QST A;  4NGP A;  1J4J A;  2ZEO A;  3FB3 A;  5AGE A;  2FCK A;  4CAW A;  1M4I A;  1IU8 A;  3MGD A;  2REF A;  4MFL A;  4HKF A;  1FT7 A;  4MHY A;  4OC1 A;  3F0A A;  4X8I A;  1S7K A;  2CXA A;  5K8P A;  4C68 A;  2ZOG A;  5K8N A;  3QB8 A;  4UFW A;  4R76 A;  7CPA A;  1YGH A;  3KQX A;  3FEC A;  4QBJ A;  3HLP A;  5EC4 A;  3H8E A;  1EE3 P;  3SXO A;  3B3W A;  2PRB A;  1XEB A;  5KTA A;  2CY2 A;  2V77 A;  2ZED A;  2AFZ A;  2CNM A;  4JLY A;  4KVX A;  4KVO E;  4CGM A;  4H2K A;  2VXK A;  4UEZ A;  1AMP A;  1BPM A;  2WYR A;  4KSI A;  2XEI A;  3B7I A;  3TO7 A;  1HDQ A;  5IB9 A;  3CPA A;  2PJC A;  1VHO A;  2PJ6 A;  5HMN A;  1Y7R A;  3K9T A;  1CJW A;  1TF9 A;  4ZY2 A;  3TOB A;  2PR1 A;  2J8N A;  1M44 A;  4M6I A;  2OZH A;  5J1Q A;  1M4L A;  4CYQ A;  1SQH A;  1U6M A;  3V8I A;  3DGV A;  2KCW A;  3SI0 A;  4R7M A;  3JRU A;  2WZN A;  4GS4 A;  3BI1 A;  2Z11 A;  3RBU A;  2R7H A;  3TE4 A;  2BOA A;  3PFO A;  4AG7 A;  3KKW A;  3NH8 A;  3R9E A;  4O23 A;  3D66 A;  3T9Y A;  3SI2 A;  4OLL A;  3B3T A;  3KHZ A;  4TWE A;  3T8W A;  4YGO A;  1Z4R A;  4KUA A;  4JD6 A;  3EY5 A;  1CM0 A;  4L89 A;  1A2Z A;  4CYO A;  1ON0 A;  2PRQ A;  3BLN A;  4JJX A;  4KVM E;  4NGS A;  4X2T A;  2RC4 A;  3SI1 A;  4UF4 A;  4CS0 B;  3D7G A;  4RS2 A;  4CGO A;  2JEV A;  4AVB A;  3KHX A;  2C6P A;  1ZG9 A;  3PFE A;  4P4J A;  4QVT A;  1ZG7 A;  4QB9 A;  3A9L A;  2I79 A;  1PU9 A; 
#chains in the Genus database with same CATH homology
 3DR6 A;  2Z3K A;  3DR8 A;  3S6G A;  4CAE A;  4K30 A;  2Q04 A;  4R87 A;  4CAF A;  3JVN A;  4B12 A;  1BO4 A;  3EXN A;  1NE9 A;  3DNS A;  4NCZ A;  1QSN A;  4B5P A;  1P0H A;  3W6S A;  4MY3 A;  3IWG A;  3G8W A;  2P6F A;  1S60 A;  5IX3 A;  2ATR A;  4FD5 A;  2FXF A;  2ZW5 A;  2Q7B A;  4PK3 A;  3TCV A;  1IID A;  2P0W A;  1I12 A;  1WK4 A;  1NSL A;  2Z3M A;  2VBQ A;  5C88 A;  1P4N A;  2ZW7 A;  4UA3 A;  5DWM A;  4F0Y A;  1I21 A;  3T90 A;  2B5G B;  2OH1 A;  4B11 A;  2D4P A;  3ZZI A;  4B13 A;  3D2M A;  4E2A A;  1XF8 A;  3OWC A;  3R1K A;  4UWJ A;  2Q44 A;  3GY9 A;  2PDO A;  4A31 A;  5J8F A;  2P6G A;  4KOX A;  2DXQ A;  4F0X A;  2YND A;  1QSR A;  3S6H A;  4JXQ A;  3LOD A;  1Z4E A;  4ZBG A;  2OU2 A;  4AVC A;  5KTD A;  4C2Z A;  2QEC A;  4CRZ B;  2B3U A;  2GIV A;  3FXT A;  2O28 A;  1VKC A;  2B4D B;  4MFQ A;  2Z3N A;  1KUY A;  1VHS A;  1B6B A;  2QML A;  3DSB A;  3S6F A;  4FD7 A;  1RXT A;  4FD6 A;  4PK2 A;  1WWZ A;  4M85 A;  2NMT A;  5GCN A;  2BSW A;  5HH1 A;  4DNC A;  2AJ6 A;  3I3G A;  2WPW A;  5I0C A;  4Q38 A;  2Z3L A;  2BL1 A;  1TIQ A;  2ARH A;  2PQ8 A;  2R98 A;  3NE7 A;  4C7H A;  4NXY A;  5DWN A;  3TT2 A;  5JQ4 A;  5AG6 A;  1XIX A;  4KSF A;  4RI1 A;  5F46 A;  3R9G A;  3JTK A;  4MI4 A;  5F49 A;  4A2Z A;  2H5M A;  2VEZ A;  4C7I A;  2WUU A;  1NMT A;  1N71 A;  2GAN A;  4Y49 C;  4KOV A;  3PP9 A;  4KOR A;  1IYL A;  2G3A A;  1KUX A;  3P2F A;  4R3K A;  1XE4 A;  2QIR A;  3JUW A;  5G22 A;  4H6U A;  1L0C A;  1YR0 A;  1I1D A;  3D3S A;  2ZPA A;  4UCN A;  4HNW B;  2P6E A;  2EUI A;  5EBV A;  1MJA A;  3H5Z A;  4LX9 A;  1ZO0 A;  4KS9 A;  4L8A A;  2G0B A;  3UY5 A;  2Z0Z A;  4CAV A;  5AG7 A;  4B14 A;  4Y49 B;  2X7B A;  3G3S A;  2ZW6 A;  3EC4 A;  2VZY A;  5A27 A;  3F8K A;  4NEX A;  2VQY A;  2YNC A;  2REE A;  4A32 A;  4R9M A;  2FS5 A;  3FNC A;  3BJ8 A;  2G3T A;  3WR7 A;  4C2Y A;  2BEI A;  2JLM A;  1QSM A;  3K9U A;  2DPT A;  4KOS A;  2VZZ A;  2JDC A;  3P2H A;  4NSQ A;  3TOA A;  4HNX B;  4H6Z A;  4ORF A;  1OZP A;  5E96 A;  4KUB A;  3D8P A;  4OAE A;  1MJB A;  2BUE A;  1S7L A;  2VI7 A;  2Q4V A;  4PSX A;  4PV6 A;  1UFH A;  4XNH C;  2B5G A;  4Q36 A;  1KUV A;  5F47 A;  1IB1 E;  4B5O A;  4YFJ A;  3FIX A;  1K4J A;  2R8V A;  3IWE A;  3R96 A;  4MFK A;  5F48 A;  1FY7 A;  5A28 A;  1S7F A;  4R57 A;  2C27 A;  3CXQ A;  3H4Q A;  4KSA A;  4OAD A;  4XNH B;  2B4D A;  2EVN A;  5H86 A;  2OZU A;  4E0A A;  1XMT A;  3VWD A;  2HQY A;  2AE6 A;  2J8R A;  3LD2 A;  2PR8 A;  4X5K A;  5H84 A;  4CAX A;  1Q2C A;  1Z9U A;  2B4B A;  1BOB A;  1MJ9 A;  3F5B A;  3EO4 A;  5JPH A;  4M3S A;  4A95 A;  4UBR A;  4ONU A;  4QUS A;  4CGN A;  3IU1 A;  4KZT A;  3PGP A;  4PSW A;  3N7Z A;  4FD4 A;  1M4D A;  2Q0Y A;  4U5Y A;  5AG4 A;  5BWA B;  4AVA A;  1MK4 A;  4CYN A;  4XPK A;  4ZGY B;  2Z3P A;  2ZW4 A;  2R1I A;  4XPD C;  2FT0 A;  4C2X A;  4F6A A;  3R95 A;  2HV2 A;  1IIC A;  4CGL A;  4YRH A;  2B58 A;  2FL4 A;  2JDD A;  2J8M A;  3RYO A;  1S7N A;  2Y0M A;  2Z10 A;  3VWE A;  3B8G A;  3TO9 A;  2PSW A;  1YRE A;  4AB7 A;  2CNT A;  4NF1 A;  1YVO A;  4XPD B;  4HNY B;  3R9F A;  4MFZ A;  2K5T A;  3PZJ A;  4JWP A;  2Q4Y A;  2OB0 A;  1IYK A;  4MHD A;  1PUA A;  1Y9W A;  3GYA A;  5G1Z A;  4IF5 A;  4U9Y A;  5AG5 A;  4KLV A;  2A4N A;  4AG9 A;  4XPL A;  1S3Z A;  3EFA A;  3IU2 A;  2OZG A;  5J8C A;  1R57 A;  4UFV A;  4MY0 A;  4KLW A;  2YNC C;  3E0K A;  4UCM A;  1M1D A;  1RO5 A;  3FYN A;  4UWI A;  5FVJ A;  3TO6 A;  3IGR A;  3W6X A;  5KTC A;  3TFY A;  2FIW A;  4JXR A;  4E8O A;  1S5K A;  3I9S A;  1Y9K A;  3SXN A;  1KZF A;  1QSO A;  4CRY B;  2F5I A;  3D2P A;  4KOT A;  3FBU A;  2B3V A;  3CXS A;  4CYP A;  2I79 A;  2CNS A;  2YNE A;  4B10 A;  4II9 A;  3C26 A;  3W91 A;  3ZJ0 A;  4J3G A;  4A33 A;  3TTH A;  4QC6 A;  1YX0 A;  2DPS A;  4MBU A;  1YLE A;  1V0C A;  2HUZ A;  4BBH A;  2WPX A;  4MFP A;  1Q2D A;  5G20 A;  4MJ8 A;  4I49 A;  4B5P B;  1LRZ A;  2FE7 A;  1GHE A;  1M4G A;  2FSR A;  2Z3O A;  5IV0 A;  4H89 A;  1YVK A;  2PC1 A;  3GKR A;  4BMH A;  3CXP A;  5ISV A;  2ZXV A;  4KOW A;  4UFX A;  4IUS A;  5CNP A;  4EVY A;  3BJ7 A;  4U9Z A;  1B87 A;  3S6K A;  2D4O A;  4A30 A;  2GE3 A;  5G21 A;  5C82 A;  4KOY A;  4LUA A;  2YGW A;  4UCP A;  4CGP A;  3SHP A;  2FIA A;  2I00 A;  3FRM A;  1Q2Y A;  4KOU A;  4MFJ A;  5IB0 A;  4R3L A;  2WSA A;  3QAH A;  3DDD A;  1YK3 A;  1QST A;  1J4J A;  3FB3 A;  5AGE A;  2FCK A;  4CAW A;  1M4I A;  3MGD A;  2REF A;  4MFL A;  4HKF A;  3F0A A;  1S7K A;  2CXA A;  4C68 A;  3QB8 A;  4UFW A;  1YGH A;  4QBJ A;  5EC4 A;  3SXO A;  2PRB A;  1XEB A;  5KTA A;  2CY2 A;  2CNM A;  4JLY A;  4KVX A;  4KVO E;  4CGM A;  2VXK A;  3TO7 A;  5HMN A;  1Y7R A;  1CJW A;  3TOB A;  2PR1 A;  2J8N A;  1M44 A;  2OZH A;  4CYQ A;  1SQH A;  1U6M A;  3V8I A;  2KCW A;  4GS4 A;  2Z11 A;  2R7H A;  3TE4 A;  4AG7 A;  3KKW A;  3R9E A;  3T9Y A;  4OLL A;  4YGO A;  1Z4R A;  4KUA A;  4JD6 A;  3EY5 A;  1CM0 A;  4L89 A;  4CYO A;  1ON0 A;  3BLN A;  4JJX A;  4KVM E;  4CS0 B;  2RC4 A;  4RS2 A;  4CGO A;  2JEV A;  4AVB A;  4QVT A;  4QB9 A;  3A9L A;  2IL4 A;  1PU9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...