1I1DA

Crystal structure of yeast gna1 bound to coa and glnac-6p
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
159
structure length
156
Chain Sequence
MSLPDGFYIRRMEEGDLEQVTETLKVLTTVGTITPESFCKLIKYWNEATVWNDKKIMQYNPMVIVDKRTETVAATGNIIIERKIIHELGLCGHIEDIAVNSKYQGQGLGKLLIDQLVTIGFDYGCYKIILDCDEKNVKFYEKCGFSNAGVEMQIRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUCOSAMINE-PHOSPHATE N-ACETYLTRANSFERASE
publication title The crystal structures of Apo and complexed Saccharomyces cerevisiae GNA1 shed light on the catalytic mechanism of an amino-sugar N-acetyltransferase.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase
total genus 44
structure length 156
sequence length 159
chains with identical sequence B, C, D
ec nomenclature ec 2.3.1.4: Glucosamine-phosphate N-acetyltransferase.
pdb deposition date 2001-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1i1dA00
2P6FA 4KOXA 3ZZIA 1PU9A 2G3TA 3R9EA 3H4QA 1UFHA 3TOAA 5HMNA 1B6BA 3N7ZA 1RO5A 4E8OA 4QB9A 1GHEA 1OZPA 2QECA 3TO9A 1S5KA 4KOSA 4JXQA 2FXFA 2Z10A 2OZGA 4FD7A 3OWCA 4U5YA 4CAXA 4HNXB 3TFYA 2ZW4A 4IF5A 4KOVA 1KZFA 3QAHA 2R98A 2O28A 2G0BA 2OZUA 5J8CA 2P6GA 4QVTA 3KKWA 1QSMA 2AJ6A 1BO4A 5HH1A 3V8IA 4MI4A 5KTAA 4QUSA 5F46A 3DSBA 3EO4A 4KUBA 4H6ZA 5KTDA 4E0AA 1Y9KA 2CNTA 4AG7A 1S7FA 2IL4A 3T90A 3FB3A 3CXSA 3I9SA 1Q2YA 2CNSA 2AE6A 2P6EA 1M1DA 2CNMA 3CXQA 4JWPA 2PC1A 1K4JA 2GIVA 1IYKA 2DXQA 4U9YA 1NSLA 2GE3A 2PQ8A 3TO6A 2F5IA 1Z9UA 1S60A 3TO7A 4OAEA 3FYNA 3ZJ0A 1M44A 3D2PA 4ONUA 2B3UA 4XPDC 3VWDA 5IX3A 4KOUA 3E0KA 3R1KA 1QSTA 2VZZA 4KVXA 3S6HA 2Q4YA 2REFA 4RS2A 1YLEA 4MJ8A 3RYOA 3D2MA 1XF8A 4EVYA 4R9MA 3LODA 2Q04A 1QSNA 4XNHB 3W91A 1I1DA 3F8KA 4YRHA 5JQ4A 1NMTA 3W6SA 3C26A 2REEA 2J8NA 4R57A 3JUWA 3FXTA 2B5GA 1MK4A 3DR6A 5F48A 1S7KA 3P2HA 2VQYA 4II9A 4Y49C 2X7BA 2HV2A 3G3SA 4AB7A 2ATRA 2BUEA 3R9GA 1M4IA 1YVKA 2H5MA 2I00A 1VKCA 1QSOA 2JDCA 2ZW5A 3MGDA 4R3LA 3PZJA 4CRZB 4GS4A 4KLWA 4AVBA 1R57A 4JD6A 5KTCA 2EVNA 2Q0YA 4NXYA 1IB1E 4RI1A 5GCNA 3SXNA 1J4JA 4FD4A 2P0WA 2B3VA 3S6GA 3SHPA 1WWZA 2EUIA 4CS0B 2ZXVA 3WR7A 2J8RA 5C88A 3S6KA 5EBVA 3EC4A 4YGOA 3R96A 2B58A 1YVOA 4U9ZA 4CAWA 1Q2DA 3EXNA 4K30A 4UWJA 1L0CA 1Y9WA 3BJ7A 5H84A 1N71A 4UWIA 1Z4EA 2QIRA 2R8VA 1TIQA 1YK3A 1RXTA 5ISVA 1NE9A 2B4BA 3TOBA 1VHSA 1YREA 3IWGA 4JXRA 4M3SA 2JDDA 2OH1A 4H89A 4F6AA 2D4PA 3TTHA 1IYLA 4PSWA 4PK2A 4KVOE 3FBUA 4I49A 2WPXA 3TE4A 1P0HA 4MY0A 4DNCA 1Y7RA 4XPDB 1MJAA 4OADA 2FIWA 5CNPA 4HKFA 2VEZA 3B8GA 3DNSA 2Q4VA 1B87A 1CJWA 4OLLA 1LRZA 3S6FA 2QMLA 2B4DB 5EC4A 3T9YA 3GYAA 2JEVA 2PR1A 4KVME 2FE7A 4PSXA 3EY5A 4NSQA 4R3KA 4KOTA 1Z4RA 2B4DA 3I3GA 1WK4A 4XPKA 4MY3A 4YFJA 4PK3A 4L89A 4M85A 4B5PB 3QB8A 1S7LA 3P2FA 4QBJA 5I0CA 2R7HA 4JJXA 3TT2A 4X5KA 2D4OA 2CY2A 4Y49B 3NE7A 4AVAA 5DWNA 2OB0A 4R87A 2FCKA 4ZBGA 4LUAA 5FVJA 4L8AA 2HUZA 1XEBA 3GKRA 1KUXA 3CXPA 1IICA 3K9UA 3EFAA 1MJ9A 3FIXA 2A4NA 1V0CA 3D8PA 2NMTA 4MHDA 4BMHA 1S7NA 4NEXA 1U6MA 2OZHA 1XMTA 2ZW7A 2PSWA 4AVCA 2C27A 4KLVA 5J8FA 2PDOA 2KCWA 2Y0MA 2ZPAA 3PGPA 2VBQA 5IB0A 3W6XA 1YGHA 1YX0A 2PR8A 4LX9A 4F0YA 4JLYA 3GY9A 3F5BA 4ORFA 5H86A 4FD6A 1CM0A 4XPLA 3LD2A 4CAVA 4FD5A 2VXKA 3DDDA 2FL4A 3D3SA 2FIAA 4HNWB 4B5OA 3F0AA 2FSRA 2FS5A 4HNYB 2BSWA 4UBRA 2FT0A 4PV6A 1YR0A 5E96A 3SXOA 2VZYA 2WPWA 1XE4A 2Q44A 1KUYA 4E2AA 3DR8A 2RC4A 1SQHA 1I12A 2ARHA 1KUVA 2K5TA 2JLMA 4KOWA 1M4DA 5C82A 5IV0A 2Z11A 1ON0A 3BJ8A 2Z0ZA 4CRYB 2Q7BA 3VWEA 1IIDA 3G8WA 2PRBA 4UA3A 2I79A 2OU2A 4KOYA 1PUAA 1M4GA 4H6UA 2GANA 4J3GA 4NF1A 1XIXA 2J8MA 2HQYA 5JPHA 3TCVA 2BEIA 4KZTA 3UY5A 3BLNA 1BOBA 3FNCA 5F49A 3R9FA 1P4NA 4QC6A 4KUAA 4XNHC 2B5GB 4B5PA 3PP9A 4AG9A 1I21A 1Q2CA 5F47A 3IGRA 1MJBA 4MBUA 1FY7A 2BL1A 3JVNA 2G3AA 5DWMA 4KORA 2ZW6A 2R1IA 3R95A 4NCZA 1QSRA 2VI7A 1S3ZA 3FRMA 4IUSA
chains in the Genus database with same CATH superfamily
2EBJA 2P6FA 1VGYA 1XMBA 4KOXA 3ZZIA 1PU9A 1Y0RA 2G3TA 3R9EA 4FBEA 2VL1A 3H4QA 3H5ZA 1UFHA 3PRTA 3TOAA 5HMNA 5K8OA 1B6BA 3N7ZA 1RO5A 4E8OA 4F8ZA 4W9YA 4QB9A 5IB9A 3KL9A 3B2YA 1GHEA 5A27A 1CPXA 1OZPA 2QECA 3BXMA 3TO9A 1S5KA 2O4HA 1BPMA 2ANPA 4JXQA 2FXFA 2IJZA 4KOSA 4YWYA 2Z10A 4OIDA 2NSMA 4P6YA 2OZGA 3KI9A 4FD7A 3OWCA 4P4FA 4U5YA 4UCPA 3D7HA 4CAXA 4HNXB 2QVPA 2YNEA 3TFYA 4CAFA 5LRGA 2ZW4A 4IF5A 3D7FA 4Z65A 4KOVA 5AG4A 1KZFA 3QAHA 2OOTA 2R98A 4KSFA 4OKOA 2O28A 4UEEA 2G0BA 1XBUA 2OZUA 5J8CA 3PFOA 2ZOGA 2P6GA 3RO0A 4QVTA 3KKWA 5J1QA 1QSMA 3WC6A 1TKJA 2AJ6A 1BO4A 4OC2A 5HH1A 3V8IA 2AFOA 3N5FA 2CTCA 4MI4A 5AG7A 3GB0A 5DS0A 4ZI6A 5KTAA 4QUSA 5F46A 3KQZA 3DSBA 3EO4A 2ZEPA 4CGPA 4KUBA 4H6ZA 2ZEEA 4FUUA 5KTDA 4UCNA 4AXVA 3DLJA 3IWWA 6CPAA 4E0AA 3NE8A 1Y9KA 2CNTA 3PB7X 1S7FA 2IL4A 4ZY2A 1CP6A 3T90A 2ZEDA 4AG7A 3FB3A 3CXSA 2AFZA 3I9SA 1Q2YA 2CNSA 2AE6A 2P6EA 1IOFA 1M1DA 2CNMA 2RB7A 4RUHA 3CXQA 4JWPA 3PB8X 4M6IA 2PC1A 1K4JA 4CGMA 2GIVA 1IYKA 2DXQA 3KHXA 4RN7A 4U9YA 2IMOA 4P10A 1NSLA 2GE3A 2PQ8A 4MCRA 3TO6A 2F5IA 1Z9UA 1S60A 2PJ5A 3TO7A 1IU8A 4OAEA 3FYNA 2AFWA 3KR4A 4P4EA 3VATA 3IEHA 3ZJ0A 4F9VA 1M44A 3D2PA 2EK9A 2B3UA 4ONUA 4X8IA 2HB6A 4XPDC 2FVGA 1HDQA 3B35A 3VWDA 2V8HA 3CPXA 4Q36A 2PJBA 5IX3A 4KOUA 3E0KA 2XEIA 4OC3A 3R1KA 1QSTA 4NJRA 4NGQA 4P4JA 2VZZA 4UFWA 2IQ6A 5K8NA 3D7DA 4KVXA 3S6HA 2Q4YA 2REFA 2C6PA 5THWA 4RS2A 1YLEA 3FMCA 4MJ8A 3RYOA 4F0XA 3KQXA 4CGLA 3D2MA 4B13A 4CPAA 1XF8A 3PFEA 3DGVA 4EVYA 3LMSA 2Z3PA 4R9MA 4C2YA 3IJ3A 3LODA 4OC4A 3SI1A 4NGSA 5K8MA 2Q04A 2PJ4A 4MFKA 2EO8A 2J9AA 4IHMA 4R6TA 4CYOA 2WZNA 4MFQA 4BBHA 4MCSA 1QSNA 4XNHB 5LYIA 4JYWA 1I1DA 3W91A 3F8KA 7CPAA 4YRHA 5JQ4A 1NMTA 4UF4A 4UEFA 3W6SA 3S9LA 3C26A 4R7MA 1R43A 2REEA 2J8NA 4R57A 2V77A 3FXTA 3JUWA 1Z8WA 2B5GA 1FNOA 3D67A 3CT9A 1MK4A 1VIXA 3DR6A 5F48A 3PB6X 5JGFA 1S7KA 3SJXA 3P2HA 5HVFA 2EK8A 2VQYA 4II9A 4Y49C 2X7BA 5D8NA 2AFUA 2O53A 1XFOA 2HV2A 3G3SA 4AB7A 2ATRA 2BUEA 4KSAA 3R9GA 3NA6A 1Z5RA 1M4IA 1Z2LA 1YVKA 2H5MA 2I00A 2PJ8A 3PB4X 1VKCA 1QSOA 2ZENA 4CGNA 2Q7SA 2JDCA 2YGWA 2Z3MA 3BI0A 4TNUA 3HLPA 4EWTA 2ABZA 4CYNA 2ZW5A 3MGDA 4P4DA 3PZJA 4R3LA 4ZYQA 3MN8A 4ZY0A 4MCQA 4YU9A 4CRZB 4MRIA 4Q38A 3D66A 4GS4A 2QYVA 1AYEA 4KLWA 4AVBA 2V8VA 1Y7EA 1ZLHA 2PCUA 5A28A 4B6ZA 4OC1A 1R57A 4IAVA 2CXAA 4JD6A 2V8DA 5KTCA 3KZWA 2Q51A 3FX6A 4ZX9A 2EVNA 2DPTA 2Q0YA 4NXYA 1IB1E 1CP7A 3GUXA 2PJ3A 4RI1A 2C1CA 2DPSA 5GCNA 1J4JA 4FD4A 3SXNA 1JQGA 2P0WA 2B3VA 1TF9A 2CIJA 3JRUA 3S6GA 3SHPA 1WWZA 2EUIA 3I1UA 4CS0B 2ZXVA 4IK2A 2AFXA 1Y0YA 2F7VA 1F57A 3WR7A 3H8FA 2J8RA 5C88A 3S6KA 2AFMA 1AMPA 1YQEA 1ZO0A 3EC4A 2PIYA 4YGOA 5EBVA 4C68A 3R96A 2DEAA 2XEFA 2B58A 1YVOA 4U9ZA 4CAWA 1Q2DA 3EXNA 3GLJA 4K30A 4UWJA 3BI1A 1L0CA 4JZ0A 3V7ZA 3VARA 1YW6A 1Y9WA 3BJ7A 3LACA 5H84A 1N71A 2PVVA 4UIAA 4UWIA 4FWUA 3FJUA 1XJOA 1Z4EA 5G20A 2GLJA 2QIRA 4A38A 5JM6A 2R8VA 1TIQA 1YK3A 4BD9A 1RXTA 2CF4A 5ISVA 1ZG7A 1NE9A 2B4BA 4Q7AA 3K2KA 3TOBA 1ELLP 1VHSA 3GIUA 1YREA 4BINA 3IWGA 4R8FA 3D7GA 1QQ9A 3B3WA 4JXRA 2ZEFA 4M3SA 2ZEOA 2G9DA 4OC0A 2JDDA 2OH1A 2PJ0A 4H89A 4F6AA 1QMUA 1XRYA 1AUGA 2D4PA 3TTHA 1IYLA 4PSWA 4PK2A 4KVOE 3FBUA 4DUKA 4OP4A 4FAIA 4I49A 2WPXA 3TE4A 4UEZA 3S9MA 4DYOA 4H2KA 1P0HA 4MY0A 4DNCA 1Y7RA 1YW4A 2PIZA 4XPDB 2JBKA 2ZEHA 5G21A 1MJAA 1YMEA 4OADA 4B11A 4GM5A 1LANA 4GXHA 2FIWA 5CNPA 3QAYA 4HKFA 2VEZA 3B8GA 1ZG8A 3PBBA 4CYQA 5JH9A 2PJ1A 2BCOA 2XEGA 3BHXA 3DNSA 3FEEA 4CAEA 2Q4VA 1KWMA 1B87A 3IU2A 4EFDA 1CJWA 2Z3KA 4OLLA 4MFJA 3IC1A 4A2ZA 1LRZA 4NGMA 1BAVA 4OC5A 3S6FA 4MHPA 3D4UA 2QMLA 2B4DB 4UCMA 2YNDA 5EC4A 3ISXA 3GYAA 3T9YA 2OR4A 2PJ7A 2WSAA 1RTQA 2JEVA 2PR1A 3NFZA 2FE7A 4KVME 4PSXA 3EY5A 4NSQA 2GLFA 3KHZA 5G1ZA 2WUUA 4R3KA 1H8LA 3SJEA 4KOTA 1Z4RA 3H8EA 2B4DA 1CPSA 3I3GA 4LQ6A 1WK4A 3B3SA 2Q43A 4P4BA 2DF5A 4XPKA 3FH4A 5AGEA 4MY3A 4C7IA 4PXEA 4MXUA 4YFJA 4PK3A 4L89A 4UIBA 4M85A 4B14A 4EMEA 4B5PB 1Z8LA 3QB8A 1S7LA 1UWYA 3P2FA 4QBJA 2Q4ZA 5I0CA 1IOIA 4X3RA 2R7HA 3LWUA 4JJXA 3TT2A 3B3CA 4X5KA 2D4OA 2V8GA 2CY2A 3WC7A 4Y49B 3HUVA 3NE7A 4AVAA 5LRKA 5AG6A 5DWNA 2BOAA 2YNCC 3NH5A 1Z8TA 2OB0A 3B3VA 4R87A 3PEIA 2FCKA 2NYQA 4ZBGA 4LUAA 5FVJA 2GREA 4A94A 4L8AA 2HUZA 1XEBA 3FF3A 1KUXA 2POKA 3CXPA 1IICA 1ARLA 1FT7A 1X12A 3GKRA 3KGQA 3L2NA 3IIBA 3RBUA 1EE3P 3K9UA 4ZX8A 3VH9A 4LQGA 2PVWA 3EFAA 1MJ9A 3IO1A 3FIXA 2A4NA 1V0CA 2ODFA 3D8PA 2NMTA 4MHDA 4MFLA 4BMHA 3MRUA 1S7NA 4PXCA 4NEXA 1U6MA 2F8HA 1TXRA 2OZHA 3IFEA 4NGTA 1XMTA 3IU1A 2PJ9A 1X10A 1ELMP 2ZW7A 2PSWA 2GFQA 4A37A 4AVCA 2PE3A 2GU2A 2PJ2A 2C27A 3RNZA 4KLVA 4P4IA 5G22A 3SI2A 5J8FA 1CX8A 2PDOA 1LAMA 2KCWA 5LYFA 2WYRA 2PJAA 2AFSA 2Y0MA 4UFXA 5AG5A 3SI0A 4A30A 2ZPAA 3PGPA 4A31A 2VBQA 5IB0A 4CYPA 2RFHA 4UFVA 4OIWA 4PQAA 3W6XA 1YGHA 1YX0A 4P45A 2PR8A 3K9TA 4LX9A 4F0YA 5LYLA 4JLYA 3GY9A 2Z3NA 3F5BA 5BWAB 4ORFA 5H86A 3RZAA 3WABA 4B10A 1IY7A 3KASA 4FD6A 1CM0A 1OBRA 1ZG9A 4XPLA 3LD2A 4CAVA 4FD5A 2VXKA 3DDDA 2FL4A 3D3SA 5CPAA 2FIAA 3SJGA 4HNWB 1ARMA 1NSAA 4KSIA 4B5OA 1LFWA 3F0AA 1DE4C 2FSRA 2FS5A 3B7IA 4HNYB 1TF8A 3NH8A 1BPNA 2BSWA 3CPAA 4C7HA 3QNVA 4UBRA 2FT0A 4NJQA 3CDXA 4PV6A 1YR0A 2ZEGA 5E96A 3SXOA 3CZXA 2VZYA 1VHOA 1R3NA 3IWEA 2WPWA 5LYDA 1XE4A 4F9UA 2Q44A 1KUYA 4E2AA 1M4LA 2Z3OA 4PXBA 4MCPA 2JBJA 4M6HA 3PB9X 1Q7LA 3DR8A 2RC4A 4PPZA 2BO9A 1SQHA 4P44A 3SJFA 1I12A 2ARHA 1KUVA 1XOVA 1F2OA 2JLMA 2K5TA 4CGOA 4MHYA 4KOWA 2ZELA 1TKHA 4WJBA 1M4DA 5C82A 1Z8XA 1JWQA 2I3CA 2Z11A 1ON0A 3BJ8A 2Z0ZA 5IV0A 4CRYB 3S9NA 1PCAA 1GYTA 2ZOFA 2Q7BA 4MHNA 4DJLA 5EMIA 3VWEA 1IIDA 3G8WA 5ELYA 4C2XA 1HDUA 2PJ6A 2PRBA 2I79A 4UA3A 2OU2A 1A2ZA 2C6CA 4A33A 2PRQA 1ZLIA 4KOYA 1PUAA 4MFPA 4A95A 4C2ZA 1M4GA 3A9LA 4TWEA 3T8WA 4H6UA 2GANA 4ZGYB 4J3GA 4NF1A 4NGRA 1YLOA 1XIXA 2J8MA 2JEWA 3JTKA 2HQYA 1BLLE 4NGNA 3TX8A 5JPHA 5LRJA 4KS9A 4NFRA 3TCVA 2ZEMA 2BEIA 4G1PA 4KZTA 4WWVA 3UY5A 1LCPA 3BLNA 3FEDA 1BOBA 2Z3LA 3FNCA 1LOKA 5F49A 1IGBA 4R76A 3KR5A 3NH4A 4MFZA 3B3TA 3PBEA 3H8GA 3R9FA 1P4NA 5D29A 4QC6A 4KUAA 4XNHC 2B5GB 4MHZA 5K8PA 4B5PA 3FECA 3PP9A 4B12A 4AG9A 1I21A 4X2TA 4A39A 1Q2CA 4O23A 1PYTB 4M6GA 5HXDA 2CTBA 1DTDA 1TKFA 3V38A 5HVGA 3FVLA 4NGPA 8CPAA 5F09A 1LAPA 5F47A 3IGRA 1MJBA 2QJ8A 4MBUA 1YSJA 1CBXA 4PXDA 1F2PA 1FY7A 5HVHA 2BL1A 5I4MA 2HC9A 2YNCA 3JVNA 2G3AA 4K3NA 5DWMA 4ONWA 1CG2A 3RAMA 5CBMA 2XEJA 2EWBA 3ISZA 4MMOA 3D68A 2PJCA 4KORA 3WC5A 2ZW6A 1VHEA 2R1IA 3WT4A 4A32A 3R95A 4NCZA 1HEEA 1QSRA 3TC8A 2VI7A 4HPSA 4OMEA 4ZY1A 1S3ZA 3FRMA 4IUSA 2C6GA
chains in the Genus database with same CATH topology
2P6FA 4KOXA 3ZZIA 1PU9A 2G3TA 3R9EA 3H4QA 3H5ZA 1UFHA 3TOAA 5HMNA 1B6BA 3N7ZA 1RO5A 4E8OA 4QB9A 1GHEA 5A27A 1OZPA 2QECA 3TO9A 1S5KA 4KOSA 4JXQA 2FXFA 2Z10A 2OZGA 4FD7A 3OWCA 4U5YA 4UCPA 4CAXA 4HNXB 2YNEA 3TFYA 4CAFA 2ZW4A 4IF5A 4KOVA 5AG4A 1KZFA 3QAHA 2R98A 4KSFA 2O28A 2G0BA 2OZUA 5J8CA 2P6GA 4QVTA 3KKWA 1QSMA 2AJ6A 1BO4A 5HH1A 3V8IA 4MI4A 5AG7A 5KTAA 4QUSA 5F46A 3DSBA 3EO4A 4CGPA 4KUBA 4H6ZA 5KTDA 4UCNA 4E0AA 1Y9KA 2CNTA 4AG7A 1S7FA 2IL4A 3T90A 3FB3A 3CXSA 3I9SA 1Q2YA 2CNSA 2AE6A 2P6EA 1M1DA 2CNMA 3CXQA 4JWPA 2PC1A 1K4JA 4CGMA 2GIVA 1IYKA 2DXQA 4U9YA 1NSLA 2GE3A 2PQ8A 3TO6A 2F5IA 1Z9UA 1S60A 3TO7A 4OAEA 3FYNA 3ZJ0A 1M44A 3D2PA 4ONUA 2B3UA 4XPDC 3VWDA 4Q36A 5IX3A 4KOUA 3E0KA 3R1KA 1QSTA 2VZZA 4UFWA 4KVXA 3S6HA 2Q4YA 2REFA 4RS2A 1YLEA 4MJ8A 3RYOA 4F0XA 4CGLA 3D2MA 4B13A 1XF8A 4EVYA 2Z3PA 4R9MA 4C2YA 3LODA 2Q04A 4MFKA 4CYOA 4MFQA 4BBHA 1QSNA 4XNHB 3W91A 1I1DA 3F8KA 4YRHA 5JQ4A 1NMTA 3W6SA 3C26A 2REEA 2J8NA 4R57A 3JUWA 3FXTA 2B5GA 1MK4A 3DR6A 5F48A 1S7KA 3P2HA 2VQYA 4II9A 4Y49C 2X7BA 2HV2A 3G3SA 4AB7A 2ATRA 2BUEA 4KSAA 3R9GA 1M4IA 1YVKA 2H5MA 2I00A 1VKCA 1QSOA 4CGNA 2JDCA 2YGWA 2Z3MA 4CYNA 2ZW5A 3MGDA 4R3LA 3PZJA 4CRZB 4Q38A 4GS4A 4KLWA 4AVBA 5A28A 1R57A 2CXAA 4JD6A 5KTCA 2EVNA 2DPTA 2Q0YA 4NXYA 1IB1E 4C2XA 4RI1A 5GCNA 3SXNA 2DPSA 1J4JA 4FD4A 2P0WA 2B3VA 3S6GA 3SHPA 1WWZA 2EUIA 4CS0B 2ZXVA 3WR7A 2J8RA 5C88A 3S6KA 5EBVA 3EC4A 1ZO0A 4YGOA 4C68A 3R96A 2B58A 1YVOA 4U9ZA 4CAWA 1Q2DA 3EXNA 4K30A 4UWJA 1L0CA 1Y9WA 3BJ7A 5H84A 1N71A 4UWIA 1Z4EA 5G20A 2QIRA 2R8VA 1TIQA 1YK3A 1RXTA 5ISVA 1NE9A 2B4BA 3TOBA 1VHSA 1YREA 3IWGA 4JXRA 4M3SA 2JDDA 2OH1A 4H89A 4F6AA 2D4PA 3TTHA 1IYLA 4PSWA 4PK2A 4KVOE 3FBUA 4I49A 2WPXA 3TE4A 1P0HA 4MY0A 4DNCA 1Y7RA 4XPDB 5G21A 1MJAA 4B11A 4OADA 2FIWA 5CNPA 4HKFA 2VEZA 3B8GA 4CYQA 4CAEA 3DNSA 2Q4VA 1B87A 3IU2A 1CJWA 2Z3KA 4OLLA 4MFJA 4A2ZA 1LRZA 3S6FA 2QMLA 2B4DB 4UCMA 2YNDA 5EC4A 3T9YA 3GYAA 2WSAA 2JEVA 2PR1A 4KVME 2FE7A 4PSXA 3EY5A 4NSQA 5G1ZA 2WUUA 4R3KA 4KOTA 1Z4RA 2B4DA 3I3GA 1WK4A 4XPKA 5AGEA 4MY3A 4C7IA 4YFJA 4PK3A 4L89A 4B14A 4M85A 4B5PB 3QB8A 1S7LA 3P2FA 4QBJA 5I0CA 2R7HA 4JJXA 3TT2A 4X5KA 2D4OA 2CY2A 4Y49B 3NE7A 4AVAA 5AG6A 5DWNA 2YNCC 2OB0A 4R87A 2FCKA 4ZBGA 4LUAA 5FVJA 4L8AA 2HUZA 1XEBA 3GKRA 1KUXA 3CXPA 1IICA 3K9UA 3EFAA 1MJ9A 3FIXA 2A4NA 1V0CA 3D8PA 2NMTA 4MHDA 4MFLA 4BMHA 1S7NA 4NEXA 1U6MA 2OZHA 1XMTA 3IU1A 2ZW7A 2PSWA 4AVCA 2C27A 4KLVA 5G22A 5J8FA 2PDOA 2KCWA 2Y0MA 4UFXA 5AG5A 4A30A 2ZPAA 3PGPA 4A31A 2VBQA 5IB0A 4CYPA 4UFVA 3W6XA 1YGHA 1YX0A 2PR8A 4LX9A 4F0YA 4JLYA 3GY9A 2Z3NA 3F5BA 5BWAB 4ORFA 5H86A 4B10A 4FD6A 1CM0A 4XPLA 3LD2A 4CAVA 4FD5A 2VXKA 3DDDA 2FL4A 3D3SA 2FIAA 4HNWB 4B5OA 3F0AA 2FSRA 2FS5A 4HNYB 2BSWA 4C7HA 4UBRA 2FT0A 4PV6A 1YR0A 5E96A 3SXOA 2VZYA 3IWEA 2WPWA 1XE4A 2Q44A 1KUYA 4E2AA 2Z3OA 3DR8A 2RC4A 1SQHA 1I12A 2ARHA 1KUVA 2K5TA 2JLMA 4CGOA 4KOWA 1M4DA 5C82A 5IV0A 2Z11A 1ON0A 3BJ8A 2Z0ZA 4CRYB 2Q7BA 3VWEA 1IIDA 3G8WA 2PRBA 4UA3A 2I79A 2OU2A 4A33A 4KOYA 1PUAA 4MFPA 4A95A 4C2ZA 1M4GA 3A9LA 4H6UA 2GANA 4ZGYB 4J3GA 4NF1A 1XIXA 2J8MA 3JTKA 2HQYA 5JPHA 4KS9A 3TCVA 2BEIA 4KZTA 3UY5A 3BLNA 1BOBA 2Z3LA 3FNCA 5F49A 4MFZA 3R9FA 1P4NA 4QC6A 4KUAA 4XNHC 2B5GB 4B5PA 3PP9A 4B12A 4AG9A 1I21A 1Q2CA 5F47A 3IGRA 1MJBA 4MBUA 1FY7A 2BL1A 2YNCA 3JVNA 2G3AA 5DWMA 4KORA 2ZW6A 2R1IA 4A32A 3R95A 4NCZA 1QSRA 2VI7A 1S3ZA 3FRMA 4IUSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P6F A;  4KOX A;  3ZZI A;  1PU9 A;  2G3T A;  3R9E A;  3H4Q A;  1UFH A;  3TOA A;  5HMN A;  1B6B A;  3N7Z A;  1RO5 A;  4E8O A;  4QB9 A;  1GHE A;  1OZP A;  2QEC A;  3TO9 A;  1S5K A;  4KOS A;  4JXQ A;  2FXF A;  2Z10 A;  2OZG A;  4FD7 A;  3OWC A;  4U5Y A;  4CAX A;  4HNX B;  3TFY A;  2ZW4 A;  4IF5 A;  4KOV A;  1KZF A;  3QAH A;  2R98 A;  2O28 A;  2G0B A;  2OZU A;  5J8C A;  2P6G A;  4QVT A;  3KKW A;  1QSM A;  2AJ6 A;  1BO4 A;  5HH1 A;  3V8I A;  4MI4 A;  5KTA A;  4QUS A;  5F46 A;  3DSB A;  3EO4 A;  4KUB A;  4H6Z A;  5KTD A;  4E0A A;  1Y9K A;  2CNT A;  4AG7 A;  1S7F A;  2IL4 A;  3T90 A;  3FB3 A;  3CXS A;  3I9S A;  1Q2Y A;  2CNS A;  2AE6 A;  2P6E A;  1M1D A;  2CNM A;  3CXQ A;  4JWP A;  2PC1 A;  1K4J A;  2GIV A;  1IYK A;  2DXQ A;  4U9Y A;  1NSL A;  2GE3 A;  2PQ8 A;  3TO6 A;  2F5I A;  1Z9U A;  1S60 A;  3TO7 A;  4OAE A;  3FYN A;  3ZJ0 A;  1M44 A;  3D2P A;  4ONU A;  2B3U A;  4XPD C;  3VWD A;  5IX3 A;  4KOU A;  3E0K A;  3R1K A;  1QST A;  2VZZ A;  4KVX A;  3S6H A;  2Q4Y A;  2REF A;  4RS2 A;  1YLE A;  4MJ8 A;  3RYO A;  3D2M A;  1XF8 A;  4EVY A;  4R9M A;  3LOD A;  2Q04 A;  1QSN A;  4XNH B;  3W91 A;  1I1D A;  3F8K A;  4YRH A;  5JQ4 A;  1NMT A;  3W6S A;  3C26 A;  2REE A;  2J8N A;  4R57 A;  3JUW A;  3FXT A;  2B5G A;  1MK4 A;  3DR6 A;  5F48 A;  1S7K A;  3P2H A;  2VQY A;  4II9 A;  4Y49 C;  2X7B A;  2HV2 A;  3G3S A;  4AB7 A;  2ATR A;  2BUE A;  3R9G A;  1M4I A;  1YVK A;  2H5M A;  2I00 A;  1VKC A;  1QSO A;  2JDC A;  2ZW5 A;  3MGD A;  4R3L A;  3PZJ A;  4CRZ B;  4GS4 A;  4KLW A;  4AVB A;  1R57 A;  4JD6 A;  5KTC A;  2EVN A;  2Q0Y A;  4NXY A;  1IB1 E;  4RI1 A;  5GCN A;  3SXN A;  1J4J A;  4FD4 A;  2P0W A;  2B3V A;  3S6G A;  3SHP A;  1WWZ A;  2EUI A;  4CS0 B;  2ZXV A;  3WR7 A;  2J8R A;  5C88 A;  3S6K A;  5EBV A;  3EC4 A;  4YGO A;  3R96 A;  2B58 A;  1YVO A;  4U9Z A;  4CAW A;  1Q2D A;  3EXN A;  4K30 A;  4UWJ A;  1L0C A;  1Y9W A;  3BJ7 A;  5H84 A;  1N71 A;  4UWI A;  1Z4E A;  2QIR A;  2R8V A;  1TIQ A;  1YK3 A;  1RXT A;  5ISV A;  1NE9 A;  2B4B A;  3TOB A;  1VHS A;  1YRE A;  3IWG A;  4JXR A;  4M3S A;  2JDD A;  2OH1 A;  4H89 A;  4F6A A;  2D4P A;  3TTH A;  1IYL A;  4PSW A;  4PK2 A;  4KVO E;  3FBU A;  4I49 A;  2WPX A;  3TE4 A;  1P0H A;  4MY0 A;  4DNC A;  1Y7R A;  4XPD B;  1MJA A;  4OAD A;  2FIW A;  5CNP A;  4HKF A;  2VEZ A;  3B8G A;  3DNS A;  2Q4V A;  1B87 A;  1CJW A;  4OLL A;  1LRZ A;  3S6F A;  2QML A;  2B4D B;  5EC4 A;  3T9Y A;  3GYA A;  2JEV A;  2PR1 A;  4KVM E;  2FE7 A;  4PSX A;  3EY5 A;  4NSQ A;  4R3K A;  4KOT A;  1Z4R A;  2B4D A;  3I3G A;  1WK4 A;  4XPK A;  4MY3 A;  4YFJ A;  4PK3 A;  4L89 A;  4M85 A;  4B5P B;  3QB8 A;  1S7L A;  3P2F A;  4QBJ A;  5I0C A;  2R7H A;  4JJX A;  3TT2 A;  4X5K A;  2D4O A;  2CY2 A;  4Y49 B;  3NE7 A;  4AVA A;  5DWN A;  2OB0 A;  4R87 A;  2FCK A;  4ZBG A;  4LUA A;  5FVJ A;  4L8A A;  2HUZ A;  1XEB A;  3GKR A;  1KUX A;  3CXP A;  1IIC A;  3K9U A;  3EFA A;  1MJ9 A;  3FIX A;  2A4N A;  1V0C A;  3D8P A;  2NMT A;  4MHD A;  4BMH A;  1S7N A;  4NEX A;  1U6M A;  2OZH A;  1XMT A;  2ZW7 A;  2PSW A;  4AVC A;  2C27 A;  4KLV A;  5J8F A;  2PDO A;  2KCW A;  2Y0M A;  2ZPA A;  3PGP A;  2VBQ A;  5IB0 A;  3W6X A;  1YGH A;  1YX0 A;  2PR8 A;  4LX9 A;  4F0Y A;  4JLY A;  3GY9 A;  3F5B A;  4ORF A;  5H86 A;  4FD6 A;  1CM0 A;  4XPL A;  3LD2 A;  4CAV A;  4FD5 A;  2VXK A;  3DDD A;  2FL4 A;  3D3S A;  2FIA A;  4HNW B;  4B5O A;  3F0A A;  2FSR A;  2FS5 A;  4HNY B;  2BSW A;  4UBR A;  2FT0 A;  4PV6 A;  1YR0 A;  5E96 A;  3SXO A;  2VZY A;  2WPW A;  1XE4 A;  2Q44 A;  1KUY A;  4E2A A;  3DR8 A;  2RC4 A;  1SQH A;  1I12 A;  2ARH A;  1KUV A;  2K5T A;  2JLM A;  4KOW A;  1M4D A;  5C82 A;  5IV0 A;  2Z11 A;  1ON0 A;  3BJ8 A;  2Z0Z A;  4CRY B;  2Q7B A;  3VWE A;  1IID A;  3G8W A;  2PRB A;  4UA3 A;  2I79 A;  2OU2 A;  4KOY A;  1PUA A;  1M4G A;  4H6U A;  2GAN A;  4J3G A;  4NF1 A;  1XIX A;  2J8M A;  2HQY A;  5JPH A;  3TCV A;  2BEI A;  4KZT A;  3UY5 A;  3BLN A;  1BOB A;  3FNC A;  5F49 A;  3R9F A;  1P4N A;  4QC6 A;  4KUA A;  4XNH C;  2B5G B;  4B5P A;  3PP9 A;  4AG9 A;  1I21 A;  1Q2C A;  5F47 A;  3IGR A;  1MJB A;  4MBU A;  1FY7 A;  2BL1 A;  3JVN A;  2G3A A;  5DWM A;  4KOR A;  2ZW6 A;  2R1I A;  3R95 A;  4NCZ A;  1QSR A;  2VI7 A;  1S3Z A;  3FRM A;  4IUS A; 
#chains in the Genus database with same CATH topology
 2EBJ A;  2P6F A;  1VGY A;  1XMB A;  4KOX A;  3ZZI A;  1PU9 A;  1Y0R A;  2G3T A;  3R9E A;  4FBE A;  2VL1 A;  3H4Q A;  3H5Z A;  1UFH A;  3PRT A;  3TOA A;  5HMN A;  5K8O A;  1B6B A;  3N7Z A;  1RO5 A;  4E8O A;  4F8Z A;  4W9Y A;  4QB9 A;  5IB9 A;  3KL9 A;  3B2Y A;  1GHE A;  5A27 A;  1CPX A;  1OZP A;  2QEC A;  3BXM A;  3TO9 A;  1S5K A;  2O4H A;  1BPM A;  2ANP A;  4JXQ A;  2FXF A;  2IJZ A;  4KOS A;  4YWY A;  2Z10 A;  4OID A;  2NSM A;  4P6Y A;  2OZG A;  3KI9 A;  4FD7 A;  3OWC A;  4P4F A;  4U5Y A;  4UCP A;  3D7H A;  4CAX A;  4HNX B;  2QVP A;  2YNE A;  3TFY A;  4CAF A;  5LRG A;  2ZW4 A;  4IF5 A;  3D7F A;  4Z65 A;  4KOV A;  5AG4 A;  1KZF A;  3QAH A;  2OOT A;  2R98 A;  4KSF A;  4OKO A;  2O28 A;  4UEE A;  2G0B A;  1XBU A;  2OZU A;  5J8C A;  3PFO A;  2ZOG A;  2P6G A;  3RO0 A;  4QVT A;  3KKW A;  5J1Q A;  1QSM A;  3WC6 A;  1TKJ A;  2AJ6 A;  1BO4 A;  4OC2 A;  5HH1 A;  3V8I A;  2AFO A;  3N5F A;  2CTC A;  4MI4 A;  5AG7 A;  3GB0 A;  5DS0 A;  4ZI6 A;  5KTA A;  4QUS A;  5F46 A;  3KQZ A;  3DSB A;  3EO4 A;  2ZEP A;  4CGP A;  4KUB A;  4H6Z A;  2ZEE A;  4FUU A;  5KTD A;  4UCN A;  4AXV A;  3DLJ A;  3IWW A;  6CPA A;  4E0A A;  3NE8 A;  1Y9K A;  2CNT A;  3PB7 X;  1S7F A;  2IL4 A;  4ZY2 A;  1CP6 A;  3T90 A;  2ZED A;  4AG7 A;  3FB3 A;  3CXS A;  2AFZ A;  3I9S A;  1Q2Y A;  2CNS A;  2AE6 A;  2P6E A;  1IOF A;  1M1D A;  2CNM A;  2RB7 A;  4RUH A;  3CXQ A;  4JWP A;  3PB8 X;  4M6I A;  2PC1 A;  1K4J A;  4CGM A;  2GIV A;  1IYK A;  2DXQ A;  3KHX A;  4RN7 A;  4U9Y A;  2IMO A;  4P10 A;  1NSL A;  2GE3 A;  2PQ8 A;  4MCR A;  3TO6 A;  2F5I A;  1Z9U A;  1S60 A;  2PJ5 A;  3TO7 A;  1IU8 A;  4OAE A;  3FYN A;  2AFW A;  3KR4 A;  4P4E A;  3VAT A;  3IEH A;  3ZJ0 A;  4F9V A;  1M44 A;  3D2P A;  2EK9 A;  2B3U A;  4ONU A;  4X8I A;  2HB6 A;  4XPD C;  2FVG A;  1HDQ A;  3B35 A;  3VWD A;  2V8H A;  3CPX A;  4Q36 A;  2PJB A;  5IX3 A;  4KOU A;  3E0K A;  2XEI A;  4OC3 A;  3R1K A;  1QST A;  4NJR A;  4NGQ A;  4P4J A;  2VZZ A;  4UFW A;  2IQ6 A;  5K8N A;  3D7D A;  4KVX A;  3S6H A;  2Q4Y A;  2REF A;  2C6P A;  5THW A;  4RS2 A;  1YLE A;  3FMC A;  4MJ8 A;  3RYO A;  4F0X A;  3KQX A;  4CGL A;  3D2M A;  4B13 A;  4CPA A;  1XF8 A;  3PFE A;  3DGV A;  4EVY A;  3LMS A;  2Z3P A;  4R9M A;  4C2Y A;  3IJ3 A;  3LOD A;  4OC4 A;  3SI1 A;  4NGS A;  5K8M A;  2Q04 A;  2PJ4 A;  4MFK A;  2EO8 A;  2J9A A;  4IHM A;  4R6T A;  4CYO A;  2WZN A;  4MFQ A;  4BBH A;  4MCS A;  1QSN A;  4XNH B;  5LYI A;  4JYW A;  1I1D A;  3W91 A;  3F8K A;  7CPA A;  4YRH A;  5JQ4 A;  1NMT A;  4UF4 A;  4UEF A;  3W6S A;  3S9L A;  3C26 A;  4R7M A;  1R43 A;  2REE A;  2J8N A;  4R57 A;  2V77 A;  3FXT A;  3JUW A;  1Z8W A;  2B5G A;  1FNO A;  3D67 A;  3CT9 A;  1MK4 A;  1VIX A;  3DR6 A;  5F48 A;  3PB6 X;  5JGF A;  1S7K A;  3SJX A;  3P2H A;  5HVF A;  2EK8 A;  2VQY A;  4II9 A;  4Y49 C;  2X7B A;  5D8N A;  2AFU A;  2O53 A;  1XFO A;  2HV2 A;  3G3S A;  4AB7 A;  2ATR A;  2BUE A;  4KSA A;  3R9G A;  3NA6 A;  1Z5R A;  1M4I A;  1Z2L A;  1YVK A;  2H5M A;  2I00 A;  2PJ8 A;  3PB4 X;  1VKC A;  1QSO A;  2ZEN A;  4CGN A;  2Q7S A;  2JDC A;  2YGW A;  2Z3M A;  3BI0 A;  4TNU A;  3HLP A;  4EWT A;  2ABZ A;  4CYN A;  2ZW5 A;  3MGD A;  4P4D A;  3PZJ A;  4R3L A;  4ZYQ A;  3MN8 A;  4ZY0 A;  4MCQ A;  4YU9 A;  4CRZ B;  4MRI A;  4Q38 A;  3D66 A;  4GS4 A;  2QYV A;  1AYE A;  4KLW A;  4AVB A;  2V8V A;  1Y7E A;  1ZLH A;  2PCU A;  5A28 A;  4B6Z A;  4OC1 A;  1R57 A;  4IAV A;  2CXA A;  4JD6 A;  2V8D A;  5KTC A;  3KZW A;  2Q51 A;  3FX6 A;  4ZX9 A;  2EVN A;  2DPT A;  2Q0Y A;  4NXY A;  1IB1 E;  1CP7 A;  3GUX A;  2PJ3 A;  4RI1 A;  2C1C A;  2DPS A;  5GCN A;  1J4J A;  4FD4 A;  3SXN A;  1JQG A;  2P0W A;  2B3V A;  1TF9 A;  2CIJ A;  3JRU A;  3S6G A;  3SHP A;  1WWZ A;  2EUI A;  3I1U A;  4CS0 B;  2ZXV A;  4IK2 A;  2AFX A;  1Y0Y A;  2F7V A;  1F57 A;  3WR7 A;  3H8F A;  2J8R A;  5C88 A;  3S6K A;  2AFM A;  1AMP A;  1YQE A;  1ZO0 A;  3EC4 A;  2PIY A;  4YGO A;  5EBV A;  4C68 A;  3R96 A;  2DEA A;  2XEF A;  2B58 A;  1YVO A;  4U9Z A;  4CAW A;  1Q2D A;  3EXN A;  3GLJ A;  4K30 A;  4UWJ A;  3BI1 A;  1L0C A;  4JZ0 A;  3V7Z A;  3VAR A;  1YW6 A;  1Y9W A;  3BJ7 A;  3LAC A;  5H84 A;  1N71 A;  2PVV A;  4UIA A;  4UWI A;  4FWU A;  3FJU A;  1XJO A;  1Z4E A;  5G20 A;  2GLJ A;  2QIR A;  4A38 A;  5JM6 A;  2R8V A;  1TIQ A;  1YK3 A;  4BD9 A;  1RXT A;  2CF4 A;  5ISV A;  1ZG7 A;  1NE9 A;  2B4B A;  4Q7A A;  3K2K A;  3TOB A;  1ELL P;  1VHS A;  3GIU A;  1YRE A;  4BIN A;  3IWG A;  4R8F A;  3D7G A;  1QQ9 A;  3B3W A;  4JXR A;  2ZEF A;  4M3S A;  2ZEO A;  2G9D A;  4OC0 A;  2JDD A;  2OH1 A;  2PJ0 A;  4H89 A;  4F6A A;  1QMU A;  1XRY A;  1AUG A;  2D4P A;  3TTH A;  1IYL A;  4PSW A;  4PK2 A;  4KVO E;  3FBU A;  4DUK A;  4OP4 A;  4FAI A;  4I49 A;  2WPX A;  3TE4 A;  4UEZ A;  3S9M A;  4DYO A;  4H2K A;  1P0H A;  4MY0 A;  4DNC A;  1Y7R A;  1YW4 A;  2PIZ A;  4XPD B;  2JBK A;  2ZEH A;  5G21 A;  1MJA A;  1YME A;  4OAD A;  4B11 A;  4GM5 A;  1LAN A;  4GXH A;  2FIW A;  5CNP A;  3QAY A;  4HKF A;  2VEZ A;  3B8G A;  1ZG8 A;  3PBB A;  4CYQ A;  5JH9 A;  2PJ1 A;  2BCO A;  2XEG A;  3BHX A;  3DNS A;  3FEE A;  4CAE A;  2Q4V A;  1KWM A;  1B87 A;  3IU2 A;  4EFD A;  1CJW A;  2Z3K A;  4OLL A;  4MFJ A;  3IC1 A;  4A2Z A;  1LRZ A;  4NGM A;  1BAV A;  4OC5 A;  3S6F A;  4MHP A;  3D4U A;  2QML A;  2B4D B;  4UCM A;  2YND A;  5EC4 A;  3ISX A;  3GYA A;  3T9Y A;  2OR4 A;  2PJ7 A;  2WSA A;  1RTQ A;  2JEV A;  2PR1 A;  3NFZ A;  2FE7 A;  4KVM E;  4PSX A;  3EY5 A;  4NSQ A;  2GLF A;  3KHZ A;  5G1Z A;  2WUU A;  4R3K A;  1H8L A;  3SJE A;  4KOT A;  1Z4R A;  3H8E A;  2B4D A;  1CPS A;  3I3G A;  4LQ6 A;  1WK4 A;  3B3S A;  2Q43 A;  4P4B A;  2DF5 A;  4XPK A;  3FH4 A;  5AGE A;  4MY3 A;  4C7I A;  4PXE A;  4MXU A;  4YFJ A;  4PK3 A;  4L89 A;  4UIB A;  4M85 A;  4B14 A;  4EME A;  4B5P B;  1Z8L A;  3QB8 A;  1S7L A;  1UWY A;  3P2F A;  4QBJ A;  2Q4Z A;  5I0C A;  1IOI A;  4X3R A;  2R7H A;  3LWU A;  4JJX A;  3TT2 A;  3B3C A;  4X5K A;  2D4O A;  2V8G A;  2CY2 A;  3WC7 A;  4Y49 B;  3HUV A;  3NE7 A;  4AVA A;  5LRK A;  5AG6 A;  5DWN A;  2BOA A;  2YNC C;  3NH5 A;  1Z8T A;  2OB0 A;  3B3V A;  4R87 A;  3PEI A;  2FCK A;  2NYQ A;  4ZBG A;  4LUA A;  5FVJ A;  2GRE A;  4A94 A;  4L8A A;  2HUZ A;  1XEB A;  3FF3 A;  1KUX A;  2POK A;  3CXP A;  1IIC A;  1ARL A;  1FT7 A;  1X12 A;  3GKR A;  3KGQ A;  3L2N A;  3IIB A;  3RBU A;  1EE3 P;  3K9U A;  4ZX8 A;  3VH9 A;  4LQG A;  2PVW A;  3EFA A;  1MJ9 A;  3IO1 A;  3FIX A;  2A4N A;  1V0C A;  2ODF A;  3D8P A;  2NMT A;  4MHD A;  4MFL A;  4BMH A;  3MRU A;  1S7N A;  4PXC A;  4NEX A;  1U6M A;  2F8H A;  1TXR A;  2OZH A;  3IFE A;  4NGT A;  1XMT A;  3IU1 A;  2PJ9 A;  1X10 A;  1ELM P;  2ZW7 A;  2PSW A;  2GFQ A;  4A37 A;  4AVC A;  2PE3 A;  2GU2 A;  2PJ2 A;  2C27 A;  3RNZ A;  4KLV A;  4P4I A;  5G22 A;  3SI2 A;  5J8F A;  1CX8 A;  2PDO A;  1LAM A;  2KCW A;  5LYF A;  2WYR A;  2PJA A;  2AFS A;  2Y0M A;  4UFX A;  5AG5 A;  3SI0 A;  4A30 A;  2ZPA A;  3PGP A;  4A31 A;  2VBQ A;  5IB0 A;  4CYP A;  2RFH A;  4UFV A;  4OIW A;  4PQA A;  3W6X A;  1YGH A;  1YX0 A;  4P45 A;  2PR8 A;  3K9T A;  4LX9 A;  4F0Y A;  5LYL A;  4JLY A;  3GY9 A;  2Z3N A;  3F5B A;  5BWA B;  4ORF A;  5H86 A;  3RZA A;  3WAB A;  4B10 A;  1IY7 A;  3KAS A;  4FD6 A;  1CM0 A;  1OBR A;  1ZG9 A;  4XPL A;  3LD2 A;  4CAV A;  4FD5 A;  2VXK A;  3DDD A;  2FL4 A;  3D3S A;  5CPA A;  2FIA A;  3SJG A;  4HNW B;  1ARM A;  1NSA A;  4KSI A;  4B5O A;  1LFW A;  3F0A A;  1DE4 C;  2FSR A;  2FS5 A;  3B7I A;  4HNY B;  1TF8 A;  3NH8 A;  1BPN A;  2BSW A;  3CPA A;  4C7H A;  3QNV A;  4UBR A;  2FT0 A;  4NJQ A;  3CDX A;  4PV6 A;  1YR0 A;  2ZEG A;  5E96 A;  3SXO A;  3CZX A;  2VZY A;  1VHO A;  1R3N A;  3IWE A;  2WPW A;  5LYD A;  1XE4 A;  4F9U A;  2Q44 A;  1KUY A;  4E2A A;  1M4L A;  2Z3O A;  4PXB A;  4MCP A;  2JBJ A;  4M6H A;  3PB9 X;  1Q7L A;  3DR8 A;  2RC4 A;  4PPZ A;  2BO9 A;  1SQH A;  4P44 A;  3SJF A;  1I12 A;  2ARH A;  1KUV A;  1XOV A;  1F2O A;  2JLM A;  2K5T A;  4CGO A;  4MHY A;  4KOW A;  2ZEL A;  1TKH A;  4WJB A;  1M4D A;  5C82 A;  1Z8X A;  1JWQ A;  2I3C A;  2Z11 A;  1ON0 A;  3BJ8 A;  2Z0Z A;  5IV0 A;  4CRY B;  3S9N A;  1PCA A;  1GYT A;  2ZOF A;  2Q7B A;  4MHN A;  4DJL A;  5EMI A;  3VWE A;  1IID A;  3G8W A;  5ELY A;  4C2X A;  1HDU A;  2PJ6 A;  2PRB A;  2I79 A;  4UA3 A;  2OU2 A;  1A2Z A;  2C6C A;  4A33 A;  2PRQ A;  1ZLI A;  4KOY A;  1PUA A;  4MFP A;  4A95 A;  4C2Z A;  1M4G A;  3A9L A;  4TWE A;  3T8W A;  4H6U A;  2GAN A;  4ZGY B;  4J3G A;  4NF1 A;  4NGR A;  1YLO A;  1XIX A;  2J8M A;  2JEW A;  3JTK A;  2HQY A;  1BLL E;  4NGN A;  3TX8 A;  5JPH A;  5LRJ A;  4KS9 A;  4NFR A;  3TCV A;  2ZEM A;  2BEI A;  4G1P A;  4KZT A;  4WWV A;  3UY5 A;  1LCP A;  3BLN A;  3FED A;  1BOB A;  2Z3L A;  3FNC A;  1LOK A;  5F49 A;  1IGB A;  4R76 A;  3KR5 A;  3NH4 A;  4MFZ A;  3B3T A;  3PBE A;  3H8G A;  3R9F A;  1P4N A;  5D29 A;  4QC6 A;  4KUA A;  4XNH C;  2B5G B;  4MHZ A;  5K8P A;  4B5P A;  3FEC A;  3PP9 A;  4B12 A;  4AG9 A;  1I21 A;  4X2T A;  4A39 A;  1Q2C A;  4O23 A;  1PYT B;  4M6G A;  5HXD A;  2CTB A;  1DTD A;  1TKF A;  3V38 A;  5HVG A;  3FVL A;  4NGP A;  8CPA A;  5F09 A;  1LAP A;  5F47 A;  3IGR A;  1MJB A;  2QJ8 A;  4MBU A;  1YSJ A;  1CBX A;  4PXD A;  1F2P A;  1FY7 A;  5HVH A;  2BL1 A;  5I4M A;  2HC9 A;  2YNC A;  3JVN A;  2G3A A;  4K3N A;  5DWM A;  4ONW A;  1CG2 A;  3RAM A;  5CBM A;  2XEJ A;  2EWB A;  3ISZ A;  4MMO A;  3D68 A;  2PJC A;  4KOR A;  3WC5 A;  2ZW6 A;  1VHE A;  2R1I A;  3WT4 A;  4A32 A;  3R95 A;  4NCZ A;  1HEE A;  1QSR A;  3TC8 A;  2VI7 A;  4HPS A;  4OME A;  4ZY1 A;  1S3Z A;  3FRM A;  4IUS A;  2C6G A; 
#chains in the Genus database with same CATH homology
 2P6F A;  4KOX A;  3ZZI A;  1PU9 A;  2G3T A;  3R9E A;  3H4Q A;  3H5Z A;  1UFH A;  3TOA A;  5HMN A;  1B6B A;  3N7Z A;  1RO5 A;  4E8O A;  4QB9 A;  1GHE A;  5A27 A;  1OZP A;  2QEC A;  3TO9 A;  1S5K A;  4KOS A;  4JXQ A;  2FXF A;  2Z10 A;  2OZG A;  4FD7 A;  3OWC A;  4U5Y A;  4UCP A;  4CAX A;  4HNX B;  2YNE A;  3TFY A;  4CAF A;  2ZW4 A;  4IF5 A;  4KOV A;  5AG4 A;  1KZF A;  3QAH A;  2R98 A;  4KSF A;  2O28 A;  2G0B A;  2OZU A;  5J8C A;  2P6G A;  4QVT A;  3KKW A;  1QSM A;  2AJ6 A;  1BO4 A;  5HH1 A;  3V8I A;  4MI4 A;  5AG7 A;  5KTA A;  4QUS A;  5F46 A;  3DSB A;  3EO4 A;  4CGP A;  4KUB A;  4H6Z A;  5KTD A;  4UCN A;  4E0A A;  1Y9K A;  2CNT A;  4AG7 A;  1S7F A;  2IL4 A;  3T90 A;  3FB3 A;  3CXS A;  3I9S A;  1Q2Y A;  2CNS A;  2AE6 A;  2P6E A;  1M1D A;  2CNM A;  3CXQ A;  4JWP A;  2PC1 A;  1K4J A;  4CGM A;  2GIV A;  1IYK A;  2DXQ A;  4U9Y A;  1NSL A;  2GE3 A;  2PQ8 A;  3TO6 A;  2F5I A;  1Z9U A;  1S60 A;  3TO7 A;  4OAE A;  3FYN A;  3ZJ0 A;  1M44 A;  3D2P A;  4ONU A;  2B3U A;  4XPD C;  3VWD A;  4Q36 A;  5IX3 A;  4KOU A;  3E0K A;  3R1K A;  1QST A;  2VZZ A;  4UFW A;  4KVX A;  3S6H A;  2Q4Y A;  2REF A;  4RS2 A;  1YLE A;  4MJ8 A;  3RYO A;  4F0X A;  4CGL A;  3D2M A;  4B13 A;  1XF8 A;  4EVY A;  2Z3P A;  4R9M A;  4C2Y A;  3LOD A;  2Q04 A;  4MFK A;  4CYO A;  4MFQ A;  4BBH A;  1QSN A;  4XNH B;  3W91 A;  1I1D A;  3F8K A;  4YRH A;  5JQ4 A;  1NMT A;  3W6S A;  3C26 A;  2REE A;  2J8N A;  4R57 A;  3JUW A;  3FXT A;  2B5G A;  1MK4 A;  3DR6 A;  5F48 A;  1S7K A;  3P2H A;  2VQY A;  4II9 A;  4Y49 C;  2X7B A;  2HV2 A;  3G3S A;  4AB7 A;  2ATR A;  2BUE A;  4KSA A;  3R9G A;  1M4I A;  1YVK A;  2H5M A;  2I00 A;  1VKC A;  1QSO A;  4CGN A;  2JDC A;  2YGW A;  2Z3M A;  4CYN A;  2ZW5 A;  3MGD A;  4R3L A;  3PZJ A;  4CRZ B;  4Q38 A;  4GS4 A;  4KLW A;  4AVB A;  5A28 A;  1R57 A;  2CXA A;  4JD6 A;  5KTC A;  2EVN A;  2DPT A;  2Q0Y A;  4NXY A;  1IB1 E;  4C2X A;  4RI1 A;  5GCN A;  3SXN A;  2DPS A;  1J4J A;  4FD4 A;  2P0W A;  2B3V A;  3S6G A;  3SHP A;  1WWZ A;  2EUI A;  4CS0 B;  2ZXV A;  3WR7 A;  2J8R A;  5C88 A;  3S6K A;  5EBV A;  3EC4 A;  1ZO0 A;  4YGO A;  4C68 A;  3R96 A;  2B58 A;  1YVO A;  4U9Z A;  4CAW A;  1Q2D A;  3EXN A;  4K30 A;  4UWJ A;  1L0C A;  1Y9W A;  3BJ7 A;  5H84 A;  1N71 A;  4UWI A;  1Z4E A;  5G20 A;  2QIR A;  2R8V A;  1TIQ A;  1YK3 A;  1RXT A;  5ISV A;  1NE9 A;  2B4B A;  3TOB A;  1VHS A;  1YRE A;  3IWG A;  4JXR A;  4M3S A;  2JDD A;  2OH1 A;  4H89 A;  4F6A A;  2D4P A;  3TTH A;  1IYL A;  4PSW A;  4PK2 A;  4KVO E;  3FBU A;  4I49 A;  2WPX A;  3TE4 A;  1P0H A;  4MY0 A;  4DNC A;  1Y7R A;  4XPD B;  5G21 A;  1MJA A;  4B11 A;  4OAD A;  2FIW A;  5CNP A;  4HKF A;  2VEZ A;  3B8G A;  4CYQ A;  4CAE A;  3DNS A;  2Q4V A;  1B87 A;  3IU2 A;  1CJW A;  2Z3K A;  4OLL A;  4MFJ A;  4A2Z A;  1LRZ A;  3S6F A;  2QML A;  2B4D B;  4UCM A;  2YND A;  5EC4 A;  3T9Y A;  3GYA A;  2WSA A;  2JEV A;  2PR1 A;  4KVM E;  2FE7 A;  4PSX A;  3EY5 A;  4NSQ A;  5G1Z A;  2WUU A;  4R3K A;  4KOT A;  1Z4R A;  2B4D A;  3I3G A;  1WK4 A;  4XPK A;  5AGE A;  4MY3 A;  4C7I A;  4YFJ A;  4PK3 A;  4L89 A;  4B14 A;  4M85 A;  4B5P B;  3QB8 A;  1S7L A;  3P2F A;  4QBJ A;  5I0C A;  2R7H A;  4JJX A;  3TT2 A;  4X5K A;  2D4O A;  2CY2 A;  4Y49 B;  3NE7 A;  4AVA A;  5AG6 A;  5DWN A;  2YNC C;  2OB0 A;  4R87 A;  2FCK A;  4ZBG A;  4LUA A;  5FVJ A;  4L8A A;  2HUZ A;  1XEB A;  3GKR A;  1KUX A;  3CXP A;  1IIC A;  3K9U A;  3EFA A;  1MJ9 A;  3FIX A;  2A4N A;  1V0C A;  3D8P A;  2NMT A;  4MHD A;  4MFL A;  4BMH A;  1S7N A;  4NEX A;  1U6M A;  2OZH A;  1XMT A;  3IU1 A;  2ZW7 A;  2PSW A;  4AVC A;  2C27 A;  4KLV A;  5G22 A;  5J8F A;  2PDO A;  2KCW A;  2Y0M A;  4UFX A;  5AG5 A;  4A30 A;  2ZPA A;  3PGP A;  4A31 A;  2VBQ A;  5IB0 A;  4CYP A;  4UFV A;  3W6X A;  1YGH A;  1YX0 A;  2PR8 A;  4LX9 A;  4F0Y A;  4JLY A;  3GY9 A;  2Z3N A;  3F5B A;  5BWA B;  4ORF A;  5H86 A;  4B10 A;  4FD6 A;  1CM0 A;  4XPL A;  3LD2 A;  4CAV A;  4FD5 A;  2VXK A;  3DDD A;  2FL4 A;  3D3S A;  2FIA A;  4HNW B;  4B5O A;  3F0A A;  2FSR A;  2FS5 A;  4HNY B;  2BSW A;  4C7H A;  4UBR A;  2FT0 A;  4PV6 A;  1YR0 A;  5E96 A;  3SXO A;  2VZY A;  3IWE A;  2WPW A;  1XE4 A;  2Q44 A;  1KUY A;  4E2A A;  2Z3O A;  3DR8 A;  2RC4 A;  1SQH A;  1I12 A;  2ARH A;  1KUV A;  2K5T A;  2JLM A;  4CGO A;  4KOW A;  1M4D A;  5C82 A;  5IV0 A;  2Z11 A;  1ON0 A;  3BJ8 A;  2Z0Z A;  4CRY B;  2Q7B A;  3VWE A;  1IID A;  3G8W A;  2PRB A;  4UA3 A;  2I79 A;  2OU2 A;  4A33 A;  4KOY A;  1PUA A;  4MFP A;  4A95 A;  4C2Z A;  1M4G A;  3A9L A;  4H6U A;  2GAN A;  4ZGY B;  4J3G A;  4NF1 A;  1XIX A;  2J8M A;  3JTK A;  2HQY A;  5JPH A;  4KS9 A;  3TCV A;  2BEI A;  4KZT A;  3UY5 A;  3BLN A;  1BOB A;  2Z3L A;  3FNC A;  5F49 A;  4MFZ A;  3R9F A;  1P4N A;  4QC6 A;  4KUA A;  4XNH C;  2B5G B;  4B5P A;  3PP9 A;  4B12 A;  4AG9 A;  1I21 A;  1Q2C A;  5F47 A;  3IGR A;  1MJB A;  4MBU A;  1FY7 A;  2BL1 A;  2YNC A;  3JVN A;  2G3A A;  5DWM A;  4KOR A;  2ZW6 A;  2R1I A;  4A32 A;  3R95 A;  4NCZ A;  1QSR A;  2VI7 A;  1S3Z A;  3FRM A;  4IUS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...